F436862

General Info

Members Datasets Scaffolds Average Seq Length
408 229 346 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606447|2809226211
Length 180
Sequence ERVRVWATALIRQHLDPSWSFGFDNAKRRAGLCDFRRKRISVSRYLSARYDDDTNHQTLLHEVAHALAGPAAGHGAEWKRIARSLGYVGGTTHDGETAVELAPWVGVCPAGHTAYRHRRPPRATSCVACAPHFDRRHLFTWTRREISAATRLAAMTPRADAASRASEPDDAGPAHDRHRV

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221572 Leifsonia sp. Root60 Isolate Unclassified
7 2643221575 Microbacterium sp. Root61 Isolate Unclassified
8 2643221597 Microbacterium sp. Root180 Isolate Unclassified
9 2643221616 Leifsonia sp. Root227 Isolate Unclassified
10 2643221619 Agromyces sp. Root81 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
13 2643221649 Leifsonia sp. Root4 Isolate Unclassified
14 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
15 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
16 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
17 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
18 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
19 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
20 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
21 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
22 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
23 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
24 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
25 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
26 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
27 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
28 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
29 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
30 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
31 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
32 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
33 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
34 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
35 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
36 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
37 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
38 2919069694 Microbacterium sp. 1154 Isolate Unclassified
39 2919395869 Microbacterium resistens 2980 Isolate Unclassified
40 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
41 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
42 2928153084 Leifsonia sp. 563 Isolate Unclassified
43 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
44 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
45 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
46 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
47 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
48 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
49 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
50 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
51 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
52 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
53 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
54 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
55 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
56 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
57 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
58 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
59 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
60 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
70 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
73 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
227 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
228 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
229 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.09
Metatranscriptomes 1.72
Isolates 15.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 14.46
Nodule 0
Rhizoplane 11.76
Rhizosphere 47.3
Stem 0
Stem Tuber 0.25
Unclassified 25.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10014430 3300001990 Bacteria 2565
2 JGI24735J21928_10013419 3300002067 Bacteria 2576
3 JGI25154J39366_1000583 3300002738 Bacteria 17718
4 JGI25164J39214_1001692 3300002772 Bacteria 4485
5 JGI25165J46597_1000269 3300003214 Bacteria 67008
6 rootH1_10087931 3300003316 Bacteria 1215
7 Ga0006562J51391_1193684 3300003578 Bacteria 8992
8 Ga0006562J51391_1193685 3300003578 Bacteria 8950
9 Ga0055539_1000090 3300003752 Bacteria 112260
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055532_1008061 3300003758 Bacteria 1329
12 Ga0055525_1000126 3300003759 Bacteria 115430
13 Ga0055527_1000064 3300003760 Bacteria 88552
14 Ga0055542_1000023 3300003762 Bacteria 292964
15 Ga0055529_1000050 3300003763 Bacteria 206297
16 Ga0055529_1023164 3300003763 Bacteria 769
17 Ga0065714_10016783 3300005288 Bacteria 1725
18 Ga0070658_10032547 3300005327 Bacteria 4192
19 Ga0070660_100141865 3300005339 Bacteria 1928
20 Ga0070659_100367799 3300005366 Bacteria 1209
21 Ga0070714_100412629 3300005435 Bacteria 1278
22 Ga0068853_100057965 3300005539 Bacteria 3343
23 Ga0070665_100123244 3300005548 Bacteria 2594
24 Ga0070664_100799185 3300005564 Bacteria 882
25 Ga0075365_10088244 3300006038 Bacteria 2110
26 Ga0075368_10098866 3300006042 Bacteria 1197
27 Ga0075364_10003400 3300006051 Bacteria 9039
28 Ga0075364_10052725 3300006051 Bacteria 2659
29 Ga0075364_10211061 3300006051 Bacteria 1317
30 Ga0075364_10257156 3300006051 Bacteria 1187
31 Ga0075367_10174568 3300006178 Bacteria 1339
32 Ga0075369_10010891 3300006186 Bacteria 3564
33 Ga0075369_10013418 3300006186 Bacteria 3252
34 Ga0075369_10239114 3300006186 Bacteria 842
35 Ga0075370_10131832 3300006353 Bacteria 1458
36 Ga0105244_10018680 3300009036 Bacteria 3883
37 Ga0105244_10058384 3300009036 Bacteria 1947
38 Ga0105237_10070287 3300009545 Bacteria 3496
