F436951

General Info

Members Datasets Scaffolds Average Seq Length
409 180 818 136

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100113368|Ga0070716_1001133682
Length 141
Sequence MIMKNTILICLGMALSAFTARADLNDIFFDRPFFHHTDTLAARDDWGLLHQSRTTVYETDFASRYHPRAAYYGMSGRELITQPAYVGALQRDLARLGYYCGPIDGVFSDEVGEAIASLQKNYSMRVTGTLTIPVRRVLHLP

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.85
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 46.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100113368 3300006173 Bacteria 1684
2 JGI25406J46586_10025293 3300003203 Bacteria 2307
3 Ga0065704_10011195 3300005289 Unclassified 2270
4 Ga0065704_10041449 3300005289 Bacteria 751
5 Ga0065704_10099678 3300005289 Bacteria 2302
6 Ga0065704_10519765 3300005289 Unclassified 654
7 Ga0065712_10003757 3300005290 Bacteria 3842
8 Ga0065712_10164394 3300005290 Bacteria 1281
9 Ga0065712_10168924 3300005290 Unclassified 1251
10 Ga0065715_10000366 3300005293 Bacteria 13153
11 Ga0065715_10011434 3300005293 Bacteria 2088
12 Ga0065715_10013044 3300005293 Bacteria 4487
13 Ga0065707_10020950 3300005295 Bacteria 1986
14 Ga0065707_10352930 3300005295 Bacteria 866
15 Ga0070676_10001264 3300005328 Bacteria 12723
16 Ga0070676_10012713 3300005328 Unclassified 4603
17 Ga0070676_10090146 3300005328 Bacteria 1877
18 Ga0070690_100006834 3300005330 Bacteria 6490
19 Ga0070690_100454169 3300005330 Unclassified 951
20 Ga0070670_100677708 3300005331 Unclassified 926
21 Ga0070677_10008280 3300005333 Bacteria 3495
22 Ga0068869_100123963 3300005334 Bacteria 1979
23 Ga0068869_100315588 3300005334 Unclassified 1266
24 Ga0070666_10050656 3300005335 Bacteria 2793
25 Ga0068868_100076390 3300005338 Bacteria 2678
26 Ga0068868_100148438 3300005338 Bacteria 1929
27 Ga0068868_100621552 3300005338 Unclassified 959
28 Ga0068868_101817272 3300005338 Bacteria 576
29 Ga0070660_100404505 3300005339 Unclassified 1129
30 Ga0070689_100064491 3300005340 Unclassified 2851
31 Ga0070689_100077554 3300005340 Bacteria 2604
32 Ga0070689_100342337 3300005340 Unclassified 1252
33 Ga0070687_100264763 3300005343 Unclassified 1075
34 Ga0070668_100012274 3300005347 Bacteria 6384
35 Ga0070668_100038408 3300005347 Bacteria 3659
36 Ga0070668_100043459 3300005347 Bacteria 3446
37 Ga0070668_100252150 3300005347 Unclassified 1465
38 Ga0070669_100009880 3300005353 Bacteria 6797
39 Ga0070669_100031785 3300005353 Bacteria 3812
40 Ga0070669_101296548 3300005353 Unclassified 631
41 Ga0070675_100002918 3300005354 Bacteria 12888
42 Ga0070675_100409086 3300005354 Unclassified 1211
43 Ga0070671_100044116 3300005355 Bacteria 3705
44 Ga0070671_100931400 3300005355 Unclassified 760
45 Ga0070674_100142531 3300005356 Bacteria 1800
46 Ga0070674_100210558 3300005356 Unclassified 1506
47 Ga0070674_100219454 3300005356 Unclassified 1478
48 Ga0070674_100420275 3300005356 Bacteria 1097
49 Ga0070673_100334492 3300005364 Unclassified 1340
50 Ga0070673_101406200 3300005364 Unclassified 657
51 Ga0070673_101797494 3300005364 Unclassified 581
52 Ga0070688_100027187 3300005365 Unclassified 3406
53 Ga0070688_100299122 3300005365 Unclassified 1163
54 Ga0070659_100008583 3300005366 Bacteria 7470
55 Ga0070667_100020430 3300005367 Bacteria 5497
56 Ga0070667_100089902 3300005367 Bacteria 2638
57 Ga0070709_10048827 3300005434 Bacteria 2643
58 Ga0070709_10421431 3300005434 Unclassified 1000
59 Ga0070709_10781821 3300005434 Unclassified 748
60 Ga0070709_10900272 3300005434 Unclassified 700
61 Ga0070714_100165740 3300005435 Unclassified 2002
62 Ga0070714_100504044 3300005435 Bacteria 1154
63 Ga0070714_100643371 3300005435 Unclassified 1020
64 Ga0070713_100046699 3300005436 Bacteria 3554
65 Ga0070713_100179117 3300005436 Unclassified 1903
66 Ga0070713_100357845 3300005436 Unclassified 1355
67 Ga0070713_101099437 3300005436 Bacteria 768
68 Ga0070713_101705078 3300005436 Unclassified 612
69 Ga0070710_10809918 3300005437 Unclassified 670
70 Ga0070711_100003037 3300005439 Bacteria 9706
71 Ga0070711_100008834 3300005439 Bacteria 6184
72 Ga0070711_100064776 3300005439 Bacteria 2555
73 Ga0070711_100154537 3300005439 Unclassified 1733
74 Ga0070711_100648527 3300005439 Unclassified 885
75 Ga0070705_100008609 3300005440 Bacteria 5054
76 Ga0070705_100102872 3300005440 Bacteria 1807
77 Ga0070705_100184990 3300005440 Bacteria 1414
78 Ga0070705_100714145 3300005440 Unclassified 789
