F436775

General Info

Members Datasets Scaffolds Average Seq Length
408 186 816 169

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0217353|Ga0395901_0217353_619_1236
Length 205
Sequence VRGDGDGLIIPRFHSGFPTVPSRARAWHGKLSKLPQGFAVKPRLFGFSIALVVLVLDQLAKWAVAGPLKLQWVGQIYILPIFNLTWVENIGISLGILNAHTELGRWMLVAVTSAIAIGVAVWIGREKLRGDQLALGMILGGALGNILDRARHGYVVDFADLHFGTFRPFLVFNVGDAAISIGVAILLLRAFLVRHEKPEESLDHA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.7
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0217353 3300038443 Bacteria 1998
2 JGI24736J21556_1041561 3300001904 Bacteria 707
3 JGI24740J21852_10026657 3300001979 Bacteria 1933
4 JGI24035J26624_1036288 3300002126 Bacteria 545
5 Ga0065712_10221706 3300005290 Bacteria 1039
6 Ga0065715_10142836 3300005293 Bacteria 1821
7 Ga0065715_10337724 3300005293 Bacteria 942
8 Ga0070658_10000405 3300005327 Bacteria 37355
9 Ga0070658_10000781 3300005327 Bacteria 27355
10 Ga0070658_10021747 3300005327 Bacteria 5141
11 Ga0070658_10044962 3300005327 Bacteria 3569
12 Ga0070658_10048680 3300005327 Bacteria 3432
13 Ga0070658_10049178 3300005327 Bacteria 3415
14 Ga0070658_10148074 3300005327 Bacteria 1964
15 Ga0070658_10202942 3300005327 Bacteria 1673
16 Ga0070676_10393862 3300005328 Bacteria 962
17 Ga0070683_100076233 3300005329 Bacteria 3134
18 Ga0070683_100468651 3300005329 Bacteria 1202
19 Ga0070690_100017929 3300005330 Bacteria 4266
20 Ga0070670_100136107 3300005331 Bacteria 2123
21 Ga0070670_100191400 3300005331 Bacteria 1777
22 Ga0070670_100368190 3300005331 Bacteria 1264
23 Ga0070677_10011002 3300005333 Bacteria 3109
24 Ga0070677_10020854 3300005333 Bacteria 2395
25 Ga0070680_100028742 3300005336 Bacteria 4461
26 Ga0070680_100130668 3300005336 Bacteria 2101
27 Ga0070680_100175960 3300005336 Bacteria 1802
28 Ga0070680_100207279 3300005336 Bacteria 1653
29 Ga0070680_100724871 3300005336 Bacteria 856
30 Ga0070682_100124141 3300005337 Bacteria 1738
31 Ga0070660_100000194 3300005339 Bacteria 40512
32 Ga0070660_100036776 3300005339 Bacteria 3710
33 Ga0070660_100052162 3300005339 Bacteria 3152
34 Ga0070660_100060303 3300005339 Bacteria 2944
35 Ga0070660_100109271 3300005339 Bacteria 2199
36 Ga0070660_100252078 3300005339 Bacteria 1440
37 Ga0070691_10265387 3300005341 Bacteria 926
38 Ga0070661_100038079 3300005344 Bacteria 3500
39 Ga0070661_100079514 3300005344 Bacteria 2420
40 Ga0070661_100361085 3300005344 Bacteria 1141
41 Ga0070661_100823909 3300005344 Unclassified 762
42 Ga0070661_101318091 3300005344 Bacteria 606
43 Ga0070692_10012066 3300005345 Bacteria 3986
44 Ga0070692_10016653 3300005345 Bacteria 3499
45 Ga0070692_10080504 3300005345 Bacteria 1753
46 Ga0070668_100130199 3300005347 Bacteria 2019
47 Ga0070669_100282736 3300005353 Bacteria 1330
48 Ga0070675_100005199 3300005354 Bacteria 9928
49 Ga0070675_100068461 3300005354 Bacteria 2939