39 Ga0157370_10267141 3300013104 Bacteria 1581
40 Ga0157370_10293729 3300013104 Bacteria 1501
41 Ga0157370_10367856 3300013104 Bacteria 1325
42 Ga0157369_10024848 3300013105 Bacteria 6656
43 Ga0157369_10111107 3300013105 Bacteria 2913
44 Ga0157369_10241071 3300013105 Bacteria 1889
45 Ga0157369_10739413 3300013105 Bacteria 1012
46 Ga0171462_1001 3300013250 Bacteria 1135406
47 Ga0163162_10118835 3300013306 Bacteria 2746
48 Ga0157372_10109028 3300013307 Bacteria 3170
49 Ga0157372_10121293 3300013307 Bacteria 3003
50 Ga0157372_10240471 3300013307 Bacteria 2101
51 Ga0157372_11281465 3300013307 Bacteria 846
52 Ga0157375_10691187 3300013308 Bacteria 1174
53 Ga0157375_11019999 3300013308 Bacteria 966
54 Ga0157375_12749930 3300013308 Bacteria 588
55 Ga0163163_11559959 3300014325 Bacteria 721
56 Ga0163161_10086799 3300017792 Bacteria 2310
57 Ga0197907_10669710 3300020069 Bacteria 1357
58 Ga0206354_10426408 3300020081 Bacteria 4480
59 Ga0206353_11263019 3300020082 Bacteria 1167
60 Ga0206353_11519977 3300020082 Bacteria 1522
61 Ga0224712_10013001 3300022467 Bacteria 2638
62 Ga0209566_100066 3300025225 Bacteria 186951
63 Ga0209674_100001 3300025226 Bacteria 4013750
64 Ga0209672_100116 3300025228 Bacteria 87706
65 Ga0209147_105105 3300025229 Bacteria 2029
66 Ga0209563_100001 3300025230 Bacteria 4013775
67 Ga0209563_105220 3300025230 Bacteria 2381
68 Ga0207427_100054 3300025231 Bacteria 216315
69 Ga0209437_104104 3300025233 Bacteria 2581
70 Ga0209258_102773 3300025242 Bacteria 4233
71 Ga0209646_1000041 3300025246 Bacteria 346024
72 Ga0209677_100001 3300025253 Bacteria 4013787
73 Ga0209677_102888 3300025253 Bacteria 6034
74 Ga0209148_1000240 3300025254 Bacteria 87706
75 Ga0209233_1000001 3300025261 Bacteria 2992747
76 Ga0209455_1000197 3300025272 Bacteria 87706
77 Ga0209455_1000681 3300025272 Bacteria 20165
78 Ga0207655_1024481 3300025728 Bacteria 2957
79 Ga0207647_10033043 3300025904 Bacteria 3317
80 Ga0207647_10308500 3300025904 Bacteria 900
81 Ga0207671_10081003 3300025914 Bacteria 2434
82 Ga0207657_10144192 3300025919 Bacteria 1944
83 Ga0207650_10657675 3300025925 Bacteria 884
84 Ga0207664_10350838 3300025929 Bacteria 1306
85 Ga0207679_10495107 3300025945 Bacteria 1090
86 Ga0209813_10165033 3300027866 Bacteria 801
87 Ga0268266_10170911 3300028379 Bacteria 1973
88 Ga0307408_100307392 3300031548 Bacteria 1331
89 Ga0307514_10008865 3300031649 Bacteria 8508
90 Ga0307405_10109406 3300031731 Bacteria 1869
91 Ga0307405_10357623 3300031731 Bacteria 1129
92 Ga0307413_10284418 3300031824 Bacteria 1246
93 Ga0307406_10004625 3300031901 Bacteria 7493
94 Ga0307406_10639420 3300031901 Bacteria 882
95 Ga0307406_10744112 3300031901 Bacteria 822
96 Ga0307407_10386947 3300031903 Bacteria 1000
97 Ga0307407_10497904 3300031903 Bacteria 893
98 Ga0307412_10107998 3300031911 Bacteria 1982
99 Ga0307412_10332522 3300031911 Bacteria 1213
100 Ga0307412_10346071 3300031911 Bacteria 1192
101 Ga0307412_10403011 3300031911 Bacteria 1114
102 Ga0307409_100227005 3300031995 Bacteria 1690
103 Ga0307409_100518859 3300031995 Bacteria 1164
104 Ga0307409_101262957 3300031995 Bacteria 763
105 Ga0307416_100624223 3300032002 Bacteria 1160
106 Ga0307416_100700351 3300032002 Bacteria 1102
107 Ga0307414_10102763 3300032004 Bacteria 2155
108 Ga0307414_10138642 3300032004 Bacteria 1901
109 Ga0307414_10570677 3300032004 Bacteria 1011
110 Ga0307414_10775161 3300032004 Bacteria 873
111 Ga0307414_11030742 3300032004 Bacteria 758
112 Ga0307414_11034530 3300032004 Bacteria 757
113 Ga0395899_0021959 3300037312 Bacteria 4840
114 Ga0395899_0066486 3300037312 Bacteria 2647
115 Ga0395900_0006363 3300037418 Bacteria 12311
116 Ga0395900_0221038 3300037418 Bacteria 1909
117 Ga0395898_0000060 3300037466 Bacteria 273835
118 Ga0395898_0575453 3300037466 Bacteria 1069
119 Ga0395901_0271327 3300038443 Bacteria 1764
120 Ga0395901_1053430 3300038443 Bacteria 786
121 Ga0439465_0009501 3300041413 Bacteria 3063
122 Ga0439465_0138662 3300041413 Bacteria 863
123 Ga0451789_0428685 3300041443 Bacteria 1805
124 Ga0451789_0583784 3300041443 Bacteria 931
125 Ga0451791_1825207 3300041451 Bacteria 895
126 Ga0451793_1295235 3300041452 Bacteria 1088
127 Ga0451793_1405135 3300041452 Bacteria 619
128 Ga0451797_0449651 3300041453 Bacteria 525
129 Ga0451797_0702840 3300041453 Bacteria 700
130 Ga0451797_0782388 3300041453 Bacteria 526
131 Ga0451837_0115120 3300041494 Bacteria 909
132 Ga0451841_0646979 3300041498 Bacteria 1022
133 Ga0451849_0307891 3300041505 Bacteria 637
134 Ga0451843_0087126 3300041509 Bacteria 827
135 Ga0451853_0116608 3300041512 Bacteria 601
136 Ga0451853_1929312 3300041512 Bacteria 1437
137 Ga0451853_2648805 3300041512 Bacteria 1316
138 Ga0466972_0012956 3300044658 Bacteria 4189
139 Ga0466965_0000003 3300044683 Bacteria 265985
140 Ga0466965_0024011 3300044683 Bacteria 2947
141 Ga0466965_0349677 3300044683 Bacteria 809
142 Ga0466966_0040063 3300044684 Bacteria 3015
143 Ga0466966_0163760 3300044684 Bacteria 1353
144 Ga0466961_0026029 3300044693 Bacteria 3761
145 Ga0466961_0116646 3300044693 Bacteria 1678
146 Ga0466971_0097020 3300044719 Bacteria 1352
147 Ga0466968_0015706 3300044735 Bacteria 3006
148 Ga0466970_0000001 3300044765 Bacteria 252791
149 Ga0466970_0002959 3300044765 Bacteria 8236
150 Ga0466970_0030407 3300044765 Bacteria 2847
151 Ga0466970_0042721 3300044765 Bacteria 2411
152 Ga0466970_0067470 3300044765 Bacteria 1921
153 Ga0466957_0018878 3300044842 Bacteria 4053
154 Ga0466960_0019953 3300044901 Bacteria 2962
155 Ga0466960_0141600 3300044901 Bacteria 1278
156 Ga0466960_0313388 3300044901 Bacteria 887
157 Ga0466960_0326225 3300044901 Bacteria 870
158 Ga0466959_0006693 3300045049 Bacteria 8015
159 Ga0466959_0088679 3300045049 Bacteria 2223
160 Ga0466959_0293268 3300045049 Bacteria 1115
161 Ga0466959_0423139 3300045049 Bacteria 904
