F436859

General Info

Members Datasets Scaffolds Average Seq Length
408 385 816 341

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221668|2644381516
Length 418
Sequence TAGHPTIKRGNIGVLLVNLGTPDGTDYTSMRRYLKEFLTDRRVIEWSRLVNLGTPDGTDYTSMRRYLKEFLTDRRVIEWSRLFWYPILFGIVLNTRPGKVGKAYETIWNXDLNESYLRTYTRNQSELMAKSFADQPNVIVDWGMRYGQPSIASRMDALQKAGXERILVFPLYPQYAAATTATVNDKAFEALLKMRWQPALRTVPPYHDDPVYIDALATSIERHLATLDWEPEVVLTSFHGIPKSYFDKGDPYYCQCQKTARLLREKLGWSKEKLQVTFQSRFGPEEWLQPYTDKTVEKLAQDGVKRIAVLNPGFVSDCLETLEEIAEQAAESFHHNGGEKFTHIPCLNDSAEGMAVLEHVVRRELAGWLQGTGKNTAKAPQIHSDGGEKFTHIPCLNDSAEGMAVLEHVVRRELAGWL

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
17 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
18 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
19 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
20 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
21 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
22 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
23 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
24 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
35 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
45 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
46 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
51 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
54 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
57 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
58 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
59 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
60 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
61 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
62 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
80 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
83 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
84 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
85 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
86 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
87 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
88 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
89 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
90 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
91 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
93 2643221668 Ensifer sp. Root423 Isolate Unclassified
94 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
95 2509276019 Ensifer aridi TW10 Isolate Nodule
96 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
97 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
98 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
99 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
100 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
101 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
102 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
103 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
104 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
105 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
106 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
107 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
108 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
109 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
110 2516143018 Ensifer sp. BR816 Isolate Nodule
111 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
112 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
113 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
114 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
115 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
116 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
117 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
118 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
119 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
120 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
121 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
122 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
123 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
124 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
125 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
126 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
127 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
128 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
129 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
130 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
131 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
132 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
133 2643221557 Ensifer sp. Root558 Isolate Unclassified
134 2643221607 Rhizobium sp. Root73 Isolate Unclassified
135 2643221626 Ensifer sp. Root31 Isolate Unclassified
136 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
137 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
138 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
139 2643221655 Ensifer sp. Root1252 Isolate Unclassified
140 2643221659 Ensifer sp. Root127 Isolate Unclassified
141 2643221675 Ensifer sp. Root1298 Isolate Unclassified
142 2643221680 Ensifer sp. Root1312 Isolate Unclassified
143 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
144 2643221688 Rhizobium sp. Root482 Isolate Unclassified
145 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
146 2643221698 Ensifer sp. Root142 Isolate Unclassified
147 2643221712 Ensifer sp. Root258 Isolate Unclassified
148 2643221718 Rhizobium sp. Root268 Isolate Unclassified
149 2643221719 Rhizobium sp. Root274 Isolate Unclassified
150 2643221723 Ensifer sp. Root278 Isolate Unclassified
151 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
152 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
