F436866

General Info

Members Datasets Scaffolds Average Seq Length
408 255 816 369

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862178590|2862182554
Length 418
Sequence PSREQPPRPTRHEPQRPGPDPVSDPAGRDPAAGAGAPAGRPRPDDSLIEHQHVPGAEPRRAARLDPLDGLRDPRDPACDVFLTGTVFLDIIFTGLDSAPVRGTESWARGMGSSPGGVANMATALARLGLRTSLAAAFGDDHYGEYCWDALEQGEGIDLSLSRTVPGWHSPVTVSMAYEGERTMVSHGHEAPHELSAPNCPPRARAAVASLEPGRREEWIADAARAGARIFADVGWDDTGRWDLAGLADLEHCEAFLPNAAEAMRYTRTDCPRAAARALAEKVPLAVVTLGSEGAYAVDAATGETADVPAIEVEALDPTGAGDVFVAGFVTGTLAGWPLADRLAFAGLTAALSVQEFGGSLSAPGWAEIAGWWEKVRTLRNQDPSALRRYAFLTDLLPGAARAWPLRRAVPTLGFRHPA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
24 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
36 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
41 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
42 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
43 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
44 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
45 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
77 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
110 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
152 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
153 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
160 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
161 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
162 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
163 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
164 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
165 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
166 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
167 2643221548 Streptomyces sp. Root55 Isolate Unclassified
168 2643221578 Streptomyces sp. Root63 Isolate Unclassified
169 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
170 2643221647 Streptomyces sp. Root369 Isolate Unclassified
171 2643221670 Streptomyces sp. Root431 Isolate Unclassified
172 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
173 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
174 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
175 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
176 2643221714 Streptomyces sp. Root264 Isolate Unclassified
177 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
178 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
179 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
180 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
181 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
182 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
183 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
184 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
185 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
186 2808606448 Streptomyces sp. 193411 Isolate Unclassified
187 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
188 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
189 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
190 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
191 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
192 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
193 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
194 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
195 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
196 2862574272 Streptomyces sp. AcE210 Isolate Nodule
197 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
198 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
199 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
200 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
201 2867369537 Streptomyces sp. Z26 Isolate Unclassified
202 2867428634 Streptomyces sp. RP5T Isolate Unclassified
203 2867475112 Streptomyces sp. TM32 Isolate Unclassified
204 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
205 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
206 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
207 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
208 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
209 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
210 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
211 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
212 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
213 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