162 Ga0466967_1117980 3300045976 Bacteria 785
163 Ga0495638_0463508 3300046460 Bacteria 645
164 Ga0495620_0074209 3300046515 Bacteria 1386
165 Ga0495633_0163480 3300046558 Bacteria 1027
166 Ga0495633_0429111 3300046558 Bacteria 597
167 Ga0495656_0435423 3300046615 Bacteria 689
168 Ga0495672_0012519 3300047320 Bacteria 5915
169 Ga0495686_0071097 3300047472 Bacteria 2143
170 Ga0495686_0222865 3300047472 Bacteria 1072
171 Ga0495615_0097746 3300048090 Bacteria 826
172 Ga0496100_0004294 3300048903 Bacteria 7542
173 Ga0496100_0071415 3300048903 Bacteria 2318
174 Ga0496101_0145840 3300048904 Bacteria 1807
175 Ga0496101_0536273 3300048904 Bacteria 925
176 Ga0496102_0028824 3300048905 Bacteria 4963
177 Ga0496103_0011502 3300048906 Bacteria 5244
178 Ga0496103_0130142 3300048906 Bacteria 1607
179 Ga0496104_0064110 3300048907 Bacteria 3486
180 Ga0496104_0101230 3300048907 Bacteria 2758
181 Ga0496104_0497932 3300048907 Bacteria 1129
182 Ga0496104_0505138 3300048907 Bacteria 1120
183 Ga0496104_0530334 3300048907 Bacteria 1088
184 Ga0496104_1251160 3300048907 Bacteria 645
185 Ga0496105_0095269 3300048908 Bacteria 2459
186 Ga0496105_0149002 3300048908 Bacteria 1924
187 Ga0496105_0205320 3300048908 Bacteria 1607
188 Ga0496105_0205661 3300048908 Bacteria 1606
189 Ga0496105_0395616 3300048908 Bacteria 1097
190 Ga0496105_0733853 3300048908 Bacteria 756
191 Ga0496107_0050676 3300048910 Bacteria 2993
192 Ga0496108_0030968 3300048911 Bacteria 4435
193 Ga0496108_0038406 3300048911 Bacteria 3989
194 Ga0496109_0150724 3300048912 Bacteria 2177
195 Ga0496109_0270318 3300048912 Bacteria 1601
196 Ga0496110_0119485 3300048913 Bacteria 2374
197 Ga0496111_0142970 3300048914 Bacteria 1773
198 Ga0496111_0145419 3300048914 Bacteria 1757
199 Ga0496111_0802246 3300048914 Bacteria 681
200 Ga0496112_0518810 3300048915 Bacteria 1126
201 Ga0496112_0803868 3300048915 Bacteria 865
202 Ga0496113_0174451 3300048916 Bacteria 1703
203 Ga0496113_1120674 3300048916 Bacteria 617
204 Ga0496114_0036002 3300048917 Bacteria 4090
205 Ga0496114_0320501 3300048917 Bacteria 1369
206 Ga0496114_0428656 3300048917 Bacteria 1171
207 Ga0496115_0102704 3300048918 Bacteria 2345
208 Ga0496115_0134292 3300048918 Bacteria 2040
209 Ga0496115_0489030 3300048918 Bacteria 990
210 Ga0496115_0643960 3300048918 Bacteria 838
211 Ga0496115_1138922 3300048918 Bacteria 589
212 Ga0496116_0181844 3300048919 Bacteria 1125
213 Ga0496117_0000070 3300048920 Bacteria 245027
214 Ga0496117_0000823 3300048920 Bacteria 48067
215 Ga0496117_0009501 3300048920 Bacteria 9036
216 Ga0496117_0013867 3300048920 Bacteria 6988
217 Ga0496117_0015984 3300048920 Bacteria 6357
218 Ga0496117_0038218 3300048920 Bacteria 3564
219 Ga0496117_0171733 3300048920 Bacteria 1257
220 Ga0496118_0014687 3300048921 Bacteria 7317
221 Ga0496118_0017619 3300048921 Bacteria 6488
222 Ga0496118_0049884 3300048921 Bacteria 3218
223 Ga0496118_0055285 3300048921 Bacteria 2997
224 Ga0496118_0359046 3300048921 Bacteria 773
225 Ga0496118_0367837 3300048921 Bacteria 760
226 Ga0496119_0000817 3300048922 Bacteria 41568
227 Ga0496119_0005000 3300048922 Bacteria 12940
228 Ga0496119_0007035 3300048922 Bacteria 10237
229 Ga0496119_0034308 3300048922 Bacteria 3346
230 Ga0496119_0044145 3300048922 Bacteria 2809
231 Ga0496119_0049025 3300048922 Bacteria 2614
232 Ga0496119_0081458 3300048922 Bacteria 1864
233 Ga0496119_0284917 3300048922 Bacteria 820
234 Ga0496119_0482482 3300048922 Bacteria 579
235 Ga0496120_0001681 3300048923 Bacteria 25390
236 Ga0496120_0002074 3300048923 Bacteria 21539
237 Ga0496120_0041830 3300048923 Bacteria 2680
238 Ga0496121_0447142 3300048924 Bacteria 834
239 Ga0496122_0000022 3300048925 Bacteria 388704
240 Ga0496122_0000814 3300048925 Bacteria 59717
241 Ga0496122_0006310 3300048925 Bacteria 13664
242 Ga0496122_0006599 3300048925 Bacteria 13243
243 Ga0496122_0015336 3300048925 Bacteria 7332
244 Ga0496122_0065251 3300048925 Bacteria 2641
245 Ga0496122_0132280 3300048925 Bacteria 1582
246 Ga0496122_0208419 3300048925 Bacteria 1135
247 Ga0496123_0000009 3300048926 Bacteria 509486
248 Ga0496123_0000016 3300048926 Bacteria 424330
249 Ga0496123_0003217 3300048926 Bacteria 18606
250 Ga0496123_0141230 3300048926 Bacteria 1316
251 Ga0496124_0002146 3300048927 Bacteria 26489
252 Ga0496124_0003499 3300048927 Bacteria 19129
253 Ga0496124_0003966 3300048927 Bacteria 17645
254 Ga0496124_0546965 3300048927 Bacteria 765
255 Ga0496125_0008047 3300048928 Bacteria 11130
256 Ga0496125_0040352 3300048928 Bacteria 4006
257 Ga0496125_0050689 3300048928 Bacteria 3433
258 Ga0496125_0064155 3300048928 Bacteria 2921
259 Ga0496125_0078226 3300048928 Bacteria 2543
260 Ga0496125_0259439 3300048928 Bacteria 1090
261 Ga0496125_0630216 3300048928 Bacteria 580
262 Ga0496126_0016547 3300048929 Bacteria 7371
263 Ga0496126_0017372 3300048929 Bacteria 7169
264 Ga0496126_0031926 3300048929 Bacteria 4968
265 Ga0496126_0043294 3300048929 Bacteria 4153
266 Ga0496126_0047992 3300048929 Bacteria 3907
267 Ga0496126_0054594 3300048929 Bacteria 3617
268 Ga0496126_0065054 3300048929 Bacteria 3264
269 Ga0496126_0225858 3300048929 Bacteria 1570
270 Ga0496126_0433116 3300048929 Bacteria 1061
271 Ga0501031_0025283 3300049568 Bacteria 3874
272 Ga0501032_0116387 3300049569 Bacteria 1767
273 Ga0501033_0028850 3300049570 Bacteria 4169
274 Ga0501033_0030477 3300049570 Bacteria 4054
275 Ga0501033_0051228 3300049570 Bacteria 3060
276 Ga0501033_0058709 3300049570 Bacteria 2841
277 Ga0501033_0682624 3300049570 Bacteria 700
278 Ga0501033_0775766 3300049570 Bacteria 649
279 Ga0501034_0025846 3300049571 Bacteria 5980
280 Ga0501034_0068410 3300049571 Bacteria 3561
281 Ga0501034_0089253 3300049571 Bacteria 3080
282 Ga0501034_0416761 3300049571 Bacteria 1264
283 Ga0501034_0977187 3300049571 Bacteria 731
284 Ga0501036_0069469 3300049572 Bacteria 2979