50 Ga0070671_100079870 3300005355 Bacteria 2734
51 Ga0070674_100212294 3300005356 Bacteria 1501
52 Ga0070673_100126161 3300005364 Bacteria 2142
53 Ga0070673_100153250 3300005364 Bacteria 1953
54 Ga0070659_100011533 3300005366 Bacteria 6539
55 Ga0070659_100052003 3300005366 Bacteria 3221
56 Ga0070659_100213778 3300005366 Bacteria 1589
57 Ga0070659_100328830 3300005366 Bacteria 1279
58 Ga0070659_100334698 3300005366 Bacteria 1267
59 Ga0070659_100370034 3300005366 Bacteria 1205
60 Ga0070659_100481923 3300005366 Bacteria 1055
61 Ga0070659_101134161 3300005366 Bacteria 690
62 Ga0070667_100163232 3300005367 Bacteria 1963
63 Ga0070663_100010487 3300005455 Bacteria 5775
64 Ga0070663_100143035 3300005455 Bacteria 1828
65 Ga0070678_100089503 3300005456 Bacteria 2356
66 Ga0070662_100007827 3300005457 Bacteria 6941
67 Ga0070662_100196609 3300005457 Bacteria 1598
68 Ga0070662_100629808 3300005457 Bacteria 904
69 Ga0070681_10451968 3300005458 Bacteria 1197
70 Ga0070681_11003572 3300005458 Bacteria 754
71 Ga0068867_100125804 3300005459 Bacteria 1986
72 Ga0070679_100485558 3300005530 Bacteria 1179
73 Ga0070684_100013895 3300005535 Bacteria 6504
74 Ga0070684_100497065 3300005535 Bacteria 1129
75 Ga0070684_101767269 3300005535 Unclassified 583
76 Ga0068853_100266044 3300005539 Bacteria 1578
77 Ga0068853_100281636 3300005539 Bacteria 1533
78 Ga0068853_100469278 3300005539 Bacteria 1185
79 Ga0070672_100390400 3300005543 Bacteria 1192
80 Ga0070686_100042064 3300005544 Bacteria 2860
81 Ga0070696_100043762 3300005546 Bacteria 3099
82 Ga0070693_100346224 3300005547 Bacteria 1016
83 Ga0070665_100025405 3300005548 Bacteria 5969
84 Ga0068855_100001534 3300005563 Bacteria 29001
85 Ga0068855_100005402 3300005563 Bacteria 15590
86 Ga0068855_100366953 3300005563 Bacteria 1583
87 Ga0068855_101410642 3300005563 Bacteria 718
88 Ga0070664_100167132 3300005564 Bacteria 1949
89 Ga0070664_100314366 3300005564 Bacteria 1418
90 Ga0068854_100080329 3300005578 Bacteria 2406
91 Ga0068854_100379823 3300005578 Bacteria 1164
92 Ga0068856_100040349 3300005614 Bacteria 4585
93 Ga0068852_100003939 3300005616 Bacteria 10436
94 Ga0068852_100032849 3300005616 Bacteria 4301
95 Ga0068852_100052233 3300005616 Bacteria 3512
96 Ga0068852_100120101 3300005616 Bacteria 2404
97 Ga0068852_100203709 3300005616 Bacteria 1873
98 Ga0068852_100273673 3300005616 Bacteria 1626
99 Ga0068859_100045260 3300005617 Bacteria 4421
100 Ga0068859_100339476 3300005617 Bacteria 1596
101 Ga0068864_100056191 3300005618 Bacteria 3401
102 Ga0068864_100124471 3300005618 Bacteria 2309
103 Ga0068866_10013193 3300005718 Bacteria 3618
104 Ga0068851_10044712 3300005834 Bacteria 2236
105 Ga0068863_100554575 3300005841 Bacteria 1135
106 Ga0068858_100098599 3300005842 Bacteria 2724
107 Ga0068858_100549377 3300005842 Bacteria 1118
108 Ga0068860_100361584 3300005843 Bacteria 1430
