F436835

General Info

Members Datasets Scaffolds Average Seq Length
408 297 816 149

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0771393|Ga0501075_0771393_186_698
Length 170
Sequence MSSVYWARLPGTPSSHRLETTVITPAHAGRALFVNIPVADVGRSKAFFERLGFSFNPMFTDETAACMLIGEQAFVMLLSRERFAEFAKLPVADPTTHTLALYCFSVPSRDEVDAVSAAALAAGGHEADGAEDHGFMYSRSFFDLDGHGWQVMWMDPAAAEQGPETAVRAT

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
69 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
70 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
71 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
72 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
73 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
258 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
280 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
283 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
284 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
288 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
289 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
290 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
293 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
294 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
295 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
296 8002784119 Frankia sp. AgB1.9 Isolate Nodule
297 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.74
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.41
Nodule 0.49
Rhizoplane 7.35
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0771393 3300049591 Bacteria 732
2 Ga0070683_100601215 3300005329 Bacteria 1052
3 Ga0070683_100698328 3300005329 Bacteria 972
4 Ga0070683_101297949 3300005329 Bacteria 700
5 Ga0070670_100140534 3300005331 Bacteria 2088
6 Ga0070677_10387056 3300005333 Bacteria 734
7 Ga0070682_100510050 3300005337 Bacteria 933
8 Ga0068868_100093205 3300005338 Bacteria 2428
9 Ga0070660_100661502 3300005339 Bacteria 875
10 Ga0070660_100772119 3300005339 Bacteria 807
11 Ga0070689_100119763 3300005340 Bacteria 2101
12 Ga0070689_100205867 3300005340 Bacteria 1608
13 Ga0070687_100065328 3300005343 Bacteria 1935
14 Ga0070668_100465248 3300005347 Bacteria 1089
15 Ga0070674_100413881 3300005356 Bacteria 1104
16 Ga0070659_100478267 3300005366 Bacteria 1059
17 Ga0070659_101035193 3300005366 Bacteria 722
18 Ga0070709_10018021 3300005434 Bacteria 4059
19 Ga0070714_100052192 3300005435 Bacteria 3487
20 Ga0070713_100515533 3300005436 Bacteria 1129
21 Ga0070713_100742551 3300005436 Bacteria 939
22 Ga0070701_10390165 3300005438 Bacteria 880
23 Ga0070700_100098370 3300005441 Bacteria 1923
24 Ga0070700_100173289 3300005441 Bacteria 1496
25 Ga0070663_100783148 3300005455 Bacteria 817
26 Ga0070685_11127039 3300005466 Bacteria 594
27 Ga0070706_101230172 3300005467 Bacteria 688
28 Ga0070707_100704148 3300005468 Bacteria 973
29 Ga0070684_100286964 3300005535 Bacteria 1508
30 Ga0070684_101351986 3300005535 Bacteria 671
31 Ga0068853_101171687 3300005539 Bacteria 742
32 Ga0070686_100428003 3300005544 Bacteria 1013
33 Ga0070704_100369577 3300005549 Bacteria 1215
34 Ga0068855_100905342 3300005563 Bacteria 932
35 Ga0070664_100349549 3300005564 Bacteria 1344
36 Ga0070664_100352752 3300005564 Bacteria 1338
37 Ga0068857_100229501 3300005577 Bacteria 1698
38 Ga0068854_100293143 3300005578 Bacteria 1313
39 Ga0068854_100422508 3300005578 Bacteria 1107
40 Ga0068856_101155471 3300005614 Bacteria 791
41 Ga0070702_100089719 3300005615 Bacteria 1861
42 Ga0068852_100279297 3300005616 Bacteria 1609
43 Ga0068852_100833231 3300005616 Bacteria 937
44 Ga0068864_100116757 3300005618 Bacteria 2381
45 Ga0068866_10036932 3300005718 Bacteria 2396
46 Ga0068861_100068116 3300005719 Bacteria 2749
47 Ga0068851_10137578 3300005834 Bacteria 1326
48 Ga0068870_10113010 3300005840 Bacteria 1554
49 Ga0068858_101204099 3300005842 Bacteria 745
50 Ga0068860_100399512 3300005843 Bacteria 1359