285 Ga0501037_0006093 3300049573 Bacteria 8814
286 Ga0501037_0231861 3300049573 Bacteria 1296
287 Ga0501037_0278348 3300049573 Bacteria 1166
288 Ga0501037_0303051 3300049573 Bacteria 1109
289 Ga0501038_0018602 3300049574 Bacteria 6275
290 Ga0501038_0021407 3300049574 Bacteria 5804
291 Ga0501038_0040920 3300049574 Bacteria 4044
292 Ga0501038_0054617 3300049574 Bacteria 3435
293 Ga0501039_0018880 3300049575 Bacteria 5294
294 Ga0501039_0104086 3300049575 Bacteria 2216
295 Ga0501039_0796089 3300049575 Bacteria 738
296 Ga0501039_1195402 3300049575 Bacteria 588
297 Ga0501042_0001194 3300049578 Bacteria 15042
298 Ga0501043_0070573 3300049579 Bacteria 2744
299 Ga0501046_0013427 3300049580 Bacteria 6934
300 Ga0501046_0017044 3300049580 Bacteria 6072
301 Ga0501047_0045030 3300049581 Bacteria 4265
302 Ga0501047_0047883 3300049581 Bacteria 4129
303 Ga0501047_0083327 3300049581 Bacteria 3073
304 Ga0501070_0001615 3300049586 Bacteria 19994
305 Ga0501070_0001882 3300049586 Bacteria 18547
306 Ga0501070_0009122 3300049586 Bacteria 8389
307 Ga0501070_0054406 3300049586 Bacteria 3319
308 Ga0501070_0152356 3300049586 Bacteria 1907
309 Ga0501071_0002104 3300049587 Bacteria 11944
310 Ga0501073_0175056 3300049589 Bacteria 1485
311 Ga0501079_0483037 3300049741 Bacteria 974
312 Ga0501083_0000076 3300049744 Bacteria 65990
313 Ga0501083_0078835 3300049744 Bacteria 2184
314 Ga0501083_0089429 3300049744 Bacteria 2035
315 Ga0501035_0026444 3300049822 Bacteria 5308
316 Ga0501035_0038236 3300049822 Bacteria 4345
317 Ga0501035_0975076 3300049822 Bacteria 668
318 Ga0501044_0071216 3300049823 Bacteria 3535
319 Ga0501044_0137108 3300049823 Bacteria 2438
320 Ga0501044_0433506 3300049823 Bacteria 1223
321 Ga0501044_0965659 3300049823 Bacteria 725
322 Ga0501045_0026394 3300049824 Bacteria 4178
323 nmdc:mga03n38_298462_c1 3300050490 Bacteria 864
324 nmdc:mga00v17_202204_c1 3300050491 Bacteria 1284
325 nmdc:mga00v17_22738_c1 3300050491 Bacteria 3621
326 nmdc:mga00v17_25309_c1 3300050491 Bacteria 3449
327 nmdc:mga00v17_33107_c1 3300050491 Bacteria 3060
328 nmdc:mga00v17_335875_c1 3300050491 Bacteria 982
329 nmdc:mga0yw44_441536_c1 3300050492 Bacteria 881
330 nmdc:mga06z11_218727_c1 3300050494 Bacteria 1112
331 nmdc:mga06z11_77807_c1 3300050494 Bacteria 1772
332 nmdc:mga04h51_255250_c1 3300050495 Bacteria 704
333 nmdc:mga07m45_282128_c1 3300050496 Bacteria 966
334 nmdc:mga0sz30_1437_c2 3300050516 Bacteria 6774
335 nmdc:mga0sz30_51993_c1 3300050516 Bacteria 1739
336 Ga0500635_0000108 3300053080 Bacteria 49899
337 Ga0500556_0000020 3300053104 Bacteria 185929
338 Ga0500655_021150 3300053133 Bacteria 1219
339 Ga0500559_0000132 3300053136 Bacteria 57521
340 Ga0500559_0036456 3300053136 Bacteria 2127
341 Ga0500568_0000012 3300053139 Bacteria 225711
342 Ga0500573_0000052 3300053140 Bacteria 94687
343 Ga0500573_0009329 3300053140 Bacteria 5438
344 Ga0500577_0012849 3300053142 Bacteria 2542
345 Ga0501082_0644997 3300060353 Bacteria 927
346 Ga0501082_0889119 3300060353 Bacteria 779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0006310 Ga0496122_0006310_10030_10518 139
2 3300048928 Ga0496125_0078226 Ga0496125_0078226_1099_1587 139
3 3300048929 Ga0496126_0433116 Ga0496126_0433116_466_954 139
4 3300031649 Ga0307514_10008865 Ga0307514_100088654 143
5 3300032002 Ga0307416_100624223 Ga0307416_1006242232 145
6 iso_pu_bacteria 2939657138 2939659492 145
7 iso_pu_bacteria 2995726249 2995728333 145
8 3300031911 Ga0307412_10332522 Ga0307412_103325222 146
9 3300037418 Ga0395900_0006363 Ga0395900_0006363_3591_4031 146
10 3300013104 Ga0157370_10367856 Ga0157370_103678561 147
11 3300041443 Ga0451789_0428685 Ga0451789_0428685_1323_1766 147
12 3300041509 Ga0451843_0087126 Ga0451843_0087126_177_665 147
13 3300041512 Ga0451853_2648805 Ga0451853_2648805_71_559 147
14 3300046558 Ga0495633_0429111 Ga0495633_0429111_88_576 147
15 iso_pu_bacteria 2966924647 2966926444 147
16 3300006051 Ga0075364_10052725 Ga0075364_100527253 148
17 3300031731 Ga0307405_10109406 Ga0307405_101094062 148
18 3300031911 Ga0307412_10107998 Ga0307412_101079983 148
19 3300032004 Ga0307414_11034530 Ga0307414_110345302 148
20 3300044683 Ga0466965_0000003 Ga0466965_0000003_58707_59153 148
21 3300049570 Ga0501033_0030477 Ga0501033_0030477_1386_1832 148
22 3300049571 Ga0501034_0068410 Ga0501034_0068410_123_569 148
23 3300049571 Ga0501034_0977187 Ga0501034_0977187_226_672 148
24 3300049573 Ga0501037_0278348 Ga0501037_0278348_150_596 148
25 3300049574 Ga0501038_0018602 Ga0501038_0018602_1203_1649 148
26 3300049574 Ga0501038_0054617 Ga0501038_0054617_1175_1621 148
27 3300049575 Ga0501039_0104086 Ga0501039_0104086_1550_1996 148
28 3300049823 Ga0501044_0137108 Ga0501044_0137108_1788_2234 148
29 3300053136 Ga0500559_0000132 Ga0500559_0000132_5299_5745 148
30 3300053140 Ga0500573_0000052 Ga0500573_0000052_4230_4676 148
31 3300053140 Ga0500573_0009329 Ga0500573_0009329_3347_3793 148
32 3300060353 Ga0501082_0889119 Ga0501082_0889119_261_707 148
33 3300032004 Ga0307414_10138642 Ga0307414_101386423 149
34 3300032004 Ga0307414_11030742 Ga0307414_110307421 149
35 3300044765 Ga0466970_0000001 Ga0466970_0000001_75737_76225 149
36 3300045976 Ga0466967_1117980 Ga0466967_1117980_122_610 149
37 3300003316 rootH1_10087931 rootH1_100879312 150
38 3300048922 Ga0496119_0284917 Ga0496119_0284917_315_767 150
39 3300053136 Ga0500559_0036456 Ga0500559_0036456_188_640 150
40 3300053142 Ga0500577_0012849 Ga0500577_0012849_132_584 150
41 3300002738 JGI25154J39366_1000583 JGI25154J39366_100058313 151
42 3300047320 Ga0495672_0012519 Ga0495672_0012519_2685_3140 151
43 3300047472 Ga0495686_0071097 Ga0495686_0071097_540_995 151
44 3300053104 Ga0500556_0000020 Ga0500556_0000020_82644_83099 151
45 3300053133 Ga0500655_021150 Ga0500655_021150_54_509 151