153 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
154 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
155 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
156 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
157 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
158 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
159 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
160 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
161 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
162 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
163 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
164 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
165 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
166 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
167 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
168 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
169 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
170 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
171 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
172 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
173 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
174 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
175 2844163670 Ensifer sp. 1H6 Isolate Unclassified
176 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
177 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
178 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
179 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
180 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
181 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
182 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
183 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
184 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
185 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
186 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
187 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
188 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
189 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
190 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
191 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
192 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
193 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
194 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
195 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
196 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
197 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
198 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
199 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
200 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
201 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
202 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
203 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
204 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
205 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
206 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
207 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
208 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
209 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
210 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
211 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
212 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
213 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
214 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
215 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
216 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
217 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
218 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
219 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
220 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
221 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
222 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
223 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
224 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
225 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
226 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
227 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
228 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
229 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
230 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
231 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
232 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
233 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
234 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
235 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
236 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
237 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
238 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
239 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
240 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
241 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
242 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
243 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
244 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
245 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
246 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
247 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
248 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
249 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
250 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
251 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
252 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
253 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
254 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
255 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
256 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
257 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
258 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
259 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
260 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
261 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
262 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
263 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
264 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
265 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
266 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
267 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
268 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
269 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
270 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
271 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
272 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
273 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
274 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
275 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
276 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
277 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
278 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
279 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
280 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
281 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
282 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
283 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
284 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
285 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
286 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
287 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
288 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
289 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
290 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
291 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
292 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
293 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
294 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
295 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
296 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
297 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
298 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
299 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
300 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
301 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
302 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
303 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
304 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
305 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
306 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
307 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
308 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
309 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
310 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
311 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
312 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
313 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
314 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
315 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
316 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
317 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
318 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
319 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
320 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
321 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
322 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
323 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
324 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
325 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
326 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
327 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
328 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
329 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
330 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
331 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
332 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
333 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
334 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
335 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
336 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
337 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
338 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
339 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
340 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
341 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
342 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
343 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
344 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
345 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
346 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
347 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
348 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
349 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
350 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