214 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
215 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
216 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
217 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
218 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
219 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
220 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
221 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
222 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
223 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
224 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
225 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
226 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
227 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
228 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
229 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
230 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
231 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
232 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
233 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
234 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
235 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
236 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
237 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
238 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
239 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
240 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
241 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
242 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
243 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
244 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
245 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
246 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
247 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
248 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
249 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
250 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
251 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
252 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
253 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
254 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
255 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.25
Metatranscriptomes 0.25
Isolates 24.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 0.74
Rhizoplane 0.49
Rhizosphere 74.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10039559 3300003316 Bacteria 3456
2 rootH1_10071986 3300003316 Bacteria 2618
3 rootH2_10001113 3300003320 Bacteria 9047
4 rootL2_10003174 3300003322 Bacteria 4177
5 rootH1_10094896 3300003323 Bacteria 2233
6 JGI25160J50197_1030524 3300003354 Bacteria 1403
7 Ga0006562J51391_1073911 3300003578 Bacteria 2100
8 Ga0068854_100037244 3300005578 Bacteria 3413
9 Ga0068852_100054418 3300005616 Bacteria 3449
10 Ga0081455_10065216 3300005937 Bacteria 3047
11 Ga0105251_10027930 3300009011 Bacteria 2854
12 Ga0105243_10131343 3300009148 Bacteria 2124
13 Ga0105238_10025777 3300009551 Bacteria 5995
14 Ga0105238_10383930 3300009551 Bacteria 1396
15 Ga0105239_10676386 3300010375 Bacteria 1179
16 Ga0105246_10001974 3300011119 Bacteria 12366
17 Ga0157372_10110447 3300013307 Bacteria 3149
18 Ga0182008_10000271 3300014497 Bacteria 40629
19 Ga0182007_10001229 3300015262 Bacteria 13910
20 Ga0183367_1006 3300015688 Bacteria 648044
21 Ga0213875_10003855 3300021388 Bacteria 8412
22 Ga0213875_10004218 3300021388 Bacteria 7936
23 Ga0207426_1001582 3300025302 Bacteria 18293
24 Ga0207426_1004446 3300025302 Bacteria 6836
25 Ga0307517_10003237 3300028786 Bacteria 25516
26 Ga0307517_10003826 3300028786 Bacteria 23364
27 Ga0307515_10005972 3300028794 Bacteria 24531
28 Ga0307515_10123248 3300028794 Bacteria 2917
29 Ga0307511_10000214 3300030521 Bacteria 59060
30 Ga0307511_10000657 3300030521 Bacteria 36854
31 Ga0307511_10067128 3300030521 Bacteria 2665
32 Ga0307512_10002516 3300030522 Bacteria 22951
33 Ga0307512_10029189 3300030522 Bacteria 4823
34 Ga0307513_10037423 3300031456 Bacteria 5401
35 Ga0307513_10105598 3300031456 Bacteria 2825
36 Ga0307509_10041191 3300031507 Bacteria 5014
37 Ga0307509_10068921 3300031507 Bacteria 3699
38 Ga0307508_10006538 3300031616 Bacteria 10959
39 Ga0307508_10006559 3300031616 Bacteria 10935
40 Ga0307508_10009056 3300031616 Bacteria 9170