46 3300053139 Ga0500568_0000012 Ga0500568_0000012_186849_187304 151
47 iso_pu_bacteria 2852677369 2852678551 151
48 3300006038 Ga0075365_10088244 Ga0075365_100882442 152
49 3300006051 Ga0075364_10257156 Ga0075364_102571561 152
50 3300041413 Ga0439465_0138662 Ga0439465_0138662_129_617 152
51 3300048920 Ga0496117_0000823 Ga0496117_0000823_30836_31324 152
52 3300048921 Ga0496118_0055285 Ga0496118_0055285_1209_1697 152
53 3300048922 Ga0496119_0081458 Ga0496119_0081458_460_948 152
54 3300048922 Ga0496119_0482482 Ga0496119_0482482_60_548 152
55 3300048924 Ga0496121_0447142 Ga0496121_0447142_218_706 152
56 3300048928 Ga0496125_0008047 Ga0496125_0008047_6363_6851 152
57 3300048929 Ga0496126_0017372 Ga0496126_0017372_4624_5112 152
58 3300048929 Ga0496126_0047992 Ga0496126_0047992_2445_2933 152
59 3300050491 nmdc:mga00v17_335875_c1 nmdc:mga00v17_335875_c1_124_612 152
60 3300050492 nmdc:mga0yw44_441536_c1 nmdc:mga0yw44_441536_c1_137_595 152
61 3300049571 Ga0501034_0025846 Ga0501034_0025846_4654_5142 153
62 3300049575 Ga0501039_1195402 Ga0501039_1195402_65_553 153
63 iso_pu_bacteria 2811994872 2812322050 153
64 3300041453 Ga0451797_0782388 Ga0451797_0782388_13_477 154
65 3300005288 Ga0065714_10016783 Ga0065714_100167833 156
66 3300005548 Ga0070665_100123244 Ga0070665_1001232442 156
67 3300005564 Ga0070664_100799185 Ga0070664_1007991851 156
68 3300006353 Ga0075370_10131832 Ga0075370_101318322 156
69 3300013105 Ga0157369_10111107 Ga0157369_101111073 156
70 3300013307 Ga0157372_10240471 Ga0157372_102404712 156
71 3300013308 Ga0157375_11019999 Ga0157375_110199992 156
72 3300017792 Ga0163161_10086799 Ga0163161_100867992 156
73 3300025904 Ga0207647_10308500 Ga0207647_103085002 156
74 3300025945 Ga0207679_10495107 Ga0207679_104951072 156
75 3300027866 Ga0209813_10165033 Ga0209813_101650331 156
76 3300028379 Ga0268266_10170911 Ga0268266_101709112 156
77 3300048904 Ga0496101_0145840 Ga0496101_0145840_1278_1790 156
78 3300048906 Ga0496103_0130142 Ga0496103_0130142_73_585 156
79 3300048908 Ga0496105_0095269 Ga0496105_0095269_1595_2107 156
80 3300048917 Ga0496114_0036002 Ga0496114_0036002_2247_2759 156
81 3300048920 Ga0496117_0171733 Ga0496117_0171733_127_648 156
82 3300048929 Ga0496126_0043294 Ga0496126_0043294_1845_2357 156
83 3300050490 nmdc:mga03n38_298462_c1 nmdc:mga03n38_298462_c1_378_848 156
84 3300005539 Ga0068853_100057965 Ga0068853_1000579653 157
85 3300025246 Ga0209646_1000041 Ga0209646_1000041333 157
86 3300031548 Ga0307408_100307392 Ga0307408_1003073922 157
87 3300032004 Ga0307414_10775161 Ga0307414_107751612 157
88 3300041453 Ga0451797_0449651 Ga0451797_0449651_10_486 158
89 iso_pu_bacteria 2585428157 2588107922 158
90 iso_pu_bacteria 2643221542 2643734714 158
91 iso_pu_bacteria 2643221553 2643783621 158
92 iso_pu_bacteria 2643221566 2643847746 158
93 iso_pu_bacteria 2643221575 2643888060 158
94 iso_pu_bacteria 2643221597 2643994774 158
95 iso_pu_bacteria 2643221630 2644172879 158
96 iso_pu_bacteria 2747842429 2747952963 158
97 iso_pu_bacteria 2757320536 2758224905 158
98 iso_pu_bacteria 2773857758 2774378956 158
99 iso_pu_bacteria 2808606306 2808628813 158
100 iso_pu_bacteria 2821268502 2821268956 158
101 iso_pu_bacteria 2833709550 2833709849 158
102 iso_pu_bacteria 2852663356 2852666032 158
103 iso_pu_bacteria 2857723135 2857724549 158
104 iso_pu_bacteria 2870628048 2870629355 158
105 iso_pu_bacteria 2904509784 2904510418 158
106 iso_pu_bacteria 2908678064 2908678364 158
107 iso_pu_bacteria 2919069694 2919070688 158
108 iso_pu_bacteria 2919395869 2919397812 158
109 iso_pu_bacteria 2946033335 2946034859 158
110 iso_pu_bacteria 2946041624 2946043048 158
111 iso_pu_bacteria 2946080515 2946081920 158
112 iso_pu_bacteria 2974294766 2974294906 158
113 iso_pu_bacteria 2974324384 2974325293 158
114 iso_pu_bacteria 2977228692 2977230261 158
115 iso_pu_bacteria 2977236895 2977239063 158
116 iso_pu_bacteria 2977264416 2977265460 158
117 iso_pu_bacteria 2984542743 2984543152 158
118 iso_pu_bacteria 8004182704 8004183427 158
119 iso_pu_bacteria 8016254467 8016255238 158
120 iso_pu_bacteria 2773857763 2774400816 159
121 iso_pu_bacteria 8045830549 8045832139 159
122 iso_pu_bacteria 2643221649 2644277854 160
123 iso_pu_bacteria 2808606447 2809226211 160
124 iso_pu_bacteria 2852632344 2852632470 160
125 iso_pu_bacteria 2852646457 2852648430 160
126 iso_pu_bacteria 2939660829 2939662673 160
127 iso_pu_bacteria 2945968032 2945970708 160
128 iso_pu_bacteria 2964326757 2964328417 160
129 iso_pu_bacteria 8004212874 8004213174 160
130 3300049586 Ga0501070_0009122 Ga0501070_0009122_1050_1535 161
131 3300049587 Ga0501071_0002104 Ga0501071_0002104_9693_10178 161
132 3300049744 Ga0501083_0089429 Ga0501083_0089429_964_1449 161
133 iso_pu_bacteria 2643221572 2643876490 161
134 iso_pu_bacteria 2643221616 2644096354 161
135 iso_pu_bacteria 2643221619 2644112045 161
136 iso_pu_bacteria 2643221632 2644182342 161
137 iso_pu_bacteria 2643221669 2644383545 161
138 iso_pu_bacteria 2721755702 2723643200 161
139 iso_pu_bacteria 2844841374 2844843417 161
140 iso_pu_bacteria 2857729791 2857733317 161
141 iso_pu_bacteria 2884763398 2884766442 161
142 iso_pu_bacteria 2895660088 2895660665 161
143 iso_pu_bacteria 2919055335 2919055395 161
144 iso_pu_bacteria 2919523602 2919525472 161
145 iso_pu_bacteria 2928121344 2928121511 161
146 iso_pu_bacteria 2928153084 2928153554 161
147 iso_pu_bacteria 2935409751 2935412067 161
148 3300005339 Ga0070660_100141865 Ga0070660_1001418653 162
149 3300005366 Ga0070659_100367799 Ga0070659_1003677992 162
150 3300006042 Ga0075368_10098866 Ga0075368_100988662 162
151 3300006051 Ga0075364_10003400 Ga0075364_100034007 162
152 3300006051 Ga0075364_10211061 Ga0075364_102110611 162
153 3300006178 Ga0075367_10174568 Ga0075367_101745682 162
154 3300006186 Ga0075369_10013418 Ga0075369_100134185 162