109 Ga0068862_100037534 3300005844 Bacteria 4106
110 Ga0068862_100175742 3300005844 Bacteria 1920
111 Ga0081539_10104480 3300005985 Bacteria 1437
112 Ga0097621_100222162 3300006237 Bacteria 1646
113 Ga0068865_100063406 3300006881 Bacteria 2597
114 Ga0097620_100045261 3300006931 Bacteria 4421
115 Ga0097620_100339488 3300006931 Bacteria 1596
116 Ga0105240_10025922 3300009093 Bacteria 7700
117 Ga0105245_10029483 3300009098 Bacteria 4848
118 Ga0105247_10171167 3300009101 Bacteria 1444
119 Ga0105243_10430271 3300009148 Bacteria 1233
120 Ga0105248_10543702 3300009177 Bacteria 1310
121 Ga0105237_10373666 3300009545 Bacteria 1430
122 Ga0105238_10215689 3300009551 Bacteria 1895
123 Ga0105238_10217959 3300009551 Bacteria 1884
124 Ga0105239_10833469 3300010375 Bacteria 1057
125 Ga0157373_10040621 3300013100 Bacteria 3328
126 Ga0157373_10046794 3300013100 Bacteria 3086
127 Ga0157373_10132488 3300013100 Bacteria 1753
128 Ga0157373_10489969 3300013100 Bacteria 887
129 Ga0157371_10000915 3300013102 Bacteria 33246
130 Ga0157371_10062143 3300013102 Bacteria 2648
131 Ga0157371_10075734 3300013102 Bacteria 2383
132 Ga0157371_10350210 3300013102 Bacteria 1075
133 Ga0157371_10376224 3300013102 Bacteria 1036
134 Ga0157371_10602281 3300013102 Bacteria 817
135 Ga0157370_10080854 3300013104 Bacteria 3059
136 Ga0157370_10273384 3300013104 Bacteria 1561
137 Ga0157370_10305110 3300013104 Bacteria 1469
138 Ga0157370_10784554 3300013104 Bacteria 867
139 Ga0157370_10812321 3300013104 Bacteria 851
140 Ga0157369_10000457 3300013105 Bacteria 54100
141 Ga0157369_10007383 3300013105 Bacteria 12652
142 Ga0157369_10016418 3300013105 Bacteria 8326
143 Ga0157374_10004629 3300013296 Bacteria 11542
144 Ga0157374_10723207 3300013296 Bacteria 1009
145 Ga0157378_10691718 3300013297 Bacteria 1038
146 Ga0157372_10296025 3300013307 Bacteria 1882
147 Ga0157372_10308587 3300013307 Bacteria 1841
148 Ga0157380_10233125 3300014326 Bacteria 1655
149 Ga0157380_10595977 3300014326 Bacteria 1092
150 Ga0157376_10119729 3300014969 Bacteria 2331
151 Ga0206354_10310964 3300020081 Bacteria 1284
152 Ga0207697_10008367 3300025315 Bacteria 4531
153 Ga0207656_10082936 3300025321 Bacteria 1444
154 Ga0207656_10138771 3300025321 Bacteria 1144
155 Ga0207682_10002626 3300025893 Bacteria 8005
156 Ga0207682_10036703 3300025893 Bacteria 1984
157 Ga0207682_10048684 3300025893 Bacteria 1748
158 Ga0207642_10468327 3300025899 Bacteria 766
159 Ga0207688_10225046 3300025901 Bacteria 1131
160 Ga0207647_10012060 3300025904 Bacteria 6033
161 Ga0207647_10019837 3300025904 Bacteria 4515
162 Ga0207647_10248236 3300025904 Bacteria 1021
163 Ga0207647_10488623 3300025904 Bacteria 687
164 Ga0207645_10018758 3300025907 Bacteria 4544
165 Ga0207645_10260620 3300025907 Bacteria 1148
166 Ga0207705_10000192 3300025909 Bacteria 62246