41 Ga0307508_10066272 3300031616 Bacteria 3180
42 Ga0307514_10002714 3300031649 Bacteria 17880
43 Ga0307516_10017032 3300031730 Bacteria 7589
44 Ga0307516_10032833 3300031730 Bacteria 5227
45 Ga0307516_10078648 3300031730 Bacteria 3144
46 Ga0307507_10033229 3300033179 Bacteria 5360
47 Ga0307507_10035962 3300033179 Bacteria 5074
48 Ga0307507_10095125 3300033179 Bacteria 2528
49 Ga0307507_10116769 3300033179 Bacteria 2154
50 Ga0307510_10039732 3300033180 Bacteria 5178
51 Ga0307510_10075184 3300033180 Bacteria 3332
52 Ga0373925_0055583 3300037068 Bacteria 2964
53 Ga0395900_0057367 3300037418 Bacteria 4009
54 Ga0395898_0010473 3300037466 Bacteria 9693
55 Ga0436364_0147188 3300037853 Bacteria 17063
56 Ga0436364_0429055 3300037853 Bacteria 17858
57 Ga0436364_1201075 3300037853 Bacteria 35768
58 Ga0439436_0000349 3300041404 Bacteria 11426
59 Ga0439436_0000440 3300041404 Bacteria 10552
60 Ga0439436_0018909 3300041404 Bacteria 2060
61 Ga0451853_0218085 3300041512 Bacteria 3347
62 Ga0451853_0791982 3300041512 Bacteria 9592
63 Ga0439433_0001210 3300041999 Bacteria 5315
64 Ga0439449_0000578 3300042007 Bacteria 13730
65 Ga0439449_0024916 3300042007 Bacteria 2236
66 Ga0439455_0002843 3300042012 Bacteria 3219
67 Ga0439457_010149 3300042014 Bacteria 2172
68 Ga0439457_012962 3300042014 Bacteria 1875
69 Ga0450894_000155 3300042131 Bacteria 12006
70 Ga0450896_000980 3300042133 Bacteria 3321
71 Ga0450903_000672 3300042138 Bacteria 6875
72 Ga0450903_001186 3300042138 Bacteria 4910
73 Ga0450906_002664 3300042145 Bacteria 3886
74 Ga0439458_0000139 3300042157 Bacteria 15540
75 Ga0466969_0007424 3300044656 Bacteria 5821
76 Ga0466972_0000726 3300044658 Bacteria 15757
77 Ga0466972_0005628 3300044658 Bacteria 6280
78 Ga0466965_0139969 3300044683 Bacteria 1259
79 Ga0466966_0002678 3300044684 Bacteria 11667
80 Ga0466966_0016498 3300044684 Bacteria 4877
81 Ga0466966_0049541 3300044684 Bacteria 2675
82 Ga0466966_0054375 3300044684 Bacteria 2537
83 Ga0466961_0001255 3300044693 Bacteria 15642
84 Ga0466961_0018223 3300044693 Bacteria 4514
85 Ga0466961_0042559 3300044693 Bacteria 2911
86 Ga0466961_0058577 3300044693 Bacteria 2450
87 Ga0466963_0004524 3300044694 Bacteria 8096
88 Ga0466963_0025759 3300044694 Bacteria 3754
89 Ga0466963_0028026 3300044694 Bacteria 3612
90 Ga0466971_0000899 3300044719 Bacteria 12190
91 Ga0466971_0007889 3300044719 Bacteria 4637
92 Ga0466971_0008078 3300044719 Bacteria 4589
93 Ga0466970_0008898 3300044765 Bacteria 5063
94 Ga0466957_0004532 3300044842 Bacteria 7754
95 Ga0466960_0001976 3300044901 Bacteria 7593
96 Ga0466959_0001753 3300045049 Bacteria 13517
97 Ga0466959_0006464 3300045049 Bacteria 8119
98 Ga0466959_0206875 3300045049 Bacteria 1365
99 Ga0466958_0003147 3300045836 Bacteria 8488
100 Ga0466967_0017518 3300045976 Bacteria 5691
101 Ga0495592_0011655 3300046454 Bacteria 6659
102 Ga0495592_0023356 3300046454 Bacteria 4702
103 Ga0495603_0001982 3300046455 Bacteria 12061
104 Ga0495603_0008666 3300046455 Bacteria 6145
105 Ga0495603_0016616 3300046455 Bacteria 4453
106 Ga0495603_0044878 3300046455 Bacteria 2637
107 Ga0495629_0001208 3300046459 Bacteria 20277
108 Ga0495629_0012154 3300046459 Bacteria 6238
109 Ga0495629_0029168 3300046459 Bacteria 3915
110 Ga0495629_0058211 3300046459 Bacteria 2702
111 Ga0495629_0059196 3300046459 Bacteria 2677
112 Ga0495629_0073545 3300046459 Bacteria 2386
113 Ga0495629_0101774 3300046459 Bacteria 2004
114 Ga0495629_0186286 3300046459 Bacteria 1437
115 Ga0495638_0021578 3300046460 Bacteria 4241
116 Ga0495638_0026328 3300046460 Bacteria 3770
117 Ga0495651_0023075 3300046462 Bacteria 4839
118 Ga0495639_0060132 3300046475 Bacteria 1740
119 Ga0495662_0001195 3300046476 Bacteria 12818
120 Ga0495662_0042850 3300046476 Bacteria 2184
121 Ga0495662_0082801 3300046476 Bacteria 1561
122 Ga0495585_0017723 3300046492 Bacteria 4112
123 Ga0495585_0026222 3300046492 Bacteria 3329
124 Ga0495594_0000649 3300046499 Bacteria 17952
125 Ga0495594_0020769 3300046499 Bacteria 3500
126 Ga0495594_0048476 3300046499 Bacteria 2334
127 Ga0495594_0086086 3300046499 Bacteria 1758
128 Ga0495596_0019510 3300046500 Bacteria 2784
129 Ga0495583_0039639 3300046506 Bacteria 2218
130 Ga0495610_0107222 3300046512 Bacteria 1242
131 Ga0495616_0001801 3300046513 Bacteria 14547
132 Ga0495618_0022412 3300046514 Bacteria 3901
133 Ga0495618_0063960 3300046514 Bacteria 2337
134 Ga0495628_0010709 3300046516 Bacteria 7766
135 Ga0495628_0039454 3300046516 Bacteria 3777