155 3300006186 Ga0075369_10239114 Ga0075369_102391142 162
156 3300009036 Ga0105244_10018680 Ga0105244_100186803 162
157 3300009545 Ga0105237_10070287 Ga0105237_100702874 162
158 3300013104 Ga0157370_10293729 Ga0157370_102937292 162
159 3300013250 Ga0171462_1001 Ga0171462_1001872 162
160 3300013306 Ga0163162_10118835 Ga0163162_101188354 162
161 3300013307 Ga0157372_10121293 Ga0157372_101212933 162
162 3300013308 Ga0157375_10691187 Ga0157375_106911872 162
163 3300013308 Ga0157375_12749930 Ga0157375_127499301 162
164 3300014325 Ga0163163_11559959 Ga0163163_115599592 162
165 3300025728 Ga0207655_1024481 Ga0207655_10244812 162
166 3300025904 Ga0207647_10033043 Ga0207647_100330434 162
167 3300025914 Ga0207671_10081003 Ga0207671_100810033 162
168 3300025919 Ga0207657_10144192 Ga0207657_101441922 162
169 3300031901 Ga0307406_10004625 Ga0307406_100046258 162
170 3300031903 Ga0307407_10386947 Ga0307407_103869472 162
171 3300031903 Ga0307407_10497904 Ga0307407_104979041 162
172 3300031911 Ga0307412_10346071 Ga0307412_103460712 162
173 3300032004 Ga0307414_10102763 Ga0307414_101027632 162
174 3300032004 Ga0307414_10570677 Ga0307414_105706772 162
175 3300038443 Ga0395901_0271327 Ga0395901_0271327_1235_1723 162
176 3300038443 Ga0395901_1053430 Ga0395901_1053430_170_658 162
177 3300041413 Ga0439465_0009501 Ga0439465_0009501_920_1408 162
178 3300041451 Ga0451791_1825207 Ga0451791_1825207_210_698 162
179 3300041452 Ga0451793_1295235 Ga0451793_1295235_62_550 162
180 3300041452 Ga0451793_1405135 Ga0451793_1405135_86_574 162
181 3300041453 Ga0451797_0702840 Ga0451797_0702840_121_609 162
182 3300041494 Ga0451837_0115120 Ga0451837_0115120_337_825 162
183 3300041505 Ga0451849_0307891 Ga0451849_0307891_119_607 162
184 3300041512 Ga0451853_1929312 Ga0451853_1929312_28_516 162
185 3300044765 Ga0466970_0042721 Ga0466970_0042721_1792_2280 162
186 3300044901 Ga0466960_0141600 Ga0466960_0141600_594_1082 162
187 3300045049 Ga0466959_0423139 Ga0466959_0423139_117_605 162
188 3300046460 Ga0495638_0463508 Ga0495638_0463508_70_558 162
189 3300046515 Ga0495620_0074209 Ga0495620_0074209_884_1372 162
190 3300046558 Ga0495633_0163480 Ga0495633_0163480_513_1001 162
191 3300046615 Ga0495656_0435423 Ga0495656_0435423_26_514 162
192 3300047472 Ga0495686_0222865 Ga0495686_0222865_510_998 162
193 3300048090 Ga0495615_0097746 Ga0495615_0097746_87_575 162
194 3300048903 Ga0496100_0004294 Ga0496100_0004294_4792_5280 162
195 3300048905 Ga0496102_0028824 Ga0496102_0028824_2573_3061 162
196 3300048906 Ga0496103_0011502 Ga0496103_0011502_4708_5196 162
197 3300048907 Ga0496104_0064110 Ga0496104_0064110_2273_2761 162
198 3300048907 Ga0496104_0497932 Ga0496104_0497932_321_809 162
199 3300048907 Ga0496104_0505138 Ga0496104_0505138_507_995 162
200 3300048907 Ga0496104_1251160 Ga0496104_1251160_56_544 162
201 3300048908 Ga0496105_0205320 Ga0496105_0205320_1023_1511 162
202 3300048908 Ga0496105_0205661 Ga0496105_0205661_683_1171 162
203 3300048908 Ga0496105_0395616 Ga0496105_0395616_507_995 162
204 3300048908 Ga0496105_0733853 Ga0496105_0733853_122_610 162
205 3300048910 Ga0496107_0050676 Ga0496107_0050676_29_517 162
206 3300048911 Ga0496108_0030968 Ga0496108_0030968_2772_3260 162
207 3300048911 Ga0496108_0038406 Ga0496108_0038406_3132_3620 162
208 3300048912 Ga0496109_0150724 Ga0496109_0150724_708_1196 162
209 3300048912 Ga0496109_0270318 Ga0496109_0270318_49_537 162
210 3300048913 Ga0496110_0119485 Ga0496110_0119485_570_1058 162
211 3300048914 Ga0496111_0142970 Ga0496111_0142970_242_730 162
212 3300048914 Ga0496111_0145419 Ga0496111_0145419_709_1197 162
213 3300048914 Ga0496111_0802246 Ga0496111_0802246_132_620 162
214 3300048915 Ga0496112_0518810 Ga0496112_0518810_180_668 162
215 3300048915 Ga0496112_0803868 Ga0496112_0803868_204_692 162
216 3300048916 Ga0496113_0174451 Ga0496113_0174451_953_1441 162
217 3300048917 Ga0496114_0428656 Ga0496114_0428656_488_976 162
218 3300048918 Ga0496115_0134292 Ga0496115_0134292_1458_1946 162
219 3300048919 Ga0496116_0181844 Ga0496116_0181844_170_658 162
220 3300048920 Ga0496117_0000070 Ga0496117_0000070_156118_156606 162
221 3300048920 Ga0496117_0009501 Ga0496117_0009501_5469_5957 162
222 3300048920 Ga0496117_0013867 Ga0496117_0013867_1859_2347 162
223 3300048920 Ga0496117_0038218 Ga0496117_0038218_2837_3325 162
224 3300048921 Ga0496118_0017619 Ga0496118_0017619_4111_4599 162
225 3300048921 Ga0496118_0049884 Ga0496118_0049884_1653_2141 162
226 3300048921 Ga0496118_0367837 Ga0496118_0367837_141_629 162
227 3300048922 Ga0496119_0000817 Ga0496119_0000817_29436_29924 162
228 3300048922 Ga0496119_0005000 Ga0496119_0005000_10272_10760 162
229 3300048922 Ga0496119_0007035 Ga0496119_0007035_6085_6573 162
230 3300048922 Ga0496119_0034308 Ga0496119_0034308_2626_3114 162
231 3300048922 Ga0496119_0044145 Ga0496119_0044145_2125_2613 162
232 3300048922 Ga0496119_0049025 Ga0496119_0049025_177_665 162
233 3300048923 Ga0496120_0001681 Ga0496120_0001681_15441_15929 162
234 3300048923 Ga0496120_0002074 Ga0496120_0002074_17056_17544 162
235 3300048923 Ga0496120_0041830 Ga0496120_0041830_764_1252 162
236 3300048925 Ga0496122_0000022 Ga0496122_0000022_286082_286570 162
237 3300048925 Ga0496122_0000814 Ga0496122_0000814_53029_53517 162
238 3300048925 Ga0496122_0006599 Ga0496122_0006599_3767_4255 162
239 3300048925 Ga0496122_0015336 Ga0496122_0015336_6240_6728 162
240 3300048925 Ga0496122_0065251 Ga0496122_0065251_1618_2106 162
241 3300048925 Ga0496122_0132280 Ga0496122_0132280_296_784 162
242 3300048926 Ga0496123_0000009 Ga0496123_0000009_337840_338328 162
243 3300048926 Ga0496123_0000016 Ga0496123_0000016_321565_322053 162
244 3300048926 Ga0496123_0003217 Ga0496123_0003217_13015_13503 162
245 3300048926 Ga0496123_0141230 Ga0496123_0141230_380_868 162
246 3300048927 Ga0496124_0002146 Ga0496124_0002146_6180_6668 162