79 Ga0070705_100972752 3300005440 Unclassified 687
80 Ga0070694_101846454 3300005444 Unclassified 515
81 Ga0070708_100120860 3300005445 Bacteria 2416
82 Ga0070708_100124675 3300005445 Bacteria 2379
83 Ga0070708_100177625 3300005445 Bacteria 1990
84 Ga0070708_100185040 3300005445 Bacteria 1948
85 Ga0070708_100323803 3300005445 Bacteria 1452
86 Ga0070708_100412173 3300005445 Bacteria 1274
87 Ga0070708_100576019 3300005445 Unclassified 1061
88 Ga0070708_102069162 3300005445 Unclassified 527
89 Ga0070678_100063593 3300005456 Bacteria 2731
90 Ga0070678_100214549 3300005456 Unclassified 1597
91 Ga0070662_100013790 3300005457 Bacteria 5383
92 Ga0070662_100145019 3300005457 Bacteria 1844
93 Ga0068867_100237276 3300005459 Unclassified 1477
94 Ga0068867_100578523 3300005459 Unclassified 976
95 Ga0068867_100727636 3300005459 Unclassified 878
96 Ga0070706_100000011 3300005467 Bacteria 198585
97 Ga0070706_100015234 3300005467 Bacteria 7097
98 Ga0070706_100048155 3300005467 Unclassified 3934
99 Ga0070706_100095009 3300005467 Bacteria 2766
100 Ga0070706_100113607 3300005467 Unclassified 2522
101 Ga0070706_100132527 3300005467 Bacteria 2326
102 Ga0070706_101304453 3300005467 Unclassified 666
103 Ga0070707_100003264 3300005468 Bacteria 15375
104 Ga0070707_100006453 3300005468 Bacteria 10902
105 Ga0070707_100010011 3300005468 Bacteria 8822
106 Ga0070707_100018215 3300005468 Bacteria 6608
107 Ga0070707_100030710 3300005468 Bacteria 5117
108 Ga0070707_100276099 3300005468 Unclassified 1634
109 Ga0070707_100290754 3300005468 Bacteria 1588
110 Ga0070707_100335596 3300005468 Unclassified 1469
111 Ga0070707_100636995 3300005468 Unclassified 1029
112 Ga0070707_100705361 3300005468 Bacteria 972
113 Ga0070707_100796679 3300005468 Unclassified 909
114 Ga0070707_101142040 3300005468 Bacteria 745
115 Ga0070707_101215699 3300005468 Unclassified 720
116 Ga0070707_101227027 3300005468 Unclassified 716
117 Ga0070707_101344516 3300005468 Bacteria 681
118 Ga0070698_100011652 3300005471 Bacteria 9326
119 Ga0070698_100060820 3300005471 Bacteria 3810
120 Ga0070698_100177488 3300005471 Bacteria 2069
121 Ga0070698_100306623 3300005471 Bacteria 1518
122 Ga0070698_100572849 3300005471 Bacteria 1069
123 Ga0070699_100112074 3300005518 Bacteria 2396
124 Ga0070699_101082910 3300005518 Unclassified 735
125 Ga0070699_101223152 3300005518 Unclassified 689
126 Ga0070699_101998546 3300005518 Unclassified 530
127 Ga0070697_100003939 3300005536 Bacteria 11406
128 Ga0070697_100012922 3300005536 Bacteria 6541
129 Ga0070697_100069224 3300005536 Bacteria 2890
130 Ga0070697_100102732 3300005536 Bacteria 2375
131 Ga0070697_100198822 3300005536 Bacteria 1704
132 Ga0070697_100232941 3300005536 Bacteria 1571
133 Ga0070697_100253084 3300005536 Bacteria 1506
134 Ga0070697_100330126 3300005536 Unclassified 1315
135 Ga0070697_100741579 3300005536 Unclassified 868
136 Ga0070697_101049619 3300005536 Unclassified 725
137 Ga0068853_101256690 3300005539 Unclassified 715
138 Ga0070672_100031291 3300005543 Bacteria 4004
139 Ga0070672_100136721 3300005543 Unclassified 2019
140 Ga0070696_100076181 3300005546 Bacteria 2368
141 Ga0070693_100186757 3300005547 Unclassified 1338
142 Ga0070693_100593716 3300005547 Bacteria 798
143 Ga0070704_100317628 3300005549 Unclassified 1304
144 Ga0070664_101289588 3300005564 Unclassified 690
145 Ga0068856_100221662 3300005614 Bacteria 1907
146 Ga0070702_100320291 3300005615 Unclassified 1080
147 Ga0068859_101740638 3300005617 Unclassified 688
148 Ga0068864_101074890 3300005618 Unclassified 800
149 Ga0068866_10477653 3300005718 Unclassified 820
150 Ga0068863_100686660 3300005841 Unclassified 1017
151 Ga0068858_100641977 3300005842 Unclassified 1031
152 Ga0068860_100093196 3300005843 Bacteria 2870
153 Ga0068862_100260770 3300005844 Unclassified 1582
154 Ga0081455_10096630 3300005937 Bacteria 2382
155 Ga0081455_10137590 3300005937 Unclassified 1901
156 Ga0081455_10307715 3300005937 Unclassified 1134
157 Ga0081455_10835738 3300005937 Bacteria 576
158 Ga0081540_1281115 3300005983 Unclassified 574
159 Ga0081539_10005046 3300005985 Bacteria 13877
160 Ga0081539_10088746 3300005985 Unclassified 1603
161 Ga0070717_10005613 3300006028 Bacteria 9165
162 Ga0070717_10023216 3300006028 Bacteria 4912
163 Ga0070717_10128631 3300006028 Unclassified 2176
164 Ga0070717_10162155 3300006028 Bacteria 1940
165 Ga0070717_10170488 3300006028 Unclassified 1893