136 Ga0495630_0091865 3300046517 Bacteria 2294
137 Ga0495631_0007766 3300046518 Bacteria 5441
138 Ga0495632_0032815 3300046519 Bacteria 2672
139 Ga0495643_0000935 3300046522 Bacteria 30322
140 Ga0495643_0044735 3300046522 Bacteria 2404
141 Ga0495648_0072625 3300046524 Bacteria 1990
142 Ga0495666_0056939 3300046526 Bacteria 1871
143 Ga0495652_0004472 3300046529 Bacteria 13351
144 Ga0495652_0020989 3300046529 Bacteria 5805
145 Ga0495652_0097297 3300046529 Bacteria 2394
146 Ga0495640_0006540 3300046533 Bacteria 9209
147 Ga0495640_0019232 3300046533 Bacteria 5045
148 Ga0495640_0029044 3300046533 Bacteria 3974
149 Ga0495587_0009242 3300046536 Bacteria 6325
150 Ga0495645_0010189 3300046543 Bacteria 6586
151 Ga0495622_0005115 3300046557 Bacteria 6077
152 Ga0495622_0015180 3300046557 Bacteria 3580
153 Ga0495667_0126455 3300046559 Bacteria 1649
154 Ga0495668_0008990 3300046616 Bacteria 6169
155 Ga0495634_0006376 3300046642 Bacteria 8970
156 Ga0495634_0018526 3300046642 Bacteria 4956
157 Ga0495611_0009407 3300046648 Bacteria 4130
158 Ga0495611_0039931 3300046648 Bacteria 2090
159 Ga0495625_0027823 3300046660 Bacteria 4248
160 Ga0495635_0115623 3300046663 Bacteria 1831
161 Ga0495588_0005021 3300046674 Bacteria 5873
162 Ga0495588_0018906 3300046674 Bacteria 3367
163 Ga0495588_0022047 3300046674 Bacteria 3145
164 Ga0495657_0002278 3300046675 Bacteria 16210
165 Ga0495657_0006404 3300046675 Bacteria 9214
166 Ga0495657_0139554 3300046675 Bacteria 1511
167 Ga0495623_0051979 3300046679 Bacteria 2591
168 Ga0495646_0022227 3300046680 Bacteria 4001
169 Ga0495658_0004911 3300046683 Bacteria 6559
170 Ga0495658_0051179 3300046683 Bacteria 2339
171 Ga0495613_0001356 3300046689 Bacteria 18654
172 Ga0495613_0009225 3300046689 Bacteria 7316
173 Ga0495613_0029538 3300046689 Bacteria 4075
174 Ga0495624_0019915 3300046690 Bacteria 4471
175 Ga0495671_0001746 3300046692 Bacteria 14086
176 Ga0495649_0091675 3300046694 Bacteria 1619
177 Ga0495589_0038438 3300046794 Bacteria 2395
178 Ga0495600_0008883 3300046809 Bacteria 6191
179 Ga0495600_0067449 3300046809 Bacteria 2339
180 Ga0495581_0003080 3300047315 Bacteria 9535
181 Ga0495604_0017982 3300047317 Bacteria 5656
182 Ga0495604_0116260 3300047317 Bacteria 1942
183 Ga0495674_0169407 3300047319 Bacteria 1823
184 Ga0495676_0003075 3300047321 Bacteria 15091
185 Ga0495676_0007442 3300047321 Bacteria 10045
186 Ga0495676_0023739 3300047321 Bacteria 5317
187 Ga0495676_0028462 3300047321 Bacteria 4770
188 Ga0495676_0031063 3300047321 Bacteria 4523
189 Ga0495676_0080899 3300047321 Bacteria 2464
190 Ga0495680_0002821 3300047322 Bacteria 17481
191 Ga0495687_036439 3300047443 Bacteria 2201
192 Ga0495687_059774 3300047443 Bacteria 1574
193 Ga0495679_026338 3300047446 Bacteria 1932
194 Ga0495685_005167 3300047447 Bacteria 4252
195 Ga0495685_005783 3300047447 Bacteria 4040
196 Ga0495685_030073 3300047447 Bacteria 1867
197 Ga0495681_0001113 3300047470 Bacteria 20391
198 Ga0495681_0001344 3300047470 Bacteria 18562
199 Ga0495681_0073768 3300047470 Bacteria 1540
200 Ga0495593_0001592 3300047673 Bacteria 13399
201 Ga0495602_0268624 3300048088 Bacteria 1262
202 Ga0495614_0000337 3300048089 Bacteria 18552
203 Ga0496106_0018540 3300048909 Bacteria 5148
204 Ga0501031_0012938 3300049568 Bacteria 5447
205 Ga0501031_0044690 3300049568 Bacteria 2891
206 Ga0501031_0178484 3300049568 Bacteria 1387
207 Ga0501032_0003159 3300049569 Bacteria 12672
208 Ga0501032_0012329 3300049569 Bacteria 6112
209 Ga0501032_0085520 3300049569 Bacteria 2096
210 Ga0501033_0008645 3300049570 Bacteria 7880
211 Ga0501033_0015217 3300049570 Bacteria 5837
212 Ga0501033_0015701 3300049570 Bacteria 5742
213 Ga0501033_0039483 3300049570 Bacteria 3525
214 Ga0501033_0085691 3300049570 Bacteria 2307
215 Ga0501034_0017186 3300049571 Bacteria 7422
216 Ga0501034_0026127 3300049571 Bacteria 5946
217 Ga0501034_0030338 3300049571 Bacteria 5496
218 Ga0501034_0033292 3300049571 Bacteria 5230
219 Ga0501034_0051199 3300049571 Bacteria 4164
220 Ga0501034_0052129 3300049571 Bacteria 4123
221 Ga0501034_0123895 3300049571 Bacteria 2570
222 Ga0501036_0000194 3300049572 Bacteria 40472
223 Ga0501036_0008150 3300049572 Bacteria 8586
224 Ga0501036_0009722 3300049572 Bacteria 7919
225 Ga0501036_0018662 3300049572 Bacteria 5815
226 Ga0501036_0060227 3300049572 Bacteria 3216
227 Ga0501036_0119402 3300049572 Bacteria 2227
228 Ga0501037_0010390 3300049573 Bacteria 6829
229 Ga0501037_0054547 3300049573 Bacteria 2923