351 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
352 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
353 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
354 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
355 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
356 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
357 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
358 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
359 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
360 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
361 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
362 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
363 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
364 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
365 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
366 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
367 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
368 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
369 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
370 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
371 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
372 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
373 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
374 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
375 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
376 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
377 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
378 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
379 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
380 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
381 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
382 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
383 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
384 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
385 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 27.94
Metatranscriptomes 0
Isolates 72.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.54
Nodule 59.07
Rhizoplane 1.23
Rhizosphere 13.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000018 3300002987 Bacteria 132603
2 JGI25160J50197_1000009 3300003354 Bacteria 282862
3 JGI25161J50226_1000913 3300003374 Bacteria 10639
4 Ga0055526_1001582 3300003771 Bacteria 16008
5 Ga0055536_1000582 3300003781 Bacteria 24895
6 Ga0055536_1012132 3300003781 Bacteria 3227
7 Ga0055530_10010792 3300003791 Bacteria 3338
8 Ga0055540_1013385 3300003792 Bacteria 2509
9 Ga0055531_10007080 3300003794 Bacteria 6201
10 Ga0055543_1001274 3300004625 Bacteria 10384
11 Ga0065165_1000020 3300005262 Bacteria 265570
12 Ga0075364_10000009 3300006051 Bacteria 64760
13 Ga0075362_10058011 3300006177 Bacteria 1745
14 Ga0075367_10022978 3300006178 Bacteria 3503
15 Ga0079104_1000042 3300006946 Bacteria 185991
16 Ga0157370_10472194 3300013104 Bacteria 1153
17 Ga0171463_1006 3300013249 Bacteria 336402
18 Ga0183363_1018 3300015690 Bacteria 62625
19 Ga0214544_1001241 3300021320 Bacteria 52071
20 Ga0214542_1000115 3300021321 Bacteria 109873
21 Ga0214542_1015285 3300021321 Bacteria 8089
22 Ga0214543_1000008 3300021327 Bacteria 385680
23 Ga0214543_1000098 3300021327 Bacteria 109894
24 Ga0228710_1000003 3300022740 Bacteria 262981
25 Ga0209646_1012341 3300025246 Bacteria 1313
26 Ga0209026_1000029 3300025250 Bacteria 337109
27 Ga0209759_1000040 3300025256 Bacteria 254501
28 Ga0209130_1000037 3300025284 Bacteria 284019
29 Ga0209130_1023465 3300025284 Bacteria 1359
30 Ga0209676_1002645 3300025292 Bacteria 12194
31 Ga0209025_1000052 3300025294 Bacteria 324648
32 Ga0209025_1000196 3300025294 Bacteria 147356
33 Ga0209564_1000086 3300025295 Bacteria 251385
34 Ga0209564_1030556 3300025295 Bacteria 1666
35 Ga0209050_1005669 3300025298 Bacteria 7727
36 Ga0209256_1002576 3300025299 Bacteria 14467
37 Ga0207426_1000048 3300025302 Bacteria 409127
38 Ga0209051_1017394 3300025303 Bacteria 3214
39 Ga0209257_1010099 3300025304 Bacteria 4872
40 Ga0209281_1000068 3300027111 Bacteria 280238
41 Ga0209281_1000081 3300027111 Bacteria 258084
42 Ga0209282_1000040 3300027666 Bacteria 127969
43 Ga0209813_10019185 3300027866 Bacteria 1898
44 Ga0268266_10008352 3300028379 Bacteria 9216
45 Ga0307515_10000263 3300028794 Bacteria 130303
46 Ga0307515_10000386 3300028794 Bacteria 107196
47 Ga0307515_10294137 3300028794 Bacteria 1316
48 Ga0307513_10016901 3300031456 Bacteria 8772
49 Ga0307408_100032663 3300031548 Bacteria 3630
50 Ga0307405_10303812 3300031731 Bacteria 1212
51 Ga0315914_1000002 3300031967 Bacteria 365357
52 Ga0307409_100023922 3300031995 Bacteria 4246
53 Ga0315913_1000016 3300033430 Bacteria 113410
54 Ga0315915_1000005 3300033464 Bacteria 397591
55 Ga0373927_0000095 3300035695 Bacteria 66646
56 Ga0316582_0153445 3300036647 Bacteria 1558
57 Ga0395905_0167059 3300037471 Bacteria 2068
58 Ga0439449_0048777 3300042007 Bacteria 1567
59 Ga0439462_0035011 3300042015 Bacteria 1334
60 Ga0450918_003488 3300042531 Bacteria 2917
61 Ga0495592_0142290 3300046454 Bacteria 1667
62 Ga0495638_0044108 3300046460 Bacteria 2811
63 Ga0495654_0000997 3300046530 Bacteria 20843
64 Ga0496111_0010102 3300048914 Bacteria 6319
65 Ga0496117_0000814 3300048920 Bacteria 48319
66 Ga0496122_0000024 3300048925 Bacteria 372400
67 Ga0496122_0022627 3300048925 Bacteria 5579
68 Ga0496123_0000086 3300048926 Bacteria 183266
69 Ga0496123_0055697 3300048926 Bacteria 2591
70 Ga0496124_0003016 3300048927 Bacteria 21049
71 Ga0496124_0308922 3300048927 Bacteria 1138
72 Ga0496125_0000651 3300048928 Bacteria 58001
73 Ga0496125_0140469 3300048928 Bacteria 1680
74 Ga0496126_0003130 3300048929 Bacteria 21339
75 Ga0501031_0047080 3300049568 Bacteria 2811