166 Ga0070717_10405318 3300006028 Bacteria 1225
167 Ga0070717_10644404 3300006028 Bacteria 961
168 Ga0070715_10154907 3300006163 Bacteria 1126
169 Ga0070715_10735382 3300006163 Unclassified 593
170 Ga0070716_100036188 3300006173 Bacteria 2720
171 Ga0070716_100261437 3300006173 Unclassified 1184
172 Ga0070716_100959015 3300006173 Unclassified 674
173 Ga0070712_100023477 3300006175 Bacteria 4075
174 Ga0070712_100073605 3300006175 Bacteria 2451
175 Ga0070712_100218477 3300006175 Bacteria 1507
176 Ga0097621_101914307 3300006237 Bacteria 566
177 Ga0068871_101576912 3300006358 Bacteria 621
178 Ga0075428_101475536 3300006844 Unclassified 713
179 Ga0075434_100116783 3300006871 Bacteria 2681
180 Ga0075434_100372393 3300006871 Unclassified 1449
181 Ga0068865_100081524 3300006881 Bacteria 2323
182 Ga0068865_100379662 3300006881 Bacteria 1152
183 Ga0068865_100571552 3300006881 Unclassified 952
184 Ga0097620_101741576 3300006931 Unclassified 688
185 Ga0075435_100048216 3300007076 Bacteria 3422
186 Ga0075435_100564735 3300007076 Unclassified 986
187 Ga0099794_10091551 3300007265 Bacteria 1509
188 Ga0099795_10048190 3300007788 Bacteria 1542
189 Ga0099795_10081172 3300007788 Unclassified 1241
190 Ga0099795_10284263 3300007788 Bacteria 723
191 Ga0105240_10287396 3300009093 Unclassified 1887
192 Ga0111539_10383498 3300009094 Unclassified 1636
193 Ga0105245_10103143 3300009098 Bacteria 2642
194 Ga0105245_10107032 3300009098 Bacteria 2596
195 Ga0105247_10415597 3300009101 Unclassified 962
196 Ga0114129_10465345 3300009147 Bacteria 1657
197 Ga0114129_10670013 3300009147 Bacteria 1337
198 Ga0105241_10606155 3300009174 Bacteria 990
199 Ga0105242_10098978 3300009176 Bacteria 2468
200 Ga0105237_10515463 3300009545 Unclassified 1202
201 Ga0105249_10014022 3300009553 Bacteria 7084
202 Ga0099796_10278022 3300010159 Bacteria 703
203 Ga0105239_10052235 3300010375 Bacteria 4481
204 Ga0105246_10313924 3300011119 Unclassified 1271
205 Ga0105246_11477347 3300011119 Unclassified 637
206 Ga0157339_1020664 3300012505 Unclassified 696
207 Ga0157374_10009751 3300013296 Bacteria 8246
208 Ga0157374_10095719 3300013296 Unclassified 2839
209 Ga0157374_10142810 3300013296 Bacteria 2324
210 Ga0157374_10200637 3300013296 Bacteria 1953
211 Ga0157374_10294989 3300013296 Unclassified 1603
212 Ga0157374_10666446 3300013296 Unclassified 1053
213 Ga0157374_11299035 3300013296 Unclassified 750
214 Ga0157378_10003216 3300013297 Bacteria 14524
215 Ga0157378_10029799 3300013297 Bacteria 4819
216 Ga0157378_10088056 3300013297 Bacteria 2817
217 Ga0157378_10245018 3300013297 Bacteria 1714
218 Ga0157378_10411410 3300013297 Bacteria 1335
219 Ga0157378_11735828 3300013297 Bacteria 672
220 Ga0157378_12324544 3300013297 Unclassified 588
221 Ga0163162_10004005 3300013306 Bacteria 14138
222 Ga0163162_10069417 3300013306 Unclassified 3576
223 Ga0163162_10149106 3300013306 Bacteria 2456
224 Ga0157372_10017929 3300013307 Bacteria 7608
225 Ga0157372_10295947 3300013307 Bacteria 1882
226 Ga0157372_11061294 3300013307 Unclassified 938
227 Ga0157372_12564258 3300013307 Unclassified 585
228 Ga0157375_10100147 3300013308 Bacteria 2978
229 Ga0157375_10496404 3300013308 Unclassified 1385
230 Ga0157375_13021606 3300013308 Unclassified 562
231 Ga0157375_13240163 3300013308 Unclassified 543
232 Ga0163163_10122636 3300014325 Bacteria 2633
233 Ga0182008_10035460 3300014497 Bacteria 2498
234 Ga0157379_10126517 3300014968 Bacteria 2299
235 Ga0157376_10157770 3300014969 Unclassified 2054
236 Ga0182006_1023128 3300015261 Bacteria 2576
237 Ga0163161_10012894 3300017792 Bacteria 5808
238 Ga0207666_1006048 3300025271 Unclassified 1561
239 Ga0207673_1021859 3300025290 Unclassified 867
240 Ga0207697_10000555 3300025315 Bacteria 21125
241 Ga0207697_10003172 3300025315 Bacteria 8184
242 Ga0207697_10085194 3300025315 Bacteria 1335
243 Ga0207697_10142476 3300025315 Unclassified 1040
244 Ga0207692_10039684 3300025898 Bacteria 2318
245 Ga0207692_10386822 3300025898 Unclassified 869
246 Ga0207688_10003739 3300025901 Bacteria 8303
247 Ga0207680_10184452 3300025903 Bacteria 1413
248 Ga0207685_10021989 3300025905 Bacteria 2147
249 Ga0207685_10055948 3300025905 Bacteria 1542
250 Ga0207699_10071767 3300025906 Unclassified 2119
251 Ga0207699_10220208 3300025906 Unclassified 1295
252 Ga0207699_10487925 3300025906 Unclassified 888