51 Ga0068862_101215539 3300005844 Bacteria 752
52 Ga0081455_10018673 3300005937 Bacteria 6588
53 Ga0081539_10016421 3300005985 Bacteria 5289
54 Ga0070717_10079401 3300006028 Bacteria 2751
55 Ga0070717_10347405 3300006028 Bacteria 1326
56 Ga0070717_10930543 3300006028 Bacteria 791
57 Ga0075365_10005275 3300006038 Bacteria 6954
58 Ga0075364_10720092 3300006051 Bacteria 681
59 Ga0070715_10438654 3300006163 Bacteria 735
60 Ga0070712_100790648 3300006175 Bacteria 814
61 Ga0070712_101230464 3300006175 Bacteria 652
62 Ga0075369_10103594 3300006186 Bacteria 1278
63 Ga0097621_100188795 3300006237 Bacteria 1784
64 Ga0075431_100765266 3300006847 Bacteria 940
65 Ga0075433_10082725 3300006852 Bacteria 2831
66 Ga0075434_101069093 3300006871 Bacteria 820
67 Ga0075429_100752655 3300006880 Bacteria 853
68 Ga0068865_100774968 3300006881 Bacteria 825
69 Ga0075435_101362612 3300007076 Bacteria 622
70 Ga0099794_10122928 3300007265 Bacteria 1307
71 Ga0105251_10040641 3300009011 Bacteria 2267
72 Ga0105240_12039915 3300009093 Bacteria 596
73 Ga0111539_10007382 3300009094 Bacteria 14081
74 Ga0111539_10350596 3300009094 Bacteria 1718
75 Ga0111539_11277197 3300009094 Bacteria 852
76 Ga0105247_10168812 3300009101 Bacteria 1453
77 Ga0105243_10160662 3300009148 Bacteria 1937
78 Ga0105241_10610138 3300009174 Bacteria 987
79 Ga0105241_10769931 3300009174 Bacteria 884
80 Ga0105242_12144497 3300009176 Bacteria 603
81 Ga0105248_10889165 3300009177 Bacteria 1006
82 Ga0105249_11176410 3300009553 Bacteria 838
83 Ga0105249_12769634 3300009553 Bacteria 562
84 Ga0099796_10234782 3300010159 Bacteria 756
85 Ga0105246_10059421 3300011119 Bacteria 2652
86 Ga0105246_10376655 3300011119 Bacteria 1171
87 Ga0105246_11777275 3300011119 Bacteria 588
88 Ga0157320_1016543 3300012481 Bacteria 634
89 Ga0157325_1002275 3300012485 Bacteria 967
90 Ga0157347_1058692 3300012502 Bacteria 546
91 Ga0157315_1003571 3300012508 Bacteria 1057
92 Ga0157327_1024807 3300012512 Bacteria 706
93 Ga0157326_1074161 3300012513 Bacteria 545
94 Ga0157371_10779641 3300013102 Bacteria 719
95 Ga0157371_10868497 3300013102 Bacteria 683
96 Ga0157369_11886881 3300013105 Bacteria 606
97 Ga0157374_12455333 3300013296 Bacteria 549
98 Ga0157378_11152468 3300013297 Bacteria 814
99 Ga0163162_12970761 3300013306 Bacteria 545
100 Ga0157372_10320152 3300013307 Bacteria 1806
101 Ga0157372_10342522 3300013307 Bacteria 1741
102 Ga0157372_10429600 3300013307 Bacteria 1539
103 Ga0157375_10658431 3300013308 Bacteria 1203
104 Ga0163163_11225511 3300014325 Bacteria 813
105 Ga0157380_10184157 3300014326 Bacteria 1838
106 Ga0157380_12306444 3300014326 Bacteria 603
107 Ga0182008_10626608 3300014497 Bacteria 606
108 Ga0157377_10513111 3300014745 Bacteria 840
109 Ga0157379_11308554 3300014968 Bacteria 700
110 Ga0182005_1215480 3300015265 Bacteria 582
111 Ga0206351_10712853 3300020077 Bacteria 582
112 Ga0206354_11360628 3300020081 Bacteria 829
113 Ga0213874_10128653 3300021377 Bacteria 867
114 Ga0207656_10251977 3300025321 Bacteria 865
115 Ga0207682_10285974 3300025893 Bacteria 771
116 Ga0207647_10177131 3300025904 Bacteria 1240
117 Ga0207685_10163977 3300025905 Bacteria 1017
118 Ga0207699_10193281 3300025906 Bacteria 1374
119 Ga0207645_10249270 3300025907 Bacteria 1175
120 Ga0207705_10542669 3300025909 Bacteria 904
121 Ga0207707_11090617 3300025912 Bacteria 651
122 Ga0207695_10793173 3300025913 Bacteria 827
123 Ga0207657_10408885 3300025919 Bacteria 1067
124 Ga0207657_10516378 3300025919 Bacteria 935
125 Ga0207700_10070103 3300025928 Bacteria 2694
126 Ga0207664_10180142 3300025929 Bacteria 1814
127 Ga0207704_10135237 3300025938 Bacteria 1714
128 Ga0207691_10310899 3300025940 Bacteria 1352
129 Ga0207689_10163094 3300025942 Bacteria 1836
130 Ga0207661_10050293 3300025944 Bacteria 3320
131 Ga0207661_11831041 3300025944 Bacteria 552
132 Ga0207679_10083706 3300025945 Bacteria 2446
133 Ga0207667_11288839 3300025949 Bacteria 707