76 Ga0501032_0001473 3300049569 Bacteria 18750
77 Ga0501033_0001192 3300049570 Bacteria 23475
78 Ga0501033_0007577 3300049570 Bacteria 8445
79 Ga0501034_0257949 3300049571 Bacteria 1687
80 Ga0501037_0000264 3300049573 Bacteria 45296
81 Ga0501038_0039973 3300049574 Bacteria 4100
82 Ga0501043_0000620 3300049579 Bacteria 31329
83 Ga0501047_0004890 3300049581 Bacteria 12588
84 Ga0501047_0008283 3300049581 Bacteria 9815
85 Ga0501068_0002960 3300049584 Bacteria 9050
86 Ga0501069_0000007 3300049585 Bacteria 182820
87 Ga0501070_0000229 3300049586 Bacteria 52795
88 Ga0501070_0001901 3300049586 Bacteria 18471
89 Ga0501071_0013676 3300049587 Bacteria 5535
90 Ga0501074_0000254 3300049590 Bacteria 30127
91 Ga0501080_0000550 3300049742 Bacteria 29619
92 Ga0501080_0000724 3300049742 Bacteria 26629
93 Ga0501083_0000125 3300049744 Bacteria 52499
94 Ga0501035_0000274 3300049822 Bacteria 61155
95 Ga0501035_0004006 3300049822 Bacteria 14052
96 Ga0501044_0000009 3300049823 Bacteria 270072
97 Ga0501044_0008662 3300049823 Bacteria 11141
98 nmdc:mga00v17_715_c1 3300050491 Bacteria 18144
99 nmdc:mga0yw44_9582_c1 3300050492 Bacteria 4908
100 nmdc:mga07m45_160377_c1 3300050496 Bacteria 1305
101 nmdc:mga07m45_77918_c1 3300050496 Bacteria 1891
102 Ga0500644_0002570 3300053088 Bacteria 4531
103 Ga0500654_068186 3300053099 Bacteria 1757
104 Ga0500618_000783 3300053125 Bacteria 17848
105 Ga0500618_003414 3300053125 Bacteria 5463
106 Ga0500559_0010049 3300053136 Bacteria 4075
107 Ga0500568_0043069 3300053139 Bacteria 1806
108 Ga0500573_0003963 3300053140 Bacteria 7732
109 Ga0500573_0031428 3300053140 Bacteria 3064
110 Ga0500590_001993 3300053148 Bacteria 8794
111 Ga0500622_0001325 3300053156 Bacteria 20123
112 Ga0500627_0093691 3300053158 Bacteria 1345
113 Ga0500636_0000005 3300053177 Bacteria 197561
114 Ga0501082_0073212 3300060353 Bacteria 2951
115 2644381516 2643221668 Bacteria 7306521
116 2509109799 2508501122 Bacteria 6292184
117 2509379049 2509276019 Bacteria 6802256
118 2510303640 2510065057 Bacteria 6649661
119 2510839378 2510461069 Bacteria 5505000
120 2511502947 2511231052 Bacteria 6974333
121 2512534190 2512047086 Bacteria 6850303
122 2512973974 2512875026 Bacteria 6861065
123 2513585274 2513237086 Bacteria 7265287
124 2513602308 2513237089 Bacteria 6553624
125 2513620110 2513237091 Bacteria 6900273
126 2513885849 2513237140 Bacteria 7076289
127 2513902875 2513237143 Bacteria 6664116
128 2513985971 2513237156 Bacteria 6402557
129 2513998051 2513237159 Bacteria 6810126
130 2514003951 2513237160 Bacteria 6650282
131 2515610392 2515154107 Bacteria 6795637
132 2516205193 2516143018 Bacteria 6951533
133 2516894352 2516653046 Bacteria 6989037
134 2517570963 2517487022 Bacteria 7227575
135 2524451819 2524023207 Bacteria 6813453
136 2551676487 2551306084 Bacteria 8942552
137 2551685989 2551306085 Bacteria 7347181
138 2551691622 2551306086 Bacteria 6843938
139 2551701222 2551306087 Bacteria 7351905
140 2551711840 2551306089 Bacteria 7162724
141 2551724074 2551306090 Bacteria 7953713
142 2551726309 2551306091 Bacteria 7086830
143 2551737956 2551306092 Bacteria 6992595
144 2551740306 2551306093 Bacteria 7064773
145 2558860373 2558860100 Bacteria 8458965
146 2561468145 2558860983 Bacteria 4133860
147 2585167991 2582581283 Bacteria 6030556
148 2585227771 2582581299 Bacteria 6518058
149 2585265407 2582581306 Bacteria 6450535
150 2585388512 2582581865 Bacteria 6644329
151 2585392389 2582581866 Bacteria 6859583
152 2599334778 2599185156 Bacteria 5403036
153 2600194591 2599185352 Bacteria 7228948
154 2600373700 2600254933 Bacteria 4750527
155 2643804132 2643221557 Bacteria 7184309
156 2644051079 2643221607 Bacteria 6314006
157 2644145571 2643221626 Bacteria 8069654
158 2644205559 2643221636 Bacteria 6583769
159 2644209908 2643221637 Bacteria 5345260
160 2644299203 2643221653 Bacteria 4569637
161 2644312352 2643221655 Bacteria 7722067
162 2644335980 2643221659 Bacteria 7890716
163 2644415828 2643221675 Bacteria 7473456
164 2644448868 2643221680 Bacteria 7473610
165 2644483983 2643221686 Bacteria 6310811
166 2644496336 2643221688 Bacteria 5260751
167 2644500237 2643221689 Bacteria 6042950
168 2644546837 2643221698 Bacteria 7756764
169 2644618035 2643221712 Bacteria 7729434
170 2644653459 2643221718 Bacteria 5345506
171 2644657431 2643221719 Bacteria 4568197
172 2644676788 2643221723 Bacteria 7095460
173 2692314548 2690316117 Bacteria 6800650
174 2753458655 2751185821 Bacteria 6189929
175 2757571321 2757320392 Bacteria 3737298
176 2792582587 2791355082 Bacteria 5973319
177 2792622955 2791355091 Bacteria 6135441
178 2792629209 2791355092 Bacteria 6248105
179 2792640439 2791355094 Bacteria 7011481
180 2793281666 2791355253 Bacteria 5171699
181 2802717948 2802428858 Bacteria 6636079
182 2802725201 2802428859 Bacteria 6667919
183 2802730675 2802428860 Bacteria 6525526
184 2802738022 2802428861 Bacteria 6534206
185 2802744108 2802428862 Bacteria 6633353
186 2802750987 2802428863 Bacteria 6410669
187 2819243770 2818991272 Bacteria 4622173
188 2819685623 2818991461 Bacteria 7026071
189 2821126099 2821123053 Bacteria 7836056
190 2837654263 2837651117 Bacteria 3772164
191 2838737426 2838736955 Bacteria 5760694
192 2840769136 2840764183 Bacteria 6358399
193 2841842205 2841840854 Bacteria 5761912
194 2842141984 2842140634 Bacteria 5759631
195 2842523156 2842521101 Bacteria 6569494
196 2842925905 2842922631 Bacteria 5824079
197 2844169204 2844163670 Bacteria 7266046
198 2847420400 2847417321 Bacteria 6913799
199 2848995205 2848992105 Bacteria 6810864
200 2850082271 2850079185 Bacteria 6848280
201 2855826987 2855825444 Bacteria 6785811
202 2855842383 2855839649 Bacteria 7135830
203 2855878474 2855872281 Bacteria 6964271
204 2856323073 2856320880 Bacteria 7263508
205 2857532660 2857531043 Bacteria 6754041