253 Ga0207699_10842681 3300025906 Unclassified 675
254 Ga0207645_10001030 3300025907 Bacteria 23008
255 Ga0207645_10001403 3300025907 Bacteria 19722
256 Ga0207684_10000052 3300025910 Bacteria 228510
257 Ga0207684_10007877 3300025910 Bacteria 9530
258 Ga0207684_10015782 3300025910 Bacteria 6497
259 Ga0207684_10070498 3300025910 Bacteria 2971
260 Ga0207684_10120854 3300025910 Bacteria 2246
261 Ga0207684_10152643 3300025910 Unclassified 1987
262 Ga0207684_10228939 3300025910 Bacteria 1604
263 Ga0207684_10286564 3300025910 Bacteria 1420
264 Ga0207684_10574771 3300025910 Unclassified 963
265 Ga0207684_10583067 3300025910 Bacteria 956
266 Ga0207693_10003493 3300025915 Bacteria 13414
267 Ga0207693_10042427 3300025915 Bacteria 3581
268 Ga0207693_10055515 3300025915 Unclassified 3107
269 Ga0207693_10108644 3300025915 Bacteria 2176
270 Ga0207693_10136198 3300025915 Bacteria 1931
271 Ga0207663_10002317 3300025916 Bacteria 9127
272 Ga0207663_10011030 3300025916 Bacteria 4834
273 Ga0207663_10160500 3300025916 Bacteria 1586
274 Ga0207663_10173797 3300025916 Bacteria 1532
275 Ga0207663_10536311 3300025916 Unclassified 913
276 Ga0207663_11117199 3300025916 Unclassified 634
277 Ga0207662_10462577 3300025918 Unclassified 869
278 Ga0207646_10002783 3300025922 Bacteria 20397
279 Ga0207646_10035389 3300025922 Bacteria 4510
280 Ga0207646_10047295 3300025922 Bacteria 3858
281 Ga0207646_10101319 3300025922 Bacteria 2581
282 Ga0207646_10165775 3300025922 Unclassified 1994
283 Ga0207646_10266368 3300025922 Unclassified 1549
284 Ga0207646_10384320 3300025922 Unclassified 1268
285 Ga0207646_10453652 3300025922 Bacteria 1157
286 Ga0207646_10549358 3300025922 Unclassified 1039
287 Ga0207681_10024434 3300025923 Bacteria 3878
288 Ga0207681_10482716 3300025923 Unclassified 1012
289 Ga0207650_11010004 3300025925 Unclassified 708
290 Ga0207659_10143103 3300025926 Unclassified 1858
291 Ga0207659_11009141 3300025926 Unclassified 716
292 Ga0207687_10086119 3300025927 Bacteria 2281
293 Ga0207700_10081411 3300025928 Bacteria 2528
294 Ga0207700_10172971 3300025928 Bacteria 1803
295 Ga0207700_10270754 3300025928 Unclassified 1458
296 Ga0207664_10362983 3300025929 Unclassified 1283
297 Ga0207644_10104812 3300025931 Bacteria 2129
298 Ga0207644_10885171 3300025931 Unclassified 748
299 Ga0207690_10042687 3300025932 Bacteria 2980
300 Ga0207706_10003104 3300025933 Bacteria 15970
301 Ga0207706_10007545 3300025933 Bacteria 10066
302 Ga0207686_10169012 3300025934 Bacteria 1540
303 Ga0207670_10073573 3300025936 Unclassified 2370
304 Ga0207670_10141846 3300025936 Unclassified 1772
305 Ga0207670_10811104 3300025936 Unclassified 780
306 Ga0207669_10096395 3300025937 Bacteria 1941
307 Ga0207669_10109082 3300025937 Bacteria 1850
308 Ga0207669_10277260 3300025937 Bacteria 1263
309 Ga0207704_10160118 3300025938 Unclassified 1600
310 Ga0207704_10497541 3300025938 Unclassified 982
311 Ga0207704_10616006 3300025938 Unclassified 890
312 Ga0207665_10004509 3300025939 Bacteria 9239
313 Ga0207665_10065078 3300025939 Bacteria 2478
314 Ga0207665_11370015 3300025939 Unclassified 563
315 Ga0207691_10001070 3300025940 Bacteria 27238
316 Ga0207691_10064108 3300025940 Bacteria 3330
317 Ga0207689_10115923 3300025942 Unclassified 2202
318 Ga0207651_10348978 3300025960 Unclassified 1245
319 Ga0207651_10404647 3300025960 Bacteria 1162
320 Ga0207651_11189734 3300025960 Unclassified 684
321 Ga0207651_11817540 3300025960 Bacteria 548
322 Ga0207668_10070145 3300025972 Bacteria 2498
323 Ga0207668_11499185 3300025972 Unclassified 608
324 Ga0207658_10055381 3300025986 Bacteria 2938
325 Ga0207677_10031934 3300026023 Unclassified 3378
326 Ga0207677_10050934 3300026023 Bacteria 2804
327 Ga0207677_10390523 3300026023 Unclassified 1177
328 Ga0207703_12142379 3300026035 Unclassified 535
329 Ga0207702_10821748 3300026078 Unclassified 919
330 Ga0207648_10313296 3300026089 Unclassified 1409
331 Ga0207648_10396730 3300026089 Unclassified 1249
332 Ga0207648_10449123 3300026089 Unclassified 1174
333 Ga0207676_10149173 3300026095 Bacteria 2012
334 Ga0207683_10275944 3300026121 Unclassified 1536
335 Ga0209998_10028716 3300027717 Bacteria 1223
336 Ga0268265_10061258 3300028380 Bacteria 2887
337 Ga0268264_10069058 3300028381 Bacteria 2988
338 Ga0373926_0075182 3300035083 Unclassified 1245
339 Ga0373928_0080448 3300035084 Unclassified 821
340 Ga0373944_0252631 3300035089 Unclassified 651