230 Ga0501037_0099228 3300049573 Bacteria 2103
231 Ga0501038_0009860 3300049574 Bacteria 8741
232 Ga0501038_0014780 3300049574 Bacteria 7111
233 Ga0501038_0016035 3300049574 Bacteria 6805
234 Ga0501038_0252473 3300049574 Bacteria 1396
235 Ga0501039_0008348 3300049575 Bacteria 7893
236 Ga0501039_0017823 3300049575 Bacteria 5447
237 Ga0501039_0075511 3300049575 Bacteria 2620
238 Ga0501039_0214790 3300049575 Bacteria 1512
239 Ga0501040_0006988 3300049576 Bacteria 7314
240 Ga0501041_0009883 3300049577 Bacteria 5617
241 Ga0501042_0005750 3300049578 Bacteria 8012
242 Ga0501042_0005816 3300049578 Bacteria 7964
243 Ga0501042_0205211 3300049578 Bacteria 1421
244 Ga0501043_0003340 3300049579 Bacteria 13222
245 Ga0501043_0013612 3300049579 Bacteria 6364
246 Ga0501043_0016930 3300049579 Bacteria 5713
247 Ga0501043_0023123 3300049579 Bacteria 4875
248 Ga0501043_0056299 3300049579 Bacteria 3088
249 Ga0501043_0363389 3300049579 Bacteria 1098
250 Ga0501046_0014876 3300049580 Bacteria 6549
251 Ga0501046_0062353 3300049580 Bacteria 2913
252 Ga0501046_0084393 3300049580 Bacteria 2450
253 Ga0501047_0000262 3300049581 Bacteria 61769
254 Ga0501047_0013027 3300049581 Bacteria 7876
255 Ga0501047_0027828 3300049581 Bacteria 5447
256 Ga0501047_0077965 3300049581 Bacteria 3186
257 Ga0501047_0097798 3300049581 Bacteria 2813
258 Ga0501047_0125638 3300049581 Bacteria 2445
259 Ga0501048_0001509 3300049582 Bacteria 17620
260 Ga0501048_0089652 3300049582 Bacteria 2169
261 Ga0501067_0002153 3300049583 Bacteria 10859
262 Ga0501068_0006734 3300049584 Bacteria 6348
263 Ga0501068_0210647 3300049584 Bacteria 1234
264 Ga0501069_0004956 3300049585 Bacteria 6907
265 Ga0501069_0048016 3300049585 Bacteria 2370
266 Ga0501070_0001958 3300049586 Bacteria 18176
267 Ga0501070_0048429 3300049586 Bacteria 3530
268 Ga0501071_0013921 3300049587 Bacteria 5494
269 Ga0501073_0051550 3300049589 Bacteria 2882
270 Ga0501074_0006999 3300049590 Bacteria 8147
271 Ga0501074_0022221 3300049590 Bacteria 4609
272 Ga0501076_0021403 3300049592 Bacteria 4960
273 Ga0501079_0002823 3300049741 Bacteria 12665
274 Ga0501080_0006115 3300049742 Bacteria 10792
275 Ga0501083_0006806 3300049744 Bacteria 8113
276 Ga0501035_0000951 3300049822 Bacteria 30616
277 Ga0501035_0013537 3300049822 Bacteria 7529
278 Ga0501035_0039110 3300049822 Bacteria 4293
279 Ga0501035_0066822 3300049822 Bacteria 3190
280 Ga0501035_0113599 3300049822 Bacteria 2372
281 Ga0501035_0120546 3300049822 Bacteria 2293
282 Ga0501044_0004053 3300049823 Bacteria 16437
283 Ga0501044_0032380 3300049823 Bacteria 5496
284 Ga0501044_0041120 3300049823 Bacteria 4813
285 Ga0501044_0107905 3300049823 Bacteria 2795
286 Ga0501044_0175720 3300049823 Bacteria 2110
287 Ga0501044_0182675 3300049823 Bacteria 2063
288 Ga0501044_0334107 3300049823 Bacteria 1437
289 Ga0501045_0013612 3300049824 Bacteria 5748
290 Ga0501045_0120401 3300049824 Bacteria 1949
291 Ga0500578_0002874 3300053086 Bacteria 13596
292 Ga0500644_0032193 3300053088 Bacteria 1674
293 Ga0500566_0024225 3300053094 Bacteria 3564
294 Ga0500569_002637 3300053109 Bacteria 3565
295 Ga0500628_000772 3300053129 Bacteria 5690
296 Ga0500658_0000682 3300053134 Bacteria 14000
297 Ga0500561_0000231 3300053137 Bacteria 10007
298 Ga0500579_026753 3300053143 Bacteria 3717
299 Ga0500600_0000457 3300053149 Bacteria 18504
300 Ga0500600_0075006 3300053149 Bacteria 1845
301 Ga0500616_0002105 3300053153 Bacteria 17333
302 Ga0501084_0013242 3300054114 Bacteria 6825
303 Ga0501082_0007467 3300060353 Bacteria 9432
304 Ga0466962_0000744 3300061719 Bacteria 14625
305 Ga0466962_0007195 3300061719 Bacteria 5330
306 Ga0466962_0022713 3300061719 Bacteria 3015
307 Ga0466962_0024552 3300061719 Bacteria 2896
308 Ga0530510_0069889 3300061734 Bacteria 2548
309 2862182554 2862178590 Bacteria 8583590
310 2547407938 2547132111 Bacteria 8013147
311 2554258652 2554235005 Bacteria 6457341
312 2585301349 2582581312 Bacteria 7308206
313 2585304912 2582581313 Bacteria 10042643
314 2585318945 2582581314 Bacteria 11452267
315 2616701801 2616644814 Bacteria 11555299
316 2616899821 2616644941 Bacteria 8510691
317 2643759695 2643221548 Bacteria 8053412
318 2643897812 2643221578 Bacteria 9213798
319 2643944744 2643221587 Bacteria 7586415
320 2644269180 2643221647 Bacteria 10741251
321 2644385325 2643221670 Bacteria 6497041
322 2644408957 2643221673 Bacteria 9196637
323 2644431642 2643221677 Bacteria 7584031
324 2644436298 2643221678 Bacteria 9540101
325 2644462890 2643221682 Bacteria 6743283