247 3300048927 Ga0496124_0003499 Ga0496124_0003499_17240_17728 162
248 3300048927 Ga0496124_0003966 Ga0496124_0003966_14310_14798 162
249 3300048927 Ga0496124_0546965 Ga0496124_0546965_190_678 162
250 3300048928 Ga0496125_0040352 Ga0496125_0040352_2363_2851 162
251 3300048928 Ga0496125_0050689 Ga0496125_0050689_2164_2652 162
252 3300048928 Ga0496125_0064155 Ga0496125_0064155_2136_2624 162
253 3300048928 Ga0496125_0259439 Ga0496125_0259439_142_630 162
254 3300048928 Ga0496125_0630216 Ga0496125_0630216_29_517 162
255 3300048929 Ga0496126_0016547 Ga0496126_0016547_1917_2405 162
256 3300048929 Ga0496126_0065054 Ga0496126_0065054_571_1059 162
257 3300048929 Ga0496126_0225858 Ga0496126_0225858_928_1416 162
258 3300049570 Ga0501033_0028850 Ga0501033_0028850_2120_2608 162
259 3300049570 Ga0501033_0775766 Ga0501033_0775766_149_637 162
260 3300049571 Ga0501034_0089253 Ga0501034_0089253_1871_2359 162
261 3300049573 Ga0501037_0303051 Ga0501037_0303051_348_836 162
262 3300049574 Ga0501038_0040920 Ga0501038_0040920_1285_1773 162
263 3300049578 Ga0501042_0001194 Ga0501042_0001194_2183_2671 162
264 3300049581 Ga0501047_0083327 Ga0501047_0083327_1338_1826 162
265 3300049586 Ga0501070_0001615 Ga0501070_0001615_16720_17208 162
266 3300049744 Ga0501083_0000076 Ga0501083_0000076_13162_13650 162
267 3300049822 Ga0501035_0975076 Ga0501035_0975076_149_637 162
268 3300049823 Ga0501044_0433506 Ga0501044_0433506_714_1202 162
269 3300049823 Ga0501044_0965659 Ga0501044_0965659_213_701 162
270 3300050491 nmdc:mga00v17_202204_c1 nmdc:mga00v17_202204_c1_535_1023 162
271 3300050491 nmdc:mga00v17_22738_c1 nmdc:mga00v17_22738_c1_574_1062 162
272 3300050491 nmdc:mga00v17_25309_c1 nmdc:mga00v17_25309_c1_968_1456 162
273 3300050491 nmdc:mga00v17_33107_c1 nmdc:mga00v17_33107_c1_2092_2580 162
274 3300050494 nmdc:mga06z11_218727_c1 nmdc:mga06z11_218727_c1_119_607 162
275 3300050494 nmdc:mga06z11_77807_c1 nmdc:mga06z11_77807_c1_1043_1531 162
276 3300050495 nmdc:mga04h51_255250_c1 nmdc:mga04h51_255250_c1_121_609 162
277 3300050496 nmdc:mga07m45_282128_c1 nmdc:mga07m45_282128_c1_233_721 162
278 3300050516 nmdc:mga0sz30_51993_c1 nmdc:mga0sz30_51993_c1_764_1252 162
279 iso_pu_bacteria 2643221546 2643753686 162
280 3300031731 Ga0307405_10357623 Ga0307405_103576232 163
281 3300031824 Ga0307413_10284418 Ga0307413_102844182 163
282 3300031901 Ga0307406_10639420 Ga0307406_106394202 163
283 3300041443 Ga0451789_0583784 Ga0451789_0583784_423_914 163
284 3300041512 Ga0451853_0116608 Ga0451853_0116608_76_567 163
285 3300044735 Ga0466968_0015706 Ga0466968_0015706_1664_2155 163
286 3300044765 Ga0466970_0067470 Ga0466970_0067470_588_1079 163
287 3300044901 Ga0466960_0019953 Ga0466960_0019953_437_928 163
288 3300044901 Ga0466960_0313388 Ga0466960_0313388_109_600 163
289 3300049570 Ga0501033_0051228 Ga0501033_0051228_1219_1710 163
290 3300049571 Ga0501034_0416761 Ga0501034_0416761_599_1090 163
291 3300049573 Ga0501037_0231861 Ga0501037_0231861_535_1026 163
292 3300049575 Ga0501039_0796089 Ga0501039_0796089_24_515 163
293 3300049579 Ga0501043_0070573 Ga0501043_0070573_891_1382 163
294 3300049580 Ga0501046_0017044 Ga0501046_0017044_3323_3814 163
295 3300049581 Ga0501047_0045030 Ga0501047_0045030_1625_2116 163
296 3300049586 Ga0501070_0152356 Ga0501070_0152356_1342_1833 163
297 3300049823 Ga0501044_0071216 Ga0501044_0071216_1693_2184 163
298 3300005327 Ga0070658_10032547 Ga0070658_100325473 164
299 3300031901 Ga0307406_10744112 Ga0307406_107441122 164
300 3300031911 Ga0307412_10403011 Ga0307412_104030111 164
301 3300031995 Ga0307409_100518859 Ga0307409_1005188592 164
302 3300048929 Ga0496126_0031926 Ga0496126_0031926_4367_4861 164
303 3300048929 Ga0496126_0054594 Ga0496126_0054594_1487_1981 164
304 3300001990 JGI24737J22298_10014430 JGI24737J22298_100144302 165
305 3300002067 JGI24735J21928_10013419 JGI24735J21928_100134192 165
306 3300002772 JGI25164J39214_1001692 JGI25164J39214_10016924 165
307 3300003214 JGI25165J46597_1000269 JGI25165J46597_100026951 165
308 3300003578 Ga0006562J51391_1193684 Ga0006562J51391_11936848 165
309 3300003578 Ga0006562J51391_1193685 Ga0006562J51391_11936856 165
310 3300003752 Ga0055539_1000090 Ga0055539_100009012 165
311 3300003756 Ga0055533_1000001 Ga0055533_10000011730 165
312 3300003758 Ga0055532_1008061 Ga0055532_10080611 165
313 3300003759 Ga0055525_1000126 Ga0055525_100012613 165
314 3300003760 Ga0055527_1000064 Ga0055527_100006487 165
315 3300003762 Ga0055542_1000023 Ga0055542_10000236 165
316 3300003763 Ga0055529_1000050 Ga0055529_10000506 165
317 3300003763 Ga0055529_1023164 Ga0055529_10231641 165
318 3300005435 Ga0070714_100412629 Ga0070714_1004126292 165
319 3300006186 Ga0075369_10010891 Ga0075369_100108917 165
320 3300009036 Ga0105244_10058384 Ga0105244_100583843 165
321 3300013104 Ga0157370_10267141 Ga0157370_102671412 165
322 3300013105 Ga0157369_10024848 Ga0157369_100248483 165
323 3300013105 Ga0157369_10241071 Ga0157369_102410712 165
324 3300013105 Ga0157369_10739413 Ga0157369_107394132 165
325 3300013307 Ga0157372_10109028 Ga0157372_101090281 165
326 3300013307 Ga0157372_11281465 Ga0157372_112814652 165
327 3300020069 Ga0197907_10669710 Ga0197907_106697102 165
328 3300020081 Ga0206354_10426408 Ga0206354_104264082 165
329 3300020082 Ga0206353_11263019 Ga0206353_112630192 165
330 3300020082 Ga0206353_11519977 Ga0206353_115199772 165
331 3300022467 Ga0224712_10013001 Ga0224712_100130012 165
332 3300025225 Ga0209566_100066 Ga0209566_10006697 165
333 3300025226 Ga0209674_100001 Ga0209674_1000011733 165
334 3300025228 Ga0209672_100116 Ga0209672_1001167 165
335 3300025229 Ga0209147_105105 Ga0209147_1051052 165
336 3300025230 Ga0209563_100001 Ga0209563_1000011733 165
337 3300025230 Ga0209563_105220 Ga0209563_1052203 165
338 3300025231 Ga0207427_100054 Ga0207427_100054191 165