167 Ga0207705_10000276 3300025909 Bacteria 49160
168 Ga0207705_10000692 3300025909 Bacteria 27908
169 Ga0207705_10009275 3300025909 Bacteria 7157
170 Ga0207705_10028712 3300025909 Bacteria 3965
171 Ga0207705_10047161 3300025909 Bacteria 3098
172 Ga0207705_10056314 3300025909 Bacteria 2834
173 Ga0207705_10060060 3300025909 Bacteria 2745
174 Ga0207705_10065095 3300025909 Bacteria 2635
175 Ga0207705_10112449 3300025909 Bacteria 2013
176 Ga0207705_10196024 3300025909 Bacteria 1529
177 Ga0207707_10300467 3300025912 Bacteria 1388
178 Ga0207707_10616675 3300025912 Bacteria 917
179 Ga0207707_10691829 3300025912 Bacteria 857
180 Ga0207695_10124702 3300025913 Bacteria 2539
181 Ga0207657_10000218 3300025919 Bacteria 59661
182 Ga0207657_10001140 3300025919 Bacteria 28213
183 Ga0207657_10002119 3300025919 Bacteria 21474
184 Ga0207657_10006417 3300025919 Bacteria 12199
185 Ga0207657_10044206 3300025919 Bacteria 3917
186 Ga0207657_10111056 3300025919 Bacteria 2264
187 Ga0207649_10001340 3300025920 Bacteria 14634
188 Ga0207649_10178438 3300025920 Bacteria 1485
189 Ga0207649_10348094 3300025920 Bacteria 1096
190 Ga0207649_10719567 3300025920 Bacteria 775
191 Ga0207649_10786287 3300025920 Bacteria 742
192 Ga0207652_10029641 3300025921 Bacteria 4578
193 Ga0207652_10045606 3300025921 Bacteria 3737
194 Ga0207681_10028727 3300025923 Bacteria 3605
195 Ga0207694_10007706 3300025924 Bacteria 8158
196 Ga0207650_10141498 3300025925 Bacteria 1892
197 Ga0207650_10164015 3300025925 Bacteria 1762
198 Ga0207650_10361910 3300025925 Bacteria 1195
199 Ga0207659_10035092 3300025926 Bacteria 3464
200 Ga0207659_10060744 3300025926 Bacteria 2722
201 Ga0207687_10449818 3300025927 Bacteria 1068
202 Ga0207644_10023079 3300025931 Bacteria 4256
203 Ga0207690_10015551 3300025932 Bacteria 4612
204 Ga0207690_10109282 3300025932 Bacteria 1989
205 Ga0207690_10286833 3300025932 Bacteria 1284
206 Ga0207690_10325336 3300025932 Bacteria 1209
207 Ga0207690_10478000 3300025932 Bacteria 1005
208 Ga0207690_10849715 3300025932 Bacteria 756
209 Ga0207706_10004392 3300025933 Bacteria 13255
210 Ga0207706_10063144 3300025933 Bacteria 3261
211 Ga0207706_10095708 3300025933 Bacteria 2611
212 Ga0207706_10347558 3300025933 Bacteria 1290
213 Ga0207669_10193511 3300025937 Bacteria 1469
214 Ga0207691_10069099 3300025940 Bacteria 3191
215 Ga0207691_10245113 3300025940 Bacteria 1548
216 Ga0207691_10528056 3300025940 Bacteria 1001
217 Ga0207691_10697175 3300025940 Bacteria 856
218 Ga0207711_10081589 3300025941 Bacteria 2826
219 Ga0207711_10085287 3300025941 Bacteria 2767
220 Ga0207661_10165617 3300025944 Bacteria 1920
221 Ga0207661_10174154 3300025944 Bacteria 1875
222 Ga0207661_10327719 3300025944 Bacteria 1378
223 Ga0207679_10691496 3300025945 Bacteria 925
224 Ga0207679_10832053 3300025945 Bacteria 842
225 Ga0207667_10000122 3300025949 Bacteria 121588