206 2858803199 2858800743 Bacteria 6603254
207 2869163836 2869162929 Bacteria 6399702
208 2874142280 2874139085 Bacteria 7021506
209 2876385063 2876377896 Bacteria 6565995
210 2889796285 2889790730 Bacteria 5689708
211 2889919090 2889914905 Bacteria 5702301
212 2891377553 2891373044 Bacteria 5202277
213 2899806467 2899803654 Bacteria 5577784
214 2913299804 2913295892 Bacteria 6333755
215 2915980508 2915980308 Bacteria 6624279
216 2915987418 2915986958 Bacteria 6739310
217 2915996696 2915993759 Bacteria 7016183
218 2916005106 2916000859 Bacteria 6865702
219 2916014089 2916007675 Bacteria 6898660
220 2916016962 2916014648 Bacteria 6946486
221 2916026424 2916021584 Bacteria 6854472
222 2916029266 2916028427 Bacteria 6748433
223 2916038358 2916035215 Bacteria 6755766
224 2916044884 2916041962 Bacteria 6820487
225 2916049238 2916048683 Bacteria 6543552
226 2916058203 2916055098 Bacteria 6758838
227 2916067086 2916061851 Bacteria 6737736
228 2916072375 2916068649 Bacteria 6943657
229 2916080371 2916076590 Bacteria 6596108
230 2917556465 2917554339 Bacteria 4987857
231 2920828531 2920822456 Bacteria 6897201
232 2921202254 2921201388 Bacteria 6926299
233 2921213330 2921208531 Bacteria 6745326
234 2921242331 2921237296 Bacteria 6876710
235 2921247755 2921244191 Bacteria 6568419
236 2921255342 2921250672 Bacteria 6677771
237 2921260135 2921257292 Bacteria 6808382
238 2921266130 2921263974 Bacteria 6864552
239 2921288340 2921282425 Bacteria 6826397
240 2921294718 2921289301 Bacteria 7316391
241 2921298718 2921296804 Bacteria 7176999
242 2924148254 2924144063 Bacteria 6883928
243 2924152907 2924150972 Bacteria 7169444
244 2924164030 2924158325 Bacteria 7188855
245 2924168668 2924165586 Bacteria 7260590
246 2924175360 2924172951 Bacteria 6749356
247 2924183818 2924179722 Bacteria 6843264
248 2924189981 2924186466 Bacteria 6876637
249 2924193730 2924193448 Bacteria 6955718
250 2924202678 2924200457 Bacteria 6757188
251 2924213448 2924207177 Bacteria 6917007
252 2924220317 2924214083 Bacteria 7080103
253 2924221811 2924221636 Bacteria 7113495
254 2924232443 2924228884 Bacteria 6633132
255 2924718783 2924718760 Bacteria 6331356
256 2929141337 2929138655 Bacteria 5810547
257 2937007033 2937002841 Bacteria 6934057
258 2937015502 2937009748 Bacteria 6746052
259 2937018222 2937016420 Bacteria 6782579
260 2937026751 2937023124 Bacteria 6815156
261 2937033050 2937029754 Bacteria 6424026
262 2937042168 2937036028 Bacteria 6846469
263 2937047858 2937042894 Bacteria 6741576
264 2937052389 2937049772 Bacteria 6757901
265 2937062191 2937056579 Bacteria 7107896
266 2937069415 2937063883 Bacteria 7199456
267 2937078282 2937071275 Bacteria 6984483
268 2937078575 2937078374 Bacteria 6610289
269 2937087252 2937084907 Bacteria 6618516
270 2937093441 2937091812 Bacteria 6979387
271 2937102267 2937098957 Bacteria 7249374
272 2937111365 2937106411 Bacteria 6947143
273 2937114886 2937113482 Bacteria 6505872
274 2937123652 2937119839 Bacteria 6597547
275 2937129370 2937126314 Bacteria 6771275
276 2937881209 2937877337 Bacteria 7246526
277 2937977299 2937972304 Bacteria 7532020
278 2941501738 2941499720 Bacteria 7599444
279 2957377494 2957375807 Bacteria 6425588
280 2957386131 2957382221 Bacteria 6737050
281 2957392110 2957388812 Bacteria 6778072
282 2957398456 2957395598 Bacteria 6822399
283 2957406312 2957402308 Bacteria 6741770
284 2957409065 2957408893 Bacteria 6558585
285 2957419931 2957415311 Bacteria 6991633
286 2957429401 2957422303 Bacteria 7172205
287 2957435003 2957430029 Bacteria 7022557
288 2957437333 2957437181 Bacteria 6568994
289 2957449501 2957443900 Bacteria 6869977
290 2957456284 2957450854 Bacteria 6765715
291 2957459057 2957457609 Bacteria 6967680
292 2957468358 2957464669 Bacteria 6568877
293 2957475158 2957471148 Bacteria 6797643
294 2957481148 2957478035 Bacteria 6756658
295 2957487563 2957484790 Bacteria 6703082
296 2957495320 2957491536 Bacteria 6695180
297 2957503541 2957498199 Bacteria 7126688
298 2957508700 2957505466 Bacteria 7253085
299 2958088234 2958084443 Bacteria 7312792
300 2960587656 2960584000 Bacteria 6864594
301 2960591223 2960591022 Bacteria 6622873
302 2960601295 2960597568 Bacteria 6550735
303 2960608315 2960603979 Bacteria 6898737
304 2960616645 2960610863 Bacteria 6691244
305 2960623500 2960617483 Bacteria 6727748
306 2960635076 2960631154 Bacteria 6732508
307 2960639108 2960637947 Bacteria 7296468
308 2960650109 2960645483 Bacteria 7211087
309 2960656711 2960652885 Bacteria 7083688
310 2960665322 2960660292 Bacteria 7041660
311 2960671544 2960667422 Bacteria 6763020
312 2960678308 2960674078 Bacteria 6609048
313 2960681304 2960680706 Bacteria 6624464
314 2960692403 2960687367 Bacteria 6535474
315 2960696410 2960693952 Bacteria 6749742
316 2964612963 2964607997 Bacteria 7101408
317 2964620449 2964615318 Bacteria 6809089
318 2964628501 2964621998 Bacteria 6834995
319 2964633547 2964628898 Bacteria 7083044
320 2964641269 2964636051 Bacteria 7091832
321 2964647289 2964643177 Bacteria 6820887
322 2964652313 2964649959 Bacteria 6675118
323 2964657752 2964656573 Bacteria 7100150
324 2964670059 2964663802 Bacteria 7019362
325 2964675513 2964670856 Bacteria 6851364
326 2964681839 2964678106 Bacteria 6792020
327 2964688184 2964685014 Bacteria 6839111
328 2964697656 2964691889 Bacteria 6802758
329 2964703006 2964698721 Bacteria 6765331
330 2964712106 2964705432 Bacteria 7114648
331 2964717488 2964712639 Bacteria 6695970
332 2964720493 2964719344 Bacteria 7286602
333 2967665316 2967664464 Bacteria 6948836
334 2967674402 2967671571 Bacteria 7021409
335 2967684095 2967678726 Bacteria 7264382
336 2967689364 2967686174 Bacteria 6678622
337 2967696207 2967693043 Bacteria 6804451
338 2967700953 2967699805 Bacteria 6854538