134 Ga0207651_10279199 3300025960 Bacteria 1380
135 Ga0207668_10394181 3300025972 Bacteria 1169
136 Ga0207640_10999603 3300025981 Bacteria 736
137 Ga0207677_10323511 3300026023 Bacteria 1282
138 Ga0207677_10480360 3300026023 Bacteria 1071
139 Ga0207708_10029834 3300026075 Bacteria 4135
140 Ga0207708_10212163 3300026075 Bacteria 1548
141 Ga0209998_10047494 3300027717 Bacteria 987
142 Ga0268265_10093990 3300028380 Bacteria 2404
143 Ga0268264_11045684 3300028381 Bacteria 824
144 Ga0307517_10007410 3300028786 Bacteria 15998
145 Ga0265338_10001947 3300028800 Bacteria 32225
146 Ga0307511_10003179 3300030521 Bacteria 16900
147 Ga0307508_10101272 3300031616 Bacteria 2476
148 Ga0307514_10205506 3300031649 Bacteria 1231
149 Ga0307516_10007643 3300031730 Bacteria 12378
150 Ga0307516_10756833 3300031730 Bacteria 631
151 Ga0307518_10067696 3300031838 Bacteria 2589
152 Ga0307518_10230507 3300031838 Bacteria 1199
153 Ga0307410_10454561 3300031852 Bacteria 1045
154 Ga0307406_10418643 3300031901 Bacteria 1067
155 Ga0307407_11074961 3300031903 Bacteria 624
156 Ga0307409_100186940 3300031995 Bacteria 1840
157 Ga0307416_101288523 3300032002 Bacteria 836
158 Ga0307415_100016397 3300032126 Bacteria 4416
159 Ga0307415_100056739 3300032126 Bacteria 2687
160 Ga0307415_100141165 3300032126 Bacteria 1840
161 Ga0307510_10425077 3300033180 Bacteria 770
162 Ga0373958_0086640 3300034819 Bacteria 717
163 Ga0373938_0071812 3300034957 Bacteria 829
164 Ga0373926_0293972 3300035083 Bacteria 634
165 Ga0373936_0229652 3300035113 Bacteria 825
166 Ga0373945_0050944 3300035116 Bacteria 1522
167 Ga0373953_0242684 3300035117 Bacteria 782
168 Ga0373956_0288660 3300035119 Bacteria 781
169 Ga0373957_0134971 3300035120 Bacteria 1006
170 Ga0373946_0084697 3300035171 Bacteria 1395
171 Ga0373955_0026683 3300035172 Bacteria 2979
172 Ga0373935_0379816 3300035692 Bacteria 1011
173 Ga0373927_0503075 3300035695 Bacteria 801
174 Ga0373933_0152434 3300035724 Bacteria 1464
175 Ga0373947_0184899 3300035725 Bacteria 1358
176 Ga0395900_0490362 3300037418 Bacteria 1180
177 Ga0395898_0146841 3300037466 Bacteria 2257
178 Ga0436364_1314789 3300037853 Bacteria 611
179 Ga0395901_0053735 3300038443 Bacteria 4186
180 Ga0395901_0176453 3300038443 Bacteria 2241
181 Ga0395901_0382507 3300038443 Bacteria 1448
182 Ga0436363_1171979 3300039450 Bacteria 1004
183 Ga0436363_1534419 3300039450 Bacteria 3815
184 Ga0436362_0177107 3300039453 Bacteria 729
185 Ga0439465_0292132 3300041413 Bacteria 609
186 Ga0451791_1204521 3300041451 Bacteria 1249
187 Ga0451793_0897824 3300041452 Bacteria 843
188 Ga0451802_1039055 3300041460 Bacteria 688
189 Ga0451847_0047975 3300041503 Bacteria 616
190 Ga0451847_0560769 3300041503 Bacteria 558
191 Ga0439458_0066355 3300042157 Bacteria 907
192 Ga0439444_0109378 3300042437 Bacteria 635
193 Ga0439440_0215966 3300042993 Bacteria 574
194 Ga0466965_0945213 3300044683 Bacteria 504
195 Ga0466961_0373903 3300044693 Bacteria 866
196 Ga0466963_0019255 3300044694 Bacteria 4278
197 Ga0466957_0079494 3300044842 Bacteria 2041
198 Ga0466960_0291548 3300044901 Bacteria 917
199 Ga0466960_0319767 3300044901 Bacteria 879
200 Ga0466959_0188287 3300045049 Bacteria 1441
201 Ga0466958_0090562 3300045836 Bacteria 1893
202 Ga0466958_0264295 3300045836 Bacteria 1102
203 Ga0466958_0302754 3300045836 Bacteria 1026
204 Ga0466958_0437775 3300045836 Bacteria 846
205 Ga0466958_0531040 3300045836 Bacteria 764
206 Ga0466958_0792046 3300045836 Bacteria 618
207 Ga0466967_0000641 3300045976 Bacteria 17576
208 Ga0466967_0397698 3300045976 Bacteria 1340
209 Ga0466967_0478253 3300045976 Bacteria 1220
210 Ga0466967_0788870 3300045976 Bacteria 943
211 Ga0466967_0861600 3300045976 Bacteria 900
212 Ga0466967_1209594 3300045976 Bacteria 753
213 Ga0466967_1747599 3300045976 Bacteria 619
214 Ga0466967_2184928 3300045976 Bacteria 549
215 Ga0466967_2402824 3300045976 Bacteria 522