326 2644625837 2643221714 Bacteria 9015452
327 2768647953 2767802112 Bacteria 6465194
328 2784587804 2784132148 Bacteria 8627943
329 2785344340 2784746763 Bacteria 9783172
330 2785368507 2784746768 Bacteria 10036182
331 2786669528 2786546132 Bacteria 10419719
332 2793975752 2791355406 Bacteria 11364898
333 2804844813 2802429296 Bacteria 7227771
334 2808841196 2808606359 Bacteria 9866990
335 2808919713 2808606375 Bacteria 9466072
336 2809231384 2808606448 Bacteria 8656184
337 2811848209 2808606982 Bacteria 7791042
338 2812359058 2811994879 Bacteria 9313447
339 2812481298 2811994917 Bacteria 7761064
340 2819693733 2818991463 Bacteria 7948711
341 2852641201 2852635781 Bacteria 8251373
342 2862288222 2862281513 Bacteria 9621493
343 2862296936 2862290372 Bacteria 7471434
344 2862384365 2862382967 Bacteria 10317375
345 2862513390 2862507626 Bacteria 9425308
346 2862580058 2862574272 Bacteria 10567477
347 2862709811 2862705112 Bacteria 6563286
348 2863405594 2863404153 Bacteria 9672205
349 2866617691 2866612099 Bacteria 7543886
350 2867347162 2867346516 Bacteria 7608576
351 2867370169 2867369537 Bacteria 6501581
352 2867371028 2867369537 Bacteria 6501581
353 2867436121 2867428634 Bacteria 9590268
354 2867479542 2867475112 Bacteria 6909112
355 2873156623 2873151551 Bacteria 8625867
356 2875393733 2875391855 Bacteria 7600475
357 2877682026 2877676314 Bacteria 9512378
358 2912720991 2912715099 Bacteria 9460473
359 2912725074 2912723979 Bacteria 8557534
360 2918503755 2918501144 Bacteria 8668083
361 2919468597 2919468124 Bacteria 9133025
362 2935392223 2935390628 Bacteria 7043367
363 2946050929 2946045630 Bacteria 8527308
364 2946066820 2946064051 Bacteria 8957905
365 2946075146 2946072368 Bacteria 8999607
366 2947230409 2947224130 Bacteria 9938529
367 2954003733 2954002825 Bacteria 9173742
368 2954387145 2954380949 Bacteria 10050426
369 2954676018 2954673503 Bacteria 9685905
370 2954688147 2954682443 Bacteria 9862841
371 2954697975 2954691527 Bacteria 10720516
372 2954704241 2954701450 Bacteria 10834262
373 2954717093 2954711539 Bacteria 10867210
374 2954727063 2954721474 Bacteria 10456478
375 2954734739 2954731030 Bacteria 10243860
376 2954745965 2954740390 Bacteria 10229294
377 2954753626 2954749733 Bacteria 10366972
378 2954764936 2954759201 Bacteria 9358192
379 2966603350 2966598605 Bacteria 7676064
380 2990046346 2990044586 Bacteria 6603797
381 2990061954 2990059506 Bacteria 9321252
382 2990091923 2990088156 Bacteria 6657676
383 2990092531 2990088156 Bacteria 6657676
384 2997456490 2997451912 Bacteria 8492419
385 2997600740 2997600082 Bacteria 9896405
386 3006321906 3006321560 Bacteria 8247479
387 3006396312 3006393351 Bacteria 6615579
388 3006425822 3006425503 Bacteria 6491253
389 3006487021 3006486233 Bacteria 8157040
390 3006501019 3006493962 Bacteria 8825450
391 8008488963 8008485437 Bacteria 7198341
392 8008559480 8008558824 Bacteria 10610750
393 8008579682 8008574985 Bacteria 7815457
394 8023628149 8023623736 Bacteria 8593882
395 8025419257 8025413630 Bacteria 7014048
396 8025483110 8025478263 Bacteria 8209203
397 8025528446 8025524527 Bacteria 7197316
398 8033689299 8033684223 Bacteria 6906479
399 8033691776 8033684223 Bacteria 6906479
400 8047720244 8047710418 Bacteria 11023148
401 8047894308 8047893842 Bacteria 11723082
402 8048130302 8048127548 Bacteria 11053136
403 8048364744 8048356638 Bacteria 11044339
404 8048371325 8048369669 Bacteria 11666822
405 8048380126 8048379754 Bacteria 11877923
406 8048408448 8048406513 Bacteria 8936924
407 8054167276 8054160619 Bacteria 7783213
408 8056836873 8056829672 Bacteria 9045328
409 rootH1_10039559
410 rootH1_10071986
411 rootH2_10001113
412 rootL2_10003174
413 rootH1_10094896
414 JGI25160J50197_1030524
415 Ga0006562J51391_1073911
416 Ga0068854_100037244
417 Ga0068852_100054418
418 Ga0081455_10065216
419 Ga0105251_10027930
420 Ga0105243_10131343
421 Ga0105238_10025777
422 Ga0105238_10383930
423 Ga0105239_10676386
424 Ga0105246_10001974
425 Ga0157372_10110447
426 Ga0182008_10000271
427 Ga0182007_10001229
428 Ga0183367_1006
429 Ga0213875_10003855
430 Ga0213875_10004218
431 Ga0207426_1001582
432 Ga0207426_1004446
433 Ga0307517_10003237
434 Ga0307517_10003826
435 Ga0307515_10005972
436 Ga0307515_10123248
437 Ga0307511_10000214
438 Ga0307511_10000657
439 Ga0307511_10067128
440 Ga0307512_10002516
441 Ga0307512_10029189
442 Ga0307513_10037423
443 Ga0307513_10105598
444 Ga0307509_10041191
445 Ga0307509_10068921