339 2967710057 2967706974 Bacteria 7186053
340 2967720031 2967714385 Bacteria 7000047
341 2967724845 2967721400 Bacteria 7073753
342 2967732542 2967728569 Bacteria 6641507
343 2967735339 2967735183 Bacteria 6827012
344 2967746197 2967742019 Bacteria 6794534
345 2967752394 2967748971 Bacteria 6733771
346 2967758886 2967755722 Bacteria 6814706
347 2967768521 2967762386 Bacteria 6923502
348 2967772793 2967769361 Bacteria 6587838
349 2967776405 2967775926 Bacteria 6738189
350 2968020734 2968016561 Bacteria 7022047
351 2968119281 2968117919 Bacteria 6536078
352 2970022226 2970019648 Bacteria 7072033
353 2970028249 2970026789 Bacteria 6785236
354 2970039587 2970033650 Bacteria 7118744
355 2970043453 2970040964 Bacteria 6731123
356 2970050589 2970047711 Bacteria 7088379
357 2970058427 2970054988 Bacteria 6611507
358 2970066858 2970061556 Bacteria 7099761
359 2970073982 2970068827 Bacteria 7123112
360 2970079165 2970076120 Bacteria 6697332
361 2970083472 2970082768 Bacteria 6183754
362 2970090082 2970088815 Bacteria 6933825
363 2970100401 2970095765 Bacteria 6936963
364 2970108912 2970102677 Bacteria 6812532
365 2970112741 2970109326 Bacteria 6863976
366 2970121300 2970116247 Bacteria 6501857
367 2970126519 2970122695 Bacteria 6625855
368 2970134382 2970129317 Bacteria 6806560
369 2970141263 2970136068 Bacteria 7207982
370 2970146577 2970143518 Bacteria 6446480
371 2970152764 2970149975 Bacteria 6779706
372 2970163618 2970156795 Bacteria 7168044
373 2970166771 2970164137 Bacteria 6861252
374 2970173430 2970170962 Bacteria 6876229
375 2970187708 2970184632 Bacteria 7054431
376 2970195111 2970191845 Bacteria 7032787
377 2970474031 2970469710 Bacteria 6969209
378 2977523698 2977516862 Bacteria 6940108
379 2977528071 2977523885 Bacteria 6960446
380 2977534300 2977530762 Bacteria 6951399
381 2977541052 2977537788 Bacteria 6929320
382 2977548036 2977544691 Bacteria 6875412
383 2977556932 2977551784 Bacteria 7125765
384 2977563992 2977558990 Bacteria 6863948
385 2977567210 2977565890 Bacteria 6901543
386 2977576070 2977572785 Bacteria 6763888
387 2977579795 2977579622 Bacteria 6772100
388 2989351181 2989349275 Bacteria 6349068
389 2989354687 2989349275 Bacteria 6349068
390 2989773481 2989771324 Bacteria 5605128
391 2989779770 2989776772 Bacteria 4843317
392 2996352649 2996348954 Bacteria 7239054
393 3000139598 3000135777 Bacteria 6891109
394 3002145134 3002141150 Bacteria 5254435
395 3003934887 3003930520 Bacteria 5667563
396 3004279331 3004275668 Bacteria 7114440
397 643827042 643692032 Bacteria 6891900
398 648735887 648276728 Bacteria 6968865
399 8003994923 8003992118 Bacteria 7266902
400 8004002677 8003999396 Bacteria 7063185
401 8005249610 8005246636 Bacteria 4933972
402 8005662493 8005658619 Bacteria 4500593
403 8024489307 8024486573 Bacteria 6540512
404 8049295899 8049293176 Bacteria 6128433
405 8054463431 8054460903 Bacteria 4872905
406 8054558560 8054558443 Bacteria 5204801
407 8055432075 8055431914 Bacteria 4551896
408 8056876125 8056875544 Bacteria 4355797
409 JGI25159J45721_1000018
410 JGI25160J50197_1000009
411 JGI25161J50226_1000913
412 Ga0055526_1001582
413 Ga0055536_1000582
414 Ga0055536_1012132
415 Ga0055530_10010792
416 Ga0055540_1013385
417 Ga0055531_10007080
418 Ga0055543_1001274
419 Ga0065165_1000020
420 Ga0075364_10000009
421 Ga0075362_10058011
422 Ga0075367_10022978
423 Ga0079104_1000042
424 Ga0157370_10472194
425 Ga0171463_1006
426 Ga0183363_1018
427 Ga0214544_1001241
428 Ga0214542_1000115
429 Ga0214542_1015285
430 Ga0214543_1000008
431 Ga0214543_1000098
432 Ga0228710_1000003
433 Ga0209646_1012341
434 Ga0209026_1000029
435 Ga0209759_1000040
436 Ga0209130_1000037
437 Ga0209130_1023465
438 Ga0209676_1002645
439 Ga0209025_1000052
440 Ga0209025_1000196
441 Ga0209564_1000086
442 Ga0209564_1030556
443 Ga0209050_1005669
444 Ga0209256_1002576
445 Ga0207426_1000048
446 Ga0209051_1017394
447 Ga0209257_1010099
448 Ga0209281_1000068
449 Ga0209281_1000081
450 Ga0209282_1000040
451 Ga0209813_10019185
452 Ga0268266_10008352
453 Ga0307515_10000263
454 Ga0307515_10000386
455 Ga0307515_10294137
456 Ga0307513_10016901
457 Ga0307408_100032663
458 Ga0307405_10303812
459 Ga0315914_1000002
460 Ga0307409_100023922
461 Ga0315913_1000016
462 Ga0315915_1000005
463 Ga0373927_0000095
464 Ga0316582_0153445
465 Ga0395905_0167059
466 Ga0439449_0048777
467 Ga0439462_0035011
468 Ga0450918_003488
469 Ga0495592_0142290
470 Ga0495638_0044108
471 Ga0495654_0000997
472 Ga0496111_0010102
473 Ga0496117_0000814
474 Ga0496122_0000024
475 Ga0496122_0022627
476 Ga0496123_0000086
477 Ga0496123_0055697
478 Ga0496124_0003016
479 Ga0496124_0308922
480 Ga0496125_0000651
481 Ga0496125_0140469
482 Ga0496126_0003130
483 Ga0501031_0047080
484 Ga0501032_0001473
485 Ga0501033_0001192
486 Ga0501033_0007577
487 Ga0501034_0257949
488 Ga0501037_0000264
489 Ga0501038_0039973
490 Ga0501043_0000620
491 Ga0501047_0004890
492 Ga0501047_0008283
493 Ga0501068_0002960
494 Ga0501069_0000007
495 Ga0501070_0000229
496 Ga0501070_0001901
497 Ga0501071_0013676
498 Ga0501074_0000254
499 Ga0501080_0000550
500 Ga0501080_0000724
501 Ga0501083_0000125
502 Ga0501035_0000274
503 Ga0501035_0004006
504 Ga0501044_0000009
505 Ga0501044_0008662
506 nmdc:mga00v17_715_c1
507 nmdc:mga0yw44_9582_c1
508 nmdc:mga07m45_160377_c1
509 nmdc:mga07m45_77918_c1
510 Ga0500644_0002570
511 Ga0500654_068186
512 Ga0500618_000783
513 Ga0500618_003414
514 Ga0500559_0010049
515 Ga0500568_0043069
516 Ga0500573_0003963
517 Ga0500573_0031428
518 Ga0500590_001993
519 Ga0500622_0001325
520 Ga0500627_0093691
521 Ga0500636_0000005
522 Ga0501082_0073212
523 2644381516
524 2509109799
525 2509379049
526 2510303640
527 2510839378
528 2511502947
529 2512534190
530 2512973974
531 2513585274
532 2513602308
533 2513620110
534 2513885849
535 2513902875