216 Ga0495627_123712 3300046453 Bacteria 730
217 Ga0495603_0031208 3300046455 Bacteria 3207
218 Ga0495603_0075291 3300046455 Bacteria 1981
219 Ga0495603_0112148 3300046455 Bacteria 1590
220 Ga0495629_0003467 3300046459 Bacteria 11925
221 Ga0495629_0015188 3300046459 Bacteria 5534
222 Ga0495629_0043463 3300046459 Bacteria 3155
223 Ga0495638_0284676 3300046460 Bacteria 897
224 Ga0495651_0003232 3300046462 Bacteria 12512
225 Ga0495651_0229472 3300046462 Bacteria 1279
226 Ga0495653_0001258 3300046463 Bacteria 19629
227 Ga0495639_0008057 3300046475 Bacteria 4524
228 Ga0495662_0000731 3300046476 Bacteria 15697
229 Ga0495662_0001255 3300046476 Bacteria 12519
230 Ga0495664_0239786 3300046477 Bacteria 1097
231 Ga0495594_0005481 3300046499 Bacteria 6523
232 Ga0495594_0058092 3300046499 Bacteria 2136
233 Ga0495607_0478655 3300046501 Bacteria 555
234 Ga0495608_0059000 3300046511 Bacteria 2528
235 Ga0495608_0133200 3300046511 Bacteria 1589
236 Ga0495608_0274514 3300046511 Bacteria 1047
237 Ga0495618_0011269 3300046514 Bacteria 5418
238 Ga0495628_0002538 3300046516 Bacteria 16422
239 Ga0495628_0317962 3300046516 Bacteria 1149
240 Ga0495630_0385929 3300046517 Bacteria 1073
241 Ga0495643_0003183 3300046522 Bacteria 12196
242 Ga0495663_0131082 3300046525 Bacteria 845
243 Ga0495652_0059564 3300046529 Bacteria 3230
244 Ga0495652_0189433 3300046529 Bacteria 1571
245 Ga0495640_0112151 3300046533 Bacteria 1781
246 Ga0495586_0665078 3300046535 Bacteria 602
247 Ga0495587_0068286 3300046536 Bacteria 2070
248 Ga0495587_0353639 3300046536 Bacteria 819
249 Ga0495597_0041499 3300046542 Bacteria 2055
250 Ga0495622_0080082 3300046557 Bacteria 1503
251 Ga0495667_0001046 3300046559 Bacteria 17950
252 Ga0495668_0007377 3300046616 Bacteria 7039
253 Ga0495634_0014876 3300046642 Bacteria 5594
254 Ga0495635_0002917 3300046663 Bacteria 11750
255 Ga0495635_0201907 3300046663 Bacteria 1348
256 Ga0495659_0329408 3300046664 Bacteria 649
257 Ga0495588_0040962 3300046674 Bacteria 2364
258 Ga0495588_0076777 3300046674 Bacteria 1741
259 Ga0495657_0004961 3300046675 Bacteria 10578
260 Ga0495657_0032480 3300046675 Bacteria 3642
261 Ga0495657_0101802 3300046675 Bacteria 1829
262 Ga0495599_0049323 3300046678 Bacteria 2639
263 Ga0495623_0192733 3300046679 Bacteria 1176
264 Ga0495646_0123078 3300046680 Bacteria 1466
265 Ga0495613_0006569 3300046689 Bacteria 8695
266 Ga0495613_0022445 3300046689 Bacteria 4703
267 Ga0495624_0008690 3300046690 Bacteria 7071
268 Ga0495624_0132218 3300046690 Bacteria 1530
269 Ga0495670_0014519 3300046691 Bacteria 3871
270 Ga0495589_0006933 3300046794 Bacteria 5948
271 Ga0495600_0045965 3300046809 Bacteria 2849
272 Ga0495600_0084035 3300046809 Bacteria 2077
273 Ga0495600_0376427 3300046809 Bacteria 886
274 Ga0495600_0377737 3300046809 Bacteria 884
275 Ga0495581_0630800 3300047315 Bacteria 620
276 Ga0495604_0014659 3300047317 Bacteria 6247
277 Ga0495604_0101783 3300047317 Bacteria 2109
278 Ga0495604_0110277 3300047317 Bacteria 2007
279 Ga0495636_0000262 3300047318 Bacteria 20754
280 Ga0495674_0104452 3300047319 Bacteria 2408
281 Ga0495674_0155236 3300047319 Bacteria 1918
282 Ga0495672_0342327 3300047320 Bacteria 696
283 Ga0495676_0048046 3300047321 Bacteria 3444
284 Ga0495676_0061372 3300047321 Bacteria 2940
285 Ga0495676_0326757 3300047321 Bacteria 1029
286 Ga0495680_0037227 3300047322 Bacteria 3898
287 Ga0495680_1022822 3300047322 Bacteria 526
288 Ga0495687_004740 3300047443 Bacteria 9002
289 Ga0495687_006120 3300047443 Bacteria 7460
290 Ga0495675_0101906 3300047444 Bacteria 1796
291 Ga0495675_0185193 3300047444 Bacteria 1273
292 Ga0495679_077934 3300047446 Bacteria 945
293 Ga0495685_041200 3300047447 Bacteria 1578
294 Ga0495673_0163888 3300047469 Bacteria 852
295 Ga0495681_0087607 3300047470 Bacteria 1380
296 Ga0495684_0150036 3300047471 Bacteria 1743
297 Ga0495684_0161813 3300047471 Bacteria 1669
298 Ga0495684_0454407 3300047471 Bacteria 889