446 Ga0307508_10006538
447 Ga0307508_10006559
448 Ga0307508_10009056
449 Ga0307508_10066272
450 Ga0307514_10002714
451 Ga0307516_10017032
452 Ga0307516_10032833
453 Ga0307516_10078648
454 Ga0307507_10033229
455 Ga0307507_10035962
456 Ga0307507_10095125
457 Ga0307507_10116769
458 Ga0307510_10039732
459 Ga0307510_10075184
460 Ga0373925_0055583
461 Ga0395900_0057367
462 Ga0395898_0010473
463 Ga0436364_0147188
464 Ga0436364_0429055
465 Ga0436364_1201075
466 Ga0439436_0000349
467 Ga0439436_0000440
468 Ga0439436_0018909
469 Ga0451853_0218085
470 Ga0451853_0791982
471 Ga0439433_0001210
472 Ga0439449_0000578
473 Ga0439449_0024916
474 Ga0439455_0002843
475 Ga0439457_010149
476 Ga0439457_012962
477 Ga0450894_000155
478 Ga0450896_000980
479 Ga0450903_000672
480 Ga0450903_001186
481 Ga0450906_002664
482 Ga0439458_0000139
483 Ga0466969_0007424
484 Ga0466972_0000726
485 Ga0466972_0005628
486 Ga0466965_0139969
487 Ga0466966_0002678
488 Ga0466966_0016498
489 Ga0466966_0049541
490 Ga0466966_0054375
491 Ga0466961_0001255
492 Ga0466961_0018223
493 Ga0466961_0042559
494 Ga0466961_0058577
495 Ga0466963_0004524
496 Ga0466963_0025759
497 Ga0466963_0028026
498 Ga0466971_0000899
499 Ga0466971_0007889
500 Ga0466971_0008078
501 Ga0466970_0008898
502 Ga0466957_0004532
503 Ga0466960_0001976
504 Ga0466959_0001753
505 Ga0466959_0006464
506 Ga0466959_0206875
507 Ga0466958_0003147
508 Ga0466967_0017518
509 Ga0495592_0011655
510 Ga0495592_0023356
511 Ga0495603_0001982
512 Ga0495603_0008666
513 Ga0495603_0016616
514 Ga0495603_0044878
515 Ga0495629_0001208
516 Ga0495629_0012154
517 Ga0495629_0029168
518 Ga0495629_0058211
519 Ga0495629_0059196
520 Ga0495629_0073545
521 Ga0495629_0101774
522 Ga0495629_0186286
523 Ga0495638_0021578
524 Ga0495638_0026328
525 Ga0495651_0023075
526 Ga0495639_0060132
527 Ga0495662_0001195
528 Ga0495662_0042850
529 Ga0495662_0082801
530 Ga0495585_0017723
531 Ga0495585_0026222
532 Ga0495594_0000649
533 Ga0495594_0020769
534 Ga0495594_0048476
535 Ga0495594_0086086
536 Ga0495596_0019510
537 Ga0495583_0039639
538 Ga0495610_0107222
539 Ga0495616_0001801
540 Ga0495618_0022412
541 Ga0495618_0063960
542 Ga0495628_0010709
543 Ga0495628_0039454
544 Ga0495630_0091865
545 Ga0495631_0007766
546 Ga0495632_0032815
547 Ga0495643_0000935
548 Ga0495643_0044735
549 Ga0495648_0072625
550 Ga0495666_0056939
551 Ga0495652_0004472
552 Ga0495652_0020989
553 Ga0495652_0097297
554 Ga0495640_0006540
555 Ga0495640_0019232
556 Ga0495640_0029044
557 Ga0495587_0009242
558 Ga0495645_0010189
559 Ga0495622_0005115
560 Ga0495622_0015180
561 Ga0495667_0126455
562 Ga0495668_0008990
563 Ga0495634_0006376
564 Ga0495634_0018526
565 Ga0495611_0009407
566 Ga0495611_0039931
567 Ga0495625_0027823
568 Ga0495635_0115623
569 Ga0495588_0005021
570 Ga0495588_0018906
571 Ga0495588_0022047
572 Ga0495657_0002278
573 Ga0495657_0006404
574 Ga0495657_0139554
575 Ga0495623_0051979
576 Ga0495646_0022227
577 Ga0495658_0004911
578 Ga0495658_0051179
579 Ga0495613_0001356
580 Ga0495613_0009225
581 Ga0495613_0029538
582 Ga0495624_0019915
583 Ga0495671_0001746
584 Ga0495649_0091675
585 Ga0495589_0038438
586 Ga0495600_0008883
587 Ga0495600_0067449
588 Ga0495581_0003080
589 Ga0495604_0017982
590 Ga0495604_0116260
591 Ga0495674_0169407
592 Ga0495676_0003075
593 Ga0495676_0007442
594 Ga0495676_0023739
595 Ga0495676_0028462
596 Ga0495676_0031063
597 Ga0495676_0080899
598 Ga0495680_0002821
599 Ga0495687_036439
600 Ga0495687_059774
601 Ga0495679_026338
602 Ga0495685_005167
603 Ga0495685_005783
604 Ga0495685_030073
605 Ga0495681_0001113
606 Ga0495681_0001344
607 Ga0495681_0073768
608 Ga0495593_0001592
609 Ga0495602_0268624
610 Ga0495614_0000337
611 Ga0496106_0018540
612 Ga0501031_0012938
613 Ga0501031_0044690
614 Ga0501031_0178484
615 Ga0501032_0003159
616 Ga0501032_0012329
617 Ga0501032_0085520
618 Ga0501033_0008645
619 Ga0501033_0015217
620 Ga0501033_0015701
621 Ga0501033_0039483
622 Ga0501033_0085691
623 Ga0501034_0017186
624 Ga0501034_0026127
625 Ga0501034_0030338
626 Ga0501034_0033292
627 Ga0501034_0051199
628 Ga0501034_0052129
629 Ga0501034_0123895
630 Ga0501036_0000194
631 Ga0501036_0008150
632 Ga0501036_0009722
633 Ga0501036_0018662
634 Ga0501036_0060227
635 Ga0501036_0119402
636 Ga0501037_0010390
637 Ga0501037_0054547
638 Ga0501037_0099228
639 Ga0501038_0009860
640 Ga0501038_0014780
641 Ga0501038_0016035
642 Ga0501038_0252473
643 Ga0501039_0008348
644 Ga0501039_0017823
645 Ga0501039_0075511
646 Ga0501039_0214790
647 Ga0501040_0006988