226 Ga0207667_10008267 3300025949 Bacteria 12384
227 Ga0207667_10027779 3300025949 Bacteria 6154
228 Ga0207667_10124314 3300025949 Bacteria 2658
229 Ga0207667_10299034 3300025949 Bacteria 1644
230 Ga0207667_10352440 3300025949 Bacteria 1501
231 Ga0207651_10068468 3300025960 Bacteria 2503
232 Ga0207668_10177936 3300025972 Bacteria 1675
233 Ga0207640_10001597 3300025981 Bacteria 12184
234 Ga0207640_10040971 3300025981 Bacteria 2943
235 Ga0207640_10413196 3300025981 Bacteria 1102
236 Ga0207640_10770077 3300025981 Bacteria 831
237 Ga0207658_10027886 3300025986 Bacteria 3972
238 Ga0207677_10014319 3300026023 Bacteria 4628
239 Ga0207703_10476544 3300026035 Bacteria 1169
240 Ga0207639_10548358 3300026041 Bacteria 1061
241 Ga0207639_10751482 3300026041 Bacteria 907
242 Ga0207639_10754606 3300026041 Bacteria 905
243 Ga0207678_10013354 3300026067 Bacteria 7209
244 Ga0207678_10029999 3300026067 Bacteria 4748
245 Ga0207678_10085620 3300026067 Bacteria 2694
246 Ga0207678_10371113 3300026067 Bacteria 1236
247 Ga0207678_10431450 3300026067 Bacteria 1144
248 Ga0207702_10004475 3300026078 Bacteria 12412
249 Ga0207702_10010676 3300026078 Bacteria 7674
250 Ga0207702_10237488 3300026078 Bacteria 1706
251 Ga0207702_10629440 3300026078 Bacteria 1054
252 Ga0207648_10646338 3300026089 Bacteria 977
253 Ga0207676_10040159 3300026095 Bacteria 3584
254 Ga0207676_10062492 3300026095 Bacteria 2954
255 Ga0207675_100923449 3300026118 Bacteria 889
256 Ga0207683_10002271 3300026121 Bacteria 16845
257 Ga0207683_10076011 3300026121 Bacteria 2974
258 Ga0207698_10006930 3300026142 Bacteria 7092
259 Ga0207698_10019546 3300026142 Bacteria 4641
260 Ga0207698_10523678 3300026142 Bacteria 1157
261 Ga0207698_10747557 3300026142 Unclassified 976
262 Ga0209983_1019085 3300027665 Bacteria 1425
263 Ga0209971_1024982 3300027682 Bacteria 1427
264 Ga0268266_10262838 3300028379 Bacteria 1600
265 Ga0268265_10230459 3300028380 Bacteria 1627
266 Ga0268264_10259566 3300028381 Bacteria 1618
267 Ga0268264_11039363 3300028381 Bacteria 826
268 Ga0307408_100233393 3300031548 Bacteria 1508
269 Ga0307408_100242648 3300031548 Bacteria 1481
270 Ga0307408_100551424 3300031548 Bacteria 1017
271 Ga0307408_100800672 3300031548 Bacteria 855
272 Ga0307408_101021037 3300031548 Bacteria 763
273 Ga0307405_10226509 3300031731 Bacteria 1375
274 Ga0307413_10129520 3300031824 Bacteria 1724
275 Ga0307413_10205477 3300031824 Bacteria 1426
276 Ga0307413_10651908 3300031824 Bacteria 868
277 Ga0307410_10095783 3300031852 Bacteria 2117
278 Ga0307410_10123879 3300031852 Bacteria 1889
279 Ga0307410_10260712 3300031852 Bacteria 1352
280 Ga0307410_10550448 3300031852 Bacteria 956
281 Ga0307412_10094899 3300031911 Bacteria 2096
282 Ga0307412_10357182 3300031911 Bacteria 1175
283 Ga0307412_10618582 3300031911 Bacteria 920
284 Ga0307409_100075150 3300031995 Bacteria 2704