299 Ga0495684_0854969 3300047471 Bacteria 590
300 Ga0495593_0036465 3300047673 Bacteria 2666
301 Ga0495614_0029838 3300048089 Bacteria 2346
302 Ga0495626_0038169 3300048091 Bacteria 2278
303 Ga0496100_0152386 3300048903 Bacteria 1650
304 Ga0496100_0435050 3300048903 Bacteria 1004
305 Ga0496101_0315647 3300048904 Bacteria 1226
306 Ga0496102_0012997 3300048905 Bacteria 7210
307 Ga0496102_0071752 3300048905 Bacteria 3180
308 Ga0496103_0129057 3300048906 Bacteria 1614
309 Ga0496104_0093519 3300048907 Bacteria 2876
310 Ga0496104_0467637 3300048907 Bacteria 1172
311 Ga0496105_0165904 3300048908 Bacteria 1812
312 Ga0496106_0433263 3300048909 Bacteria 1056
313 Ga0496106_1054928 3300048909 Bacteria 638
314 Ga0496107_0041173 3300048910 Bacteria 3317
315 Ga0496107_0135888 3300048910 Bacteria 1816
316 Ga0496107_0583290 3300048910 Bacteria 827
317 Ga0496108_0011299 3300048911 Bacteria 7254
318 Ga0496109_0000353 3300048912 Bacteria 42673
319 Ga0496109_0004545 3300048912 Bacteria 11591
320 Ga0496109_0034685 3300048912 Bacteria 4547
321 Ga0496109_0144870 3300048912 Bacteria 2222
322 Ga0496109_0339741 3300048912 Bacteria 1418
323 Ga0496110_0169829 3300048913 Bacteria 1978
324 Ga0496110_0198842 3300048913 Bacteria 1821
325 Ga0496110_0432874 3300048913 Bacteria 1199
326 Ga0496112_0502114 3300048915 Bacteria 1148
327 Ga0496112_1442392 3300048915 Bacteria 603
328 Ga0496113_0054673 3300048916 Bacteria 2989
329 Ga0496114_0115850 3300048917 Bacteria 2300
330 Ga0496126_0000027 3300048929 Bacteria 396518
331 Ga0496126_1203287 3300048929 Bacteria 557
332 Ga0501302_007707 3300049525 Bacteria 723
333 Ga0501032_0020067 3300049569 Bacteria 4660
334 Ga0501033_0103554 3300049570 Bacteria 2075
335 Ga0501034_0025809 3300049571 Bacteria 5984
336 Ga0501036_0021330 3300049572 Bacteria 5444
337 Ga0501036_0094991 3300049572 Bacteria 2520
338 Ga0501039_0556967 3300049575 Bacteria 899
339 Ga0501040_0067676 3300049576 Bacteria 2462
340 Ga0501041_0438934 3300049577 Bacteria 828
341 Ga0501042_0207501 3300049578 Bacteria 1413
342 Ga0501042_0254037 3300049578 Bacteria 1268
343 Ga0501042_0313319 3300049578 Bacteria 1134
344 Ga0501043_0451507 3300049579 Bacteria 966
345 Ga0501047_0744118 3300049581 Bacteria 796
346 Ga0501048_0112416 3300049582 Bacteria 1923
347 Ga0501048_0531876 3300049582 Bacteria 843
348 Ga0501067_0461765 3300049583 Bacteria 709
349 Ga0501068_0014700 3300049584 Bacteria 4479
350 Ga0501069_0118927 3300049585 Bacteria 1508
351 Ga0501069_0853728 3300049585 Bacteria 553
352 Ga0501070_0017070 3300049586 Bacteria 6091
353 Ga0501070_0063775 3300049586 Bacteria 3052
354 Ga0501070_0091678 3300049586 Bacteria 2515
355 Ga0501070_1476510 3300049586 Bacteria 515
356 Ga0501071_0324453 3300049587 Bacteria 1169
357 Ga0501071_0378358 3300049587 Bacteria 1079
358 Ga0501072_0037810 3300049588 Bacteria 3786
359 Ga0501073_0053162 3300049589 Bacteria 2835
360 Ga0501074_0439231 3300049590 Bacteria 925
361 Ga0501076_0167132 3300049592 Bacteria 1793
362 Ga0501247_052329 3300049677 Bacteria 609
363 Ga0501250_071187 3300049680 Bacteria 575
364 Ga0501079_0552573 3300049741 Bacteria 905
365 Ga0501080_0018515 3300049742 Bacteria 6442
366 Ga0501080_0192381 3300049742 Bacteria 1875
367 Ga0501080_0737211 3300049742 Bacteria 867
368 Ga0501083_0021751 3300049744 Bacteria 4455
369 Ga0501279_042953 3300049775 Bacteria 699
370 Ga0501035_0120639 3300049822 Bacteria 2292
371 Ga0501044_0499024 3300049823 Bacteria 1118
372 Ga0501045_0191783 3300049824 Bacteria 1523
373 Ga0501045_0382049 3300049824 Bacteria 1048
374 Ga0501212_012783 3300049851 Bacteria 1226
375 nmdc:mga00v17_184762_c1 3300050491 Bacteria 1345
376 nmdc:mga0yw44_9283_c1 3300050492 Bacteria 4959
377 nmdc:mga09592_1074445_c1 3300050508 Bacteria 670
378 nmdc:mga08y16_1832960_c1 3300050511 Bacteria 559
379 nmdc:mga08y16_49762_c1 3300050511 Bacteria 4385
380 nmdc:mga0n895_1283786_c1 3300050512 Bacteria 704