341 Ga0373932_0451844 3300035112 Unclassified 505
342 Ga0373936_0318106 3300035113 Unclassified 705
343 Ga0373941_0132150 3300035115 Unclassified 900
344 Ga0373945_0087651 3300035116 Unclassified 1201
345 Ga0373945_0120624 3300035116 Unclassified 1042
346 Ga0373943_0015592 3300035170 Bacteria 3455
347 Ga0373943_0214584 3300035170 Unclassified 1070
348 Ga0373943_0621716 3300035170 Unclassified 637
349 Ga0373946_0048912 3300035171 Unclassified 1762
350 Ga0373946_0448840 3300035171 Unclassified 656
351 Ga0373931_0050888 3300035691 Bacteria 2205
352 Ga0373931_0203259 3300035691 Unclassified 1185
353 Ga0373935_0012218 3300035692 Bacteria 5164
354 Ga0373935_0376235 3300035692 Unclassified 1016
355 Ga0373935_0487858 3300035692 Unclassified 893
356 Ga0373927_0179957 3300035695 Bacteria 1387
357 Ga0373927_0225923 3300035695 Unclassified 1230
358 Ga0373927_0905395 3300035695 Unclassified 582
359 Ga0373947_0013096 3300035725 Bacteria 4754
360 Ga0373947_0444899 3300035725 Unclassified 877
361 Ga0373925_0110243 3300037068 Bacteria 2125
362 Ga0395900_0222881 3300037418 Bacteria 1900
363 Ga0395898_0967330 3300037466 Bacteria 788
364 Ga0395905_1035438 3300037471 Unclassified 724
365 Ga0436364_1489405 3300037853 Bacteria 1298
366 Ga0395901_0318775 3300038443 Bacteria 1609
367 Ga0451576_0029029 3300045051 Bacteria 5921
368 Ga0495580_0106458 3300046472 Unclassified 1948
369 Ga0495580_0581174 3300046472 Unclassified 742
370 Ga0495644_0045696 3300046523 Bacteria 1647
371 Ga0495598_0010470 3300046537 Bacteria 2222
372 Ga0495659_0220739 3300046664 Unclassified 783
373 Ga0495669_0087263 3300046684 Bacteria 1438
374 Ga0496100_0007040 3300048903 Bacteria 6171
375 Ga0496100_0029842 3300048903 Unclassified 3377
376 Ga0496101_0168489 3300048904 Bacteria 1682
377 Ga0496102_0053946 3300048905 Bacteria 3664
378 Ga0496102_0496509 3300048905 Unclassified 1142
379 Ga0496102_1974787 3300048905 Unclassified 500
380 Ga0496103_0023979 3300048906 Bacteria 3681
381 Ga0496104_0060730 3300048907 Bacteria 3581
382 Ga0496104_0683748 3300048907 Unclassified 934
383 Ga0496105_0035029 3300048908 Unclassified 4131
384 Ga0496106_0036270 3300048909 Bacteria 3688
385 Ga0496106_0599666 3300048909 Bacteria 882
386 Ga0496107_0000174 3300048910 Bacteria 33216
387 Ga0496107_1018701 3300048910 Unclassified 600
388 Ga0496108_0142510 3300048911 Unclassified 2065
389 Ga0496108_0190451 3300048911 Unclassified 1778
390 Ga0496108_0487597 3300048911 Bacteria 1077
391 Ga0496109_0322478 3300048912 Bacteria 1458
392 Ga0496109_0544550 3300048912 Unclassified 1095
393 Ga0496112_0127034 3300048915 Bacteria 2520
394 Ga0496112_1083763 3300048915 Unclassified 719
395 Ga0496113_0543397 3300048916 Unclassified 932
396 Ga0496114_1229341 3300048917 Unclassified 635
397 Ga0496114_1414311 3300048917 Unclassified 583
398 Ga0496115_0004373 3300048918 Bacteria 10232
399 Ga0496115_0009610 3300048918 Bacteria 7192
400 Ga0496115_0019273 3300048918 Bacteria 5249
401 Ga0496115_0679296 3300048918 Unclassified 811
402 nmdc:mga05p37_1391983_c1 3300050507 Unclassified 707
403 nmdc:mga05p37_352704_c1 3300050507 Bacteria 1732
404 nmdc:mga0n895_492918_c1 3300050512 Unclassified 1235
405 nmdc:mga0n895_62831_c1 3300050512 Unclassified 2381
406 nmdc:mga0n895_879821_c1 3300050512 Bacteria 882
407 nmdc:mga0rr50_582342_c1 3300050513 Unclassified 953
408 nmdc:mga0rr50_78445_c1 3300050513 Unclassified 2541
409 nmdc:mga0a205_924045_c1 3300050515 Unclassified 719
410 Ga0070716_100113368
411 JGI25406J46586_10025293
412 Ga0065704_10011195
413 Ga0065704_10041449
414 Ga0065704_10099678
415 Ga0065704_10519765
416 Ga0065712_10003757
417 Ga0065712_10164394
418 Ga0065712_10168924
419 Ga0065715_10000366
420 Ga0065715_10011434
421 Ga0065715_10013044
422 Ga0065707_10020950
423 Ga0065707_10352930
424 Ga0070676_10001264
425 Ga0070676_10012713
426 Ga0070676_10090146
427 Ga0070690_100006834
428 Ga0070690_100454169
429 Ga0070670_100677708
430 Ga0070677_10008280
431 Ga0068869_100123963
432 Ga0068869_100315588
433 Ga0070666_10050656
434 Ga0068868_100076390
435 Ga0068868_100148438
436 Ga0068868_100621552
437 Ga0068868_101817272
438 Ga0070660_100404505
439 Ga0070689_100064491
440 Ga0070689_100077554
441 Ga0070689_100342337
442 Ga0070687_100264763
443 Ga0070668_100012274
444 Ga0070668_100038408
445 Ga0070668_100043459
446 Ga0070668_100252150
447 Ga0070669_100009880