536 2513985971
537 2513998051
538 2514003951
539 2515610392
540 2516205193
541 2516894352
542 2517570963
543 2524451819
544 2551676487
545 2551685989
546 2551691622
547 2551701222
548 2551711840
549 2551724074
550 2551726309
551 2551737956
552 2551740306
553 2558860373
554 2561468145
555 2585167991
556 2585227771
557 2585265407
558 2585388512
559 2585392389
560 2599334778
561 2600194591
562 2600373700
563 2643804132
564 2644051079
565 2644145571
566 2644205559
567 2644209908
568 2644299203
569 2644312352
570 2644335980
571 2644415828
572 2644448868
573 2644483983
574 2644496336
575 2644500237
576 2644546837
577 2644618035
578 2644653459
579 2644657431
580 2644676788
581 2692314548
582 2753458655
583 2757571321
584 2792582587
585 2792622955
586 2792629209
587 2792640439
588 2793281666
589 2802717948
590 2802725201
591 2802730675
592 2802738022
593 2802744108
594 2802750987
595 2819243770
596 2819685623
597 2821126099
598 2837654263
599 2838737426
600 2840769136
601 2841842205
602 2842141984
603 2842523156
604 2842925905
605 2844169204
606 2847420400
607 2848995205
608 2850082271
609 2855826987
610 2855842383
611 2855878474
612 2856323073
613 2857532660
614 2858803199
615 2869163836
616 2874142280
617 2876385063
618 2889796285
619 2889919090
620 2891377553
621 2899806467
622 2913299804
623 2915980508
624 2915987418
625 2915996696
626 2916005106
627 2916014089
628 2916016962
629 2916026424
630 2916029266
631 2916038358
632 2916044884
633 2916049238
634 2916058203
635 2916067086
636 2916072375
637 2916080371
638 2917556465
639 2920828531
640 2921202254
641 2921213330
642 2921242331
643 2921247755
644 2921255342
645 2921260135
646 2921266130
647 2921288340
648 2921294718
649 2921298718
650 2924148254
651 2924152907
652 2924164030
653 2924168668
654 2924175360
655 2924183818
656 2924189981
657 2924193730
658 2924202678
659 2924213448
660 2924220317
661 2924221811
662 2924232443
663 2924718783
664 2929141337
665 2937007033
666 2937015502
667 2937018222
668 2937026751
669 2937033050
670 2937042168
671 2937047858
672 2937052389
673 2937062191
674 2937069415
675 2937078282
676 2937078575
677 2937087252
678 2937093441
679 2937102267
680 2937111365
681 2937114886
682 2937123652
683 2937129370
684 2937881209
685 2937977299
686 2941501738
687 2957377494
688 2957386131
689 2957392110
690 2957398456
691 2957406312
692 2957409065
693 2957419931
694 2957429401
695 2957435003
696 2957437333
697 2957449501
698 2957456284
699 2957459057
700 2957468358
701 2957475158
702 2957481148
703 2957487563
704 2957495320
705 2957503541
706 2957508700
707 2958088234
708 2960587656
709 2960591223
710 2960601295
711 2960608315
712 2960616645
713 2960623500
714 2960635076
715 2960639108
716 2960650109
717 2960656711
718 2960665322
719 2960671544
720 2960678308
721 2960681304
722 2960692403
723 2960696410
724 2964612963
725 2964620449
726 2964628501
727 2964633547
728 2964641269
729 2964647289
730 2964652313
731 2964657752
732 2964670059
733 2964675513
734 2964681839
735 2964688184
736 2964697656
737 2964703006
738 2964712106
739 2964717488
740 2964720493
741 2967665316
742 2967674402
743 2967684095
744 2967689364
745 2967696207
746 2967700953
747 2967710057
748 2967720031
749 2967724845
750 2967732542
751 2967735339
752 2967746197
753 2967752394
754 2967758886
755 2967768521
756 2967772793
757 2967776405
758 2968020734
759 2968119281
760 2970022226
761 2970028249
762 2970039587
763 2970043453
764 2970050589
765 2970058427
766 2970066858
767 2970073982
768 2970079165
769 2970083472
770 2970090082
771 2970100401
772 2970108912
773 2970112741
774 2970121300
775 2970126519
776 2970134382
777 2970141263
778 2970146577
779 2970152764
780 2970163618
781 2970166771
782 2970173430
783 2970187708
784 2970195111
785 2970474031
786 2977523698
787 2977528071
788 2977534300
789 2977541052
790 2977548036
791 2977556932
792 2977563992
793 2977567210
794 2977576070
795 2977579795
796 2989351181
797 2989354687
798 2989773481
799 2989779770
800 2996352649
801 3000139598
802 3002145134
803 3003934887
804 3004279331
805 643827042
806 648735887
807 8003994923
808 8004002677
809 8005249610
810 8005662493
811 8024489307
812 8049295899
813 8054463431
814 8054558560
815 8055432075
816 8056876125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

48

365

0.98

PF00762

Ferrochelatase

Ferrochelatase

11

49

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.8888 19 343
3aqi-assembly1.cif.gz_B h240a variant of human ferrochelatase 0.8764 19 343
2pnj-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.8752 19 343
2po7-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 341 replaced by cys 0.8732 19 343
4f4d-assembly1.cif.gz_B f337r variant of human ferrochelatase 0.8732 19 345
ID Description Score Start End Superfamily
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9683 22 270 3.40.605.10
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9665 22 179 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9568 22 270 3.40.605.10
af_Q8ID58_27_285_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9531 22 279 3.40.50.1400
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9425 22 179 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A529N520-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.9962 27 167 GO:0004325
GO:0006783
AF-A0A529FBU1-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.9903 16 139 GO:0004325
GO:0006783
AF-A0A5R2N677-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9858 46 250 GO:0004325
GO:0005737
GO:0006783
AF-A0A434LJU7-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9829 40 289 GO:0004325
GO:0005737
GO:0006783
AF-A0A1U9M9W6-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.981 19 345 GO:0004325
GO:0005737
GO:0006783
GO:0046872

Map