381 nmdc:mga0rr50_108107_c1 3300050513 Bacteria 2197
382 nmdc:mga08x19_580718_c1 3300050514 Bacteria 794
383 nmdc:mga0a205_200133_c1 3300050515 Bacteria 1888
384 nmdc:mga0sz30_132106_c1 3300050516 Bacteria 1100
385 Ga0495601_0213950 3300053077 Bacteria 1259
386 Ga0495595_0069240 3300053084 Bacteria 1665
387 Ga0495619_0034387 3300053085 Bacteria 3295
388 Ga0495619_0076030 3300053085 Bacteria 2254
389 Ga0500578_0108389 3300053086 Bacteria 1752
390 Ga0500646_0056507 3300053090 Bacteria 1145
391 Ga0500566_0071212 3300053094 Bacteria 1951
392 Ga0500654_085639 3300053099 Bacteria 1438
393 Ga0500652_031919 3300053131 Bacteria 2070
394 Ga0500658_0012338 3300053134 Bacteria 3151
395 Ga0500616_0002980 3300053153 Bacteria 13406
396 Ga0500616_0415008 3300053153 Bacteria 535
397 Ga0500634_0039773 3300053161 Bacteria 2556
398 Ga0500656_007269 3300053732 Bacteria 1146
399 Ga0500599_001782 3300053736 Bacteria 2524
400 Ga0500587_001024 3300053739 Bacteria 3789
401 Ga0587082_155624 3300059504 Bacteria 544
402 Ga0501082_0651615 3300060353 Bacteria 921
403 2585312956 2582581314 Bacteria 11452267
404 2808848920 2808606359 Bacteria 9866990
405 2946072613 2946072368 Bacteria 8999607
406 2954006453 2954002825 Bacteria 9173742
407 8002790998 8002784119 Bacteria 9788632
408 8055161990 8055157932 Bacteria 6429399
409 Ga0501075_0771393
410 Ga0070683_100601215
411 Ga0070683_100698328
412 Ga0070683_101297949
413 Ga0070670_100140534
414 Ga0070677_10387056
415 Ga0070682_100510050
416 Ga0068868_100093205
417 Ga0070660_100661502
418 Ga0070660_100772119
419 Ga0070689_100119763
420 Ga0070689_100205867
421 Ga0070687_100065328
422 Ga0070668_100465248
423 Ga0070674_100413881
424 Ga0070659_100478267
425 Ga0070659_101035193
426 Ga0070709_10018021
427 Ga0070714_100052192
428 Ga0070713_100515533
429 Ga0070713_100742551
430 Ga0070701_10390165
431 Ga0070700_100098370
432 Ga0070700_100173289
433 Ga0070663_100783148
434 Ga0070685_11127039
435 Ga0070706_101230172
436 Ga0070707_100704148
437 Ga0070684_100286964
438 Ga0070684_101351986
439 Ga0068853_101171687
440 Ga0070686_100428003
441 Ga0070704_100369577
442 Ga0068855_100905342
443 Ga0070664_100349549
444 Ga0070664_100352752
445 Ga0068857_100229501
446 Ga0068854_100293143
447 Ga0068854_100422508
448 Ga0068856_101155471
449 Ga0070702_100089719
450 Ga0068852_100279297
451 Ga0068852_100833231
452 Ga0068864_100116757
453 Ga0068866_10036932
454 Ga0068861_100068116
455 Ga0068851_10137578
456 Ga0068870_10113010
457 Ga0068858_101204099
458 Ga0068860_100399512
459 Ga0068862_101215539
460 Ga0081455_10018673
461 Ga0081539_10016421
462 Ga0070717_10079401
463 Ga0070717_10347405
464 Ga0070717_10930543
465 Ga0075365_10005275
466 Ga0075364_10720092
467 Ga0070715_10438654
468 Ga0070712_100790648
469 Ga0070712_101230464
470 Ga0075369_10103594
471 Ga0097621_100188795
472 Ga0075431_100765266
473 Ga0075433_10082725
474 Ga0075434_101069093
475 Ga0075429_100752655
476 Ga0068865_100774968
477 Ga0075435_101362612
478 Ga0099794_10122928
479 Ga0105251_10040641
480 Ga0105240_12039915
481 Ga0111539_10007382
482 Ga0111539_10350596
483 Ga0111539_11277197
484 Ga0105247_10168812
485 Ga0105243_10160662
486 Ga0105241_10610138
487 Ga0105241_10769931
488 Ga0105242_12144497
489 Ga0105248_10889165
490 Ga0105249_11176410
491 Ga0105249_12769634
492 Ga0099796_10234782
493 Ga0105246_10059421
494 Ga0105246_10376655
495 Ga0105246_11777275
496 Ga0157320_1016543
497 Ga0157325_1002275
498 Ga0157347_1058692
499 Ga0157315_1003571
500 Ga0157327_1024807
501 Ga0157326_1074161
502 Ga0157371_10779641
503 Ga0157371_10868497
504 Ga0157369_11886881
505 Ga0157374_12455333
506 Ga0157378_11152468
507 Ga0163162_12970761
508 Ga0157372_10320152
509 Ga0157372_10342522
510 Ga0157372_10429600
511 Ga0157375_10658431
512 Ga0163163_11225511
513 Ga0157380_10184157
514 Ga0157380_12306444
515 Ga0182008_10626608
516 Ga0157377_10513111
517 Ga0157379_11308554
518 Ga0182005_1215480
519 Ga0206351_10712853