448 Ga0070669_100031785
449 Ga0070669_101296548
450 Ga0070675_100002918
451 Ga0070675_100409086
452 Ga0070671_100044116
453 Ga0070671_100931400
454 Ga0070674_100142531
455 Ga0070674_100210558
456 Ga0070674_100219454
457 Ga0070674_100420275
458 Ga0070673_100334492
459 Ga0070673_101406200
460 Ga0070673_101797494
461 Ga0070688_100027187
462 Ga0070688_100299122
463 Ga0070659_100008583
464 Ga0070667_100020430
465 Ga0070667_100089902
466 Ga0070709_10048827
467 Ga0070709_10421431
468 Ga0070709_10781821
469 Ga0070709_10900272
470 Ga0070714_100165740
471 Ga0070714_100504044
472 Ga0070714_100643371
473 Ga0070713_100046699
474 Ga0070713_100179117
475 Ga0070713_100357845
476 Ga0070713_101099437
477 Ga0070713_101705078
478 Ga0070710_10809918
479 Ga0070711_100003037
480 Ga0070711_100008834
481 Ga0070711_100064776
482 Ga0070711_100154537
483 Ga0070711_100648527
484 Ga0070705_100008609
485 Ga0070705_100102872
486 Ga0070705_100184990
487 Ga0070705_100714145
488 Ga0070705_100972752
489 Ga0070694_101846454
490 Ga0070708_100120860
491 Ga0070708_100124675
492 Ga0070708_100177625
493 Ga0070708_100185040
494 Ga0070708_100323803
495 Ga0070708_100412173
496 Ga0070708_100576019
497 Ga0070708_102069162
498 Ga0070678_100063593
499 Ga0070678_100214549
500 Ga0070662_100013790
501 Ga0070662_100145019
502 Ga0068867_100237276
503 Ga0068867_100578523
504 Ga0068867_100727636
505 Ga0070706_100000011
506 Ga0070706_100015234
507 Ga0070706_100048155
508 Ga0070706_100095009
509 Ga0070706_100113607
510 Ga0070706_100132527
511 Ga0070706_101304453
512 Ga0070707_100003264
513 Ga0070707_100006453
514 Ga0070707_100010011
515 Ga0070707_100018215
516 Ga0070707_100030710
517 Ga0070707_100276099
518 Ga0070707_100290754
519 Ga0070707_100335596
520 Ga0070707_100636995
521 Ga0070707_100705361
522 Ga0070707_100796679
523 Ga0070707_101142040
524 Ga0070707_101215699
525 Ga0070707_101227027
526 Ga0070707_101344516
527 Ga0070698_100011652
528 Ga0070698_100060820
529 Ga0070698_100177488
530 Ga0070698_100306623
531 Ga0070698_100572849
532 Ga0070699_100112074
533 Ga0070699_101082910
534 Ga0070699_101223152
535 Ga0070699_101998546
536 Ga0070697_100003939
537 Ga0070697_100012922
538 Ga0070697_100069224
539 Ga0070697_100102732
540 Ga0070697_100198822
541 Ga0070697_100232941
542 Ga0070697_100253084
543 Ga0070697_100330126
544 Ga0070697_100741579
545 Ga0070697_101049619
546 Ga0068853_101256690
547 Ga0070672_100031291
548 Ga0070672_100136721
549 Ga0070696_100076181
550 Ga0070693_100186757
551 Ga0070693_100593716
552 Ga0070704_100317628
553 Ga0070664_101289588
554 Ga0068856_100221662
555 Ga0070702_100320291
556 Ga0068859_101740638
557 Ga0068864_101074890
558 Ga0068866_10477653
559 Ga0068863_100686660
560 Ga0068858_100641977
561 Ga0068860_100093196
562 Ga0068862_100260770
563 Ga0081455_10096630
564 Ga0081455_10137590
565 Ga0081455_10307715
566 Ga0081455_10835738
567 Ga0081540_1281115
568 Ga0081539_10005046
569 Ga0081539_10088746
570 Ga0070717_10005613
571 Ga0070717_10023216
572 Ga0070717_10128631
573 Ga0070717_10162155
574 Ga0070717_10170488
575 Ga0070717_10405318
576 Ga0070717_10644404
577 Ga0070715_10154907
578 Ga0070715_10735382
579 Ga0070716_100036188
580 Ga0070716_100261437
581 Ga0070716_100959015
582 Ga0070712_100023477
583 Ga0070712_100073605
584 Ga0070712_100218477
585 Ga0097621_101914307
586 Ga0068871_101576912
587 Ga0075428_101475536
588 Ga0075434_100116783
589 Ga0075434_100372393
590 Ga0068865_100081524
591 Ga0068865_100379662
592 Ga0068865_100571552
593 Ga0097620_101741576
594 Ga0075435_100048216
595 Ga0075435_100564735
596 Ga0099794_10091551
597 Ga0099795_10048190
598 Ga0099795_10081172
599 Ga0099795_10284263
600 Ga0105240_10287396
601 Ga0111539_10383498
602 Ga0105245_10103143
603 Ga0105245_10107032
604 Ga0105247_10415597
605 Ga0114129_10465345
606 Ga0114129_10670013
607 Ga0105241_10606155
608 Ga0105242_10098978
609 Ga0105237_10515463
610 Ga0105249_10014022
611 Ga0099796_10278022
612 Ga0105239_10052235
613 Ga0105246_10313924
614 Ga0105246_11477347
615 Ga0157339_1020664
616 Ga0157374_10009751
617 Ga0157374_10095719
618 Ga0157374_10142810
619 Ga0157374_10200637
620 Ga0157374_10294989
621 Ga0157374_10666446
622 Ga0157374_11299035
623 Ga0157378_10003216
624 Ga0157378_10029799
625 Ga0157378_10088056
626 Ga0157378_10245018
627 Ga0157378_10411410
628 Ga0157378_11735828
629 Ga0157378_12324544
630 Ga0163162_10004005
631 Ga0163162_10069417