339 3300025233 Ga0209437_104104 Ga0209437_1041041 165
340 3300025242 Ga0209258_102773 Ga0209258_1027734 165
341 3300025253 Ga0209677_100001 Ga0209677_1000011733 165
342 3300025253 Ga0209677_102888 Ga0209677_1028884 165
343 3300025254 Ga0209148_1000240 Ga0209148_10002407 165
344 3300025261 Ga0209233_1000001 Ga0209233_10000011068 165
345 3300025272 Ga0209455_1000197 Ga0209455_10001977 165
346 3300025272 Ga0209455_1000681 Ga0209455_100068115 165
347 3300025925 Ga0207650_10657675 Ga0207650_106576752 165
348 3300025929 Ga0207664_10350838 Ga0207664_103508382 165
349 3300031995 Ga0307409_100227005 Ga0307409_1002270052 165
350 3300031995 Ga0307409_101262957 Ga0307409_1012629571 165
351 3300032002 Ga0307416_100700351 Ga0307416_1007003512 165
352 3300037312 Ga0395899_0021959 Ga0395899_0021959_1959_2456 165
353 3300037312 Ga0395899_0066486 Ga0395899_0066486_1181_1708 165
354 3300037418 Ga0395900_0221038 Ga0395900_0221038_141_638 165
355 3300037466 Ga0395898_0000060 Ga0395898_0000060_12112_12639 165
356 3300037466 Ga0395898_0575453 Ga0395898_0575453_250_747 165
357 3300041498 Ga0451841_0646979 Ga0451841_0646979_50_574 165
358 3300044658 Ga0466972_0012956 Ga0466972_0012956_3141_3638 165
359 3300044683 Ga0466965_0024011 Ga0466965_0024011_1049_1546 165
360 3300044683 Ga0466965_0349677 Ga0466965_0349677_289_795 165
361 3300044684 Ga0466966_0040063 Ga0466966_0040063_1775_2272 165
362 3300044684 Ga0466966_0163760 Ga0466966_0163760_507_1004 165
363 3300044693 Ga0466961_0026029 Ga0466961_0026029_669_1166 165
364 3300044693 Ga0466961_0116646 Ga0466961_0116646_929_1426 165
365 3300044719 Ga0466971_0097020 Ga0466971_0097020_164_661 165
366 3300044765 Ga0466970_0002959 Ga0466970_0002959_4414_4911 165
367 3300044765 Ga0466970_0030407 Ga0466970_0030407_651_1148 165
368 3300044842 Ga0466957_0018878 Ga0466957_0018878_1205_1702 165
369 3300044901 Ga0466960_0326225 Ga0466960_0326225_258_764 165
370 3300045049 Ga0466959_0006693 Ga0466959_0006693_4737_5234 165
371 3300045049 Ga0466959_0088679 Ga0466959_0088679_992_1489 165
372 3300045049 Ga0466959_0293268 Ga0466959_0293268_498_1004 165
373 3300048903 Ga0496100_0071415 Ga0496100_0071415_619_1125 165
374 3300048904 Ga0496101_0536273 Ga0496101_0536273_75_581 165
375 3300048907 Ga0496104_0101230 Ga0496104_0101230_912_1424 165
376 3300048907 Ga0496104_0530334 Ga0496104_0530334_191_697 165
377 3300048908 Ga0496105_0149002 Ga0496105_0149002_727_1233 165
378 3300048916 Ga0496113_1120674 Ga0496113_1120674_107_604 165
379 3300048917 Ga0496114_0320501 Ga0496114_0320501_457_963 165
380 3300048918 Ga0496115_0102704 Ga0496115_0102704_697_1203 165
381 3300048918 Ga0496115_0489030 Ga0496115_0489030_31_537 165
382 3300048918 Ga0496115_0643960 Ga0496115_0643960_273_779 165
383 3300048918 Ga0496115_1138922 Ga0496115_1138922_16_522 165
384 3300048920 Ga0496117_0015984 Ga0496117_0015984_4648_5145 165
385 3300048921 Ga0496118_0014687 Ga0496118_0014687_5459_5980 165
386 3300048921 Ga0496118_0359046 Ga0496118_0359046_205_729 165
387 3300048925 Ga0496122_0208419 Ga0496122_0208419_194_718 165
388 3300049568 Ga0501031_0025283 Ga0501031_0025283_2110_2610 165
389 3300049569 Ga0501032_0116387 Ga0501032_0116387_1085_1585 165
390 3300049570 Ga0501033_0058709 Ga0501033_0058709_705_1205 165
391 3300049570 Ga0501033_0682624 Ga0501033_0682624_182_679 165
392 3300049572 Ga0501036_0069469 Ga0501036_0069469_2384_2884 165
393 3300049573 Ga0501037_0006093 Ga0501037_0006093_1014_1514 165
394 3300049574 Ga0501038_0021407 Ga0501038_0021407_4957_5457 165
395 3300049575 Ga0501039_0018880 Ga0501039_0018880_2006_2506 165
396 3300049580 Ga0501046_0013427 Ga0501046_0013427_969_1469 165
397 3300049581 Ga0501047_0047883 Ga0501047_0047883_2114_2614 165
398 3300049586 Ga0501070_0001882 Ga0501070_0001882_9499_10026 165
399 3300049586 Ga0501070_0054406 Ga0501070_0054406_683_1183 165
400 3300049589 Ga0501073_0175056 Ga0501073_0175056_28_528 165
401 3300049741 Ga0501079_0483037 Ga0501079_0483037_95_595 165
402 3300049744 Ga0501083_0078835 Ga0501083_0078835_219_719 165
403 3300049822 Ga0501035_0026444 Ga0501035_0026444_4498_4998 165
404 3300049822 Ga0501035_0038236 Ga0501035_0038236_521_1048 165
405 3300049824 Ga0501045_0026394 Ga0501045_0026394_681_1181 165
406 3300050516 nmdc:mga0sz30_1437_c2 nmdc:mga0sz30_1437_c2_5705_6208 165
407 3300053080 Ga0500635_0000108 Ga0500635_0000108_38570_39100 165
408 3300060353 Ga0501082_0644997 Ga0501082_0644997_369_869 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10263

SprT-like

SprT-like family

2

99

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.8116 7 96
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.7895 1 90
4qhh-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii tetrameric selecase 0.7744 2 71
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7629 4 90
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7546 1 96
ID Description Score Start End Superfamily
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8116 7 96 3.30.2010.10
af_Q9H040_45_153_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7923 12 98 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7629 4 90 3.30.2010.10
af_Q2FWJ6_6_112_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7619 8 100 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.731 5 96 3.30.2010.10
ID Description Score Start End GO Terms
AF-U2T4A1-F1-model_v4 SprT-like domain-containing protein 1.008 1 87 GO:0033554
AF-U2T4A1-F1-model_v4 SprT-like domain-containing protein 0.9851 1 87 GO:0033554
AF-A0A2W0DS13-F1-model_v4 M48 family peptidase 0.9838 1 67 GO:0033554
AF-A0A1G8CW72-F1-model_v4 SprT-like family protein 0.9726 5 91 GO:0033554
AF-A0A850DZ94-F1-model_v4 SprT domain-containing protein 0.9699 1 152 GO:0033554

Feature Viewer

pLDDT pTM Quality
88.58 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map