520 Ga0206354_11360628
521 Ga0213874_10128653
522 Ga0207656_10251977
523 Ga0207682_10285974
524 Ga0207647_10177131
525 Ga0207685_10163977
526 Ga0207699_10193281
527 Ga0207645_10249270
528 Ga0207705_10542669
529 Ga0207707_11090617
530 Ga0207695_10793173
531 Ga0207657_10408885
532 Ga0207657_10516378
533 Ga0207700_10070103
534 Ga0207664_10180142
535 Ga0207704_10135237
536 Ga0207691_10310899
537 Ga0207689_10163094
538 Ga0207661_10050293
539 Ga0207661_11831041
540 Ga0207679_10083706
541 Ga0207667_11288839
542 Ga0207651_10279199
543 Ga0207668_10394181
544 Ga0207640_10999603
545 Ga0207677_10323511
546 Ga0207677_10480360
547 Ga0207708_10029834
548 Ga0207708_10212163
549 Ga0209998_10047494
550 Ga0268265_10093990
551 Ga0268264_11045684
552 Ga0307517_10007410
553 Ga0265338_10001947
554 Ga0307511_10003179
555 Ga0307508_10101272
556 Ga0307514_10205506
557 Ga0307516_10007643
558 Ga0307516_10756833
559 Ga0307518_10067696
560 Ga0307518_10230507
561 Ga0307410_10454561
562 Ga0307406_10418643
563 Ga0307407_11074961
564 Ga0307409_100186940
565 Ga0307416_101288523
566 Ga0307415_100016397
567 Ga0307415_100056739
568 Ga0307415_100141165
569 Ga0307510_10425077
570 Ga0373958_0086640
571 Ga0373938_0071812
572 Ga0373926_0293972
573 Ga0373936_0229652
574 Ga0373945_0050944
575 Ga0373953_0242684
576 Ga0373956_0288660
577 Ga0373957_0134971
578 Ga0373946_0084697
579 Ga0373955_0026683
580 Ga0373935_0379816
581 Ga0373927_0503075
582 Ga0373933_0152434
583 Ga0373947_0184899
584 Ga0395900_0490362
585 Ga0395898_0146841
586 Ga0436364_1314789
587 Ga0395901_0053735
588 Ga0395901_0176453
589 Ga0395901_0382507
590 Ga0436363_1171979
591 Ga0436363_1534419
592 Ga0436362_0177107
593 Ga0439465_0292132
594 Ga0451791_1204521
595 Ga0451793_0897824
596 Ga0451802_1039055
597 Ga0451847_0047975
598 Ga0451847_0560769
599 Ga0439458_0066355
600 Ga0439444_0109378
601 Ga0439440_0215966
602 Ga0466965_0945213
603 Ga0466961_0373903
604 Ga0466963_0019255
605 Ga0466957_0079494
606 Ga0466960_0291548
607 Ga0466960_0319767
608 Ga0466959_0188287
609 Ga0466958_0090562
610 Ga0466958_0264295
611 Ga0466958_0302754
612 Ga0466958_0437775
613 Ga0466958_0531040
614 Ga0466958_0792046
615 Ga0466967_0000641
616 Ga0466967_0397698
617 Ga0466967_0478253
618 Ga0466967_0788870
619 Ga0466967_0861600
620 Ga0466967_1209594
621 Ga0466967_1747599
622 Ga0466967_2184928
623 Ga0466967_2402824
624 Ga0495627_123712
625 Ga0495603_0031208
626 Ga0495603_0075291
627 Ga0495603_0112148
628 Ga0495629_0003467
629 Ga0495629_0015188
630 Ga0495629_0043463
631 Ga0495638_0284676
632 Ga0495651_0003232
633 Ga0495651_0229472
634 Ga0495653_0001258
635 Ga0495639_0008057
636 Ga0495662_0000731
637 Ga0495662_0001255
638 Ga0495664_0239786
639 Ga0495594_0005481
640 Ga0495594_0058092
641 Ga0495607_0478655
642 Ga0495608_0059000
643 Ga0495608_0133200
644 Ga0495608_0274514
645 Ga0495618_0011269
646 Ga0495628_0002538
647 Ga0495628_0317962
648 Ga0495630_0385929
649 Ga0495643_0003183
650 Ga0495663_0131082
651 Ga0495652_0059564
652 Ga0495652_0189433
653 Ga0495640_0112151
654 Ga0495586_0665078
655 Ga0495587_0068286
656 Ga0495587_0353639
657 Ga0495597_0041499
658 Ga0495622_0080082
659 Ga0495667_0001046
660 Ga0495668_0007377
661 Ga0495634_0014876
662 Ga0495635_0002917
663 Ga0495635_0201907
664 Ga0495659_0329408
665 Ga0495588_0040962
666 Ga0495588_0076777
667 Ga0495657_0004961
668 Ga0495657_0032480
669 Ga0495657_0101802
670 Ga0495599_0049323
671 Ga0495623_0192733
672 Ga0495646_0123078
673 Ga0495613_0006569
674 Ga0495613_0022445
675 Ga0495624_0008690
676 Ga0495624_0132218
677 Ga0495670_0014519
678 Ga0495589_0006933
679 Ga0495600_0045965
680 Ga0495600_0084035
681 Ga0495600_0376427
682 Ga0495600_0377737
683 Ga0495581_0630800
684 Ga0495604_0014659
685 Ga0495604_0101783
686 Ga0495604_0110277
687 Ga0495636_0000262
688 Ga0495674_0104452
689 Ga0495674_0155236
690 Ga0495672_0342327
691 Ga0495676_0048046
692 Ga0495676_0061372
693 Ga0495676_0326757