632 Ga0163162_10149106
633 Ga0157372_10017929
634 Ga0157372_10295947
635 Ga0157372_11061294
636 Ga0157372_12564258
637 Ga0157375_10100147
638 Ga0157375_10496404
639 Ga0157375_13021606
640 Ga0157375_13240163
641 Ga0163163_10122636
642 Ga0182008_10035460
643 Ga0157379_10126517
644 Ga0157376_10157770
645 Ga0182006_1023128
646 Ga0163161_10012894
647 Ga0207666_1006048
648 Ga0207673_1021859
649 Ga0207697_10000555
650 Ga0207697_10003172
651 Ga0207697_10085194
652 Ga0207697_10142476
653 Ga0207692_10039684
654 Ga0207692_10386822
655 Ga0207688_10003739
656 Ga0207680_10184452
657 Ga0207685_10021989
658 Ga0207685_10055948
659 Ga0207699_10071767
660 Ga0207699_10220208
661 Ga0207699_10487925
662 Ga0207699_10842681
663 Ga0207645_10001030
664 Ga0207645_10001403
665 Ga0207684_10000052
666 Ga0207684_10007877
667 Ga0207684_10015782
668 Ga0207684_10070498
669 Ga0207684_10120854
670 Ga0207684_10152643
671 Ga0207684_10228939
672 Ga0207684_10286564
673 Ga0207684_10574771
674 Ga0207684_10583067
675 Ga0207693_10003493
676 Ga0207693_10042427
677 Ga0207693_10055515
678 Ga0207693_10108644
679 Ga0207693_10136198
680 Ga0207663_10002317
681 Ga0207663_10011030
682 Ga0207663_10160500
683 Ga0207663_10173797
684 Ga0207663_10536311
685 Ga0207663_11117199
686 Ga0207662_10462577
687 Ga0207646_10002783
688 Ga0207646_10035389
689 Ga0207646_10047295
690 Ga0207646_10101319
691 Ga0207646_10165775
692 Ga0207646_10266368
693 Ga0207646_10384320
694 Ga0207646_10453652
695 Ga0207646_10549358
696 Ga0207681_10024434
697 Ga0207681_10482716
698 Ga0207650_11010004
699 Ga0207659_10143103
700 Ga0207659_11009141
701 Ga0207687_10086119
702 Ga0207700_10081411
703 Ga0207700_10172971
704 Ga0207700_10270754
705 Ga0207664_10362983
706 Ga0207644_10104812
707 Ga0207644_10885171
708 Ga0207690_10042687
709 Ga0207706_10003104
710 Ga0207706_10007545
711 Ga0207686_10169012
712 Ga0207670_10073573
713 Ga0207670_10141846
714 Ga0207670_10811104
715 Ga0207669_10096395
716 Ga0207669_10109082
717 Ga0207669_10277260
718 Ga0207704_10160118
719 Ga0207704_10497541
720 Ga0207704_10616006
721 Ga0207665_10004509
722 Ga0207665_10065078
723 Ga0207665_11370015
724 Ga0207691_10001070
725 Ga0207691_10064108
726 Ga0207689_10115923
727 Ga0207651_10348978
728 Ga0207651_10404647
729 Ga0207651_11189734
730 Ga0207651_11817540
731 Ga0207668_10070145
732 Ga0207668_11499185
733 Ga0207658_10055381
734 Ga0207677_10031934
735 Ga0207677_10050934
736 Ga0207677_10390523
737 Ga0207703_12142379
738 Ga0207702_10821748
739 Ga0207648_10313296
740 Ga0207648_10396730
741 Ga0207648_10449123
742 Ga0207676_10149173
743 Ga0207683_10275944
744 Ga0209998_10028716
745 Ga0268265_10061258
746 Ga0268264_10069058
747 Ga0373926_0075182
748 Ga0373928_0080448
749 Ga0373944_0252631
750 Ga0373932_0451844
751 Ga0373936_0318106
752 Ga0373941_0132150
753 Ga0373945_0087651
754 Ga0373945_0120624
755 Ga0373943_0015592
756 Ga0373943_0214584
757 Ga0373943_0621716
758 Ga0373946_0048912
759 Ga0373946_0448840
760 Ga0373931_0050888
761 Ga0373931_0203259
762 Ga0373935_0012218
763 Ga0373935_0376235
764 Ga0373935_0487858
765 Ga0373927_0179957
766 Ga0373927_0225923
767 Ga0373927_0905395
768 Ga0373947_0013096
769 Ga0373947_0444899
770 Ga0373925_0110243
771 Ga0395900_0222881
772 Ga0395898_0967330
773 Ga0395905_1035438
774 Ga0436364_1489405
775 Ga0395901_0318775
776 Ga0451576_0029029
777 Ga0495580_0106458
778 Ga0495580_0581174
779 Ga0495644_0045696
780 Ga0495598_0010470
781 Ga0495659_0220739
782 Ga0495669_0087263
783 Ga0496100_0007040
784 Ga0496100_0029842
785 Ga0496101_0168489
786 Ga0496102_0053946
787 Ga0496102_0496509
788 Ga0496102_1974787
789 Ga0496103_0023979
790 Ga0496104_0060730
791 Ga0496104_0683748
792 Ga0496105_0035029
793 Ga0496106_0036270
794 Ga0496106_0599666
795 Ga0496107_0000174
796 Ga0496107_1018701
797 Ga0496108_0142510
798 Ga0496108_0190451
799 Ga0496108_0487597
800 Ga0496109_0322478
801 Ga0496109_0544550
802 Ga0496112_0127034
803 Ga0496112_1083763
804 Ga0496113_0543397
805 Ga0496114_1229341
806 Ga0496114_1414311
807 Ga0496115_0004373
808 Ga0496115_0009610
809 Ga0496115_0019273
810 Ga0496115_0679296
811 nmdc:mga05p37_1391983_c1
812 nmdc:mga05p37_352704_c1
813 nmdc:mga0n895_492918_c1
814 nmdc:mga0n895_62831_c1
815 nmdc:mga0n895_879821_c1
816 nmdc:mga0rr50_582342_c1
817 nmdc:mga0rr50_78445_c1
818 nmdc:mga0a205_924045_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01471