648 Ga0501041_0009883
649 Ga0501042_0005750
650 Ga0501042_0005816
651 Ga0501042_0205211
652 Ga0501043_0003340
653 Ga0501043_0013612
654 Ga0501043_0016930
655 Ga0501043_0023123
656 Ga0501043_0056299
657 Ga0501043_0363389
658 Ga0501046_0014876
659 Ga0501046_0062353
660 Ga0501046_0084393
661 Ga0501047_0000262
662 Ga0501047_0013027
663 Ga0501047_0027828
664 Ga0501047_0077965
665 Ga0501047_0097798
666 Ga0501047_0125638
667 Ga0501048_0001509
668 Ga0501048_0089652
669 Ga0501067_0002153
670 Ga0501068_0006734
671 Ga0501068_0210647
672 Ga0501069_0004956
673 Ga0501069_0048016
674 Ga0501070_0001958
675 Ga0501070_0048429
676 Ga0501071_0013921
677 Ga0501073_0051550
678 Ga0501074_0006999
679 Ga0501074_0022221
680 Ga0501076_0021403
681 Ga0501079_0002823
682 Ga0501080_0006115
683 Ga0501083_0006806
684 Ga0501035_0000951
685 Ga0501035_0013537
686 Ga0501035_0039110
687 Ga0501035_0066822
688 Ga0501035_0113599
689 Ga0501035_0120546
690 Ga0501044_0004053
691 Ga0501044_0032380
692 Ga0501044_0041120
693 Ga0501044_0107905
694 Ga0501044_0175720
695 Ga0501044_0182675
696 Ga0501044_0334107
697 Ga0501045_0013612
698 Ga0501045_0120401
699 Ga0500578_0002874
700 Ga0500644_0032193
701 Ga0500566_0024225
702 Ga0500569_002637
703 Ga0500628_000772
704 Ga0500658_0000682
705 Ga0500561_0000231
706 Ga0500579_026753
707 Ga0500600_0000457
708 Ga0500600_0075006
709 Ga0500616_0002105
710 Ga0501084_0013242
711 Ga0501082_0007467
712 Ga0466962_0000744
713 Ga0466962_0007195
714 Ga0466962_0022713
715 Ga0466962_0024552
716 Ga0530510_0069889
717 2862182554
718 2547407938
719 2554258652
720 2585301349
721 2585304912
722 2585318945
723 2616701801
724 2616899821
725 2643759695
726 2643897812
727 2643944744
728 2644269180
729 2644385325
730 2644408957
731 2644431642
732 2644436298
733 2644462890
734 2644625837
735 2768647953
736 2784587804
737 2785344340
738 2785368507
739 2786669528
740 2793975752
741 2804844813
742 2808841196
743 2808919713
744 2809231384
745 2811848209
746 2812359058
747 2812481298
748 2819693733
749 2852641201
750 2862288222
751 2862296936
752 2862384365
753 2862513390
754 2862580058
755 2862709811
756 2863405594
757 2866617691
758 2867347162
759 2867370169
760 2867371028
761 2867436121
762 2867479542
763 2873156623
764 2875393733
765 2877682026
766 2912720991
767 2912725074
768 2918503755
769 2919468597
770 2935392223
771 2946050929
772 2946066820
773 2946075146
774 2947230409
775 2954003733
776 2954387145
777 2954676018
778 2954688147
779 2954697975
780 2954704241
781 2954717093
782 2954727063
783 2954734739
784 2954745965
785 2954753626
786 2954764936
787 2966603350
788 2990046346
789 2990061954
790 2990091923
791 2990092531
792 2997456490
793 2997600740
794 3006321906
795 3006396312
796 3006425822
797 3006487021
798 3006501019
799 8008488963
800 8008559480
801 8008579682
802 8023628149
803 8025419257
804 8025483110
805 8025528446
806 8033689299
807 8033691776
808 8047720244
809 8047894308
810 8048130302
811 8048364744
812 8048371325
813 8048380126
814 8048408448
815 8054167276
816 8056836873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

80

365

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hqq-assembly1.cif.gz_A crystal structure of human ketohexokinase complexed to different sugar molecules 0.8431 39 315
2hlz-assembly1.cif.gz_B crystal structure of human ketohexokinase 0.8331 38 323
2rbc-assembly1.cif.gz_A-2 crystal structure of a putative ribokinase from agrobacterium tumefaciens 0.833 39 340
2rbc-assembly1.cif.gz_A-2 crystal structure of a putative ribokinase from agrobacterium tumefaciens 0.8203 39 340
1v19-assembly1.cif.gz_A 2-keto-3-deoxygluconate kinase from thermus thermophilus 0.8185 39 332
ID Description Score Start End Superfamily
af_F4K7C7_15_348_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8578 42 320 3.40.1190.20
6iltB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8213 38 335 3.40.1190.20
2rbcA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8206 39 339 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8154 39 330 3.40.1190.20
2rbcA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8129 39 339 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A1Q5L9Q2-F1-model_v4 Sugar kinase 0.9629 25 380 GO:0016301
AF-A0A5P8K3C2-F1-model_v4 Sugar kinase 0.9615 17 380 GO:0016301
AF-A0A7K2N4I7-F1-model_v4 Sugar kinase 0.9614 30 380 GO:0016301
AF-A0A6G2WQC5-F1-model_v4 deleted 0.9595 25 380
AF-A0A1Q5L9Q2-F1-model_v4 Sugar kinase 0.9577 25 380 GO:0016301

Map