694 Ga0495680_0037227
695 Ga0495680_1022822
696 Ga0495687_004740
697 Ga0495687_006120
698 Ga0495675_0101906
699 Ga0495675_0185193
700 Ga0495679_077934
701 Ga0495685_041200
702 Ga0495673_0163888
703 Ga0495681_0087607
704 Ga0495684_0150036
705 Ga0495684_0161813
706 Ga0495684_0454407
707 Ga0495684_0854969
708 Ga0495593_0036465
709 Ga0495614_0029838
710 Ga0495626_0038169
711 Ga0496100_0152386
712 Ga0496100_0435050
713 Ga0496101_0315647
714 Ga0496102_0012997
715 Ga0496102_0071752
716 Ga0496103_0129057
717 Ga0496104_0093519
718 Ga0496104_0467637
719 Ga0496105_0165904
720 Ga0496106_0433263
721 Ga0496106_1054928
722 Ga0496107_0041173
723 Ga0496107_0135888
724 Ga0496107_0583290
725 Ga0496108_0011299
726 Ga0496109_0000353
727 Ga0496109_0004545
728 Ga0496109_0034685
729 Ga0496109_0144870
730 Ga0496109_0339741
731 Ga0496110_0169829
732 Ga0496110_0198842
733 Ga0496110_0432874
734 Ga0496112_0502114
735 Ga0496112_1442392
736 Ga0496113_0054673
737 Ga0496114_0115850
738 Ga0496126_0000027
739 Ga0496126_1203287
740 Ga0501302_007707
741 Ga0501032_0020067
742 Ga0501033_0103554
743 Ga0501034_0025809
744 Ga0501036_0021330
745 Ga0501036_0094991
746 Ga0501039_0556967
747 Ga0501040_0067676
748 Ga0501041_0438934
749 Ga0501042_0207501
750 Ga0501042_0254037
751 Ga0501042_0313319
752 Ga0501043_0451507
753 Ga0501047_0744118
754 Ga0501048_0112416
755 Ga0501048_0531876
756 Ga0501067_0461765
757 Ga0501068_0014700
758 Ga0501069_0118927
759 Ga0501069_0853728
760 Ga0501070_0017070
761 Ga0501070_0063775
762 Ga0501070_0091678
763 Ga0501070_1476510
764 Ga0501071_0324453
765 Ga0501071_0378358
766 Ga0501072_0037810
767 Ga0501073_0053162
768 Ga0501074_0439231
769 Ga0501076_0167132
770 Ga0501247_052329
771 Ga0501250_071187
772 Ga0501079_0552573
773 Ga0501080_0018515
774 Ga0501080_0192381
775 Ga0501080_0737211
776 Ga0501083_0021751
777 Ga0501279_042953
778 Ga0501035_0120639
779 Ga0501044_0499024
780 Ga0501045_0191783
781 Ga0501045_0382049
782 Ga0501212_012783
783 nmdc:mga00v17_184762_c1
784 nmdc:mga0yw44_9283_c1
785 nmdc:mga09592_1074445_c1
786 nmdc:mga08y16_1832960_c1
787 nmdc:mga08y16_49762_c1
788 nmdc:mga0n895_1283786_c1
789 nmdc:mga0rr50_108107_c1
790 nmdc:mga08x19_580718_c1
791 nmdc:mga0a205_200133_c1
792 nmdc:mga0sz30_132106_c1
793 Ga0495601_0213950
794 Ga0495595_0069240
795 Ga0495619_0034387
796 Ga0495619_0076030
797 Ga0500578_0108389
798 Ga0500646_0056507
799 Ga0500566_0071212
800 Ga0500654_085639
801 Ga0500652_031919
802 Ga0500658_0012338
803 Ga0500616_0002980
804 Ga0500616_0415008
805 Ga0500634_0039773
806 Ga0500656_007269
807 Ga0500599_001782
808 Ga0500587_001024
809 Ga0587082_155624
810 Ga0501082_0651615
811 2585312956
812 2808848920
813 2946072613
814 2954006453
815 8002790998
816 8055161990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

30

70

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

151

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9752 9 139
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9666 5 140
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9201 9 139
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9019 5 140
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.8857 12 132
ID Description Score Start End Superfamily
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9634 9 137 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9065 9 137 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8909 79 133 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8737 79 133 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8491 79 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A5D0TTV7-F1-model_v4 Glyoxalase 0.9924 65 140
AF-A0A1Q7J927-F1-model_v4 Extradiol dioxygenase 0.9816 22 138 GO:0051213
AF-A0A3S4E747-F1-model_v4 VOC domain-containing protein 0.9809 8 135
AF-A0A0C2DCT0-F1-model_v4 Glyoxalase family protein 0.9807 9 137
AF-A0A6L7GPT1-F1-model_v4 Glyoxalase 0.9805 9 136

Map