PG_binding_1

Putative peptidoglycan binding domain

82

138

0.91

PF08823

PG_binding_2

Putative peptidoglycan binding domain

77

123

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tci-assembly1.cif.gz_A the crystal structure of sleb n-terminal domain 0.9642 83 137
4c2g-assembly1.cif.gz_A-2 crystal structure of ctpb(s309a) in complex with a peptide having a val-pro-ala c-terminus 0.9603 83 137
4c2f-assembly1.cif.gz_A crystal structure of the ctpb r168a mutant present in an active conformation 0.9568 84 137
4c2e-assembly1.cif.gz_B crystal structure of the protease ctpb(s309a) present in a resting state 0.9548 82 137
5nm7-assembly2.cif.gz_A crystal structure of burkholderia ap3 phage endolysin 0.9506 84 136
ID Description Score Start End Superfamily
af_I1N5Y3_46_297_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9335 84 134 3.40.390.10
3bkvA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.9265 84 137 1.10.101.10
af_I1J5F1_56_315_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9264 85 135 3.40.390.10
af_K7K641_72_302_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9226 84 134 3.40.390.10
af_D3ZRZ2_1_209_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9185 109 135 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A2V6CWQ3-F1-model_v4 Peptidoglycan binding-like domain-containing protein 0.995 80 139
AF-A0A316QKH3-F1-model_v4 Uncharacterized protein 0.9913 84 137 GO:0008234
AF-A0A6P0VRF7-F1-model_v4 Peptidoglycan-binding protein 0.9881 83 136
AF-A0A7C6BPB2-F1-model_v4 Peptidoglycan-binding protein 0.9881 84 137
AF-A0A2V6BH74-F1-model_v4 Peptidoglycan-binding protein 0.9877 84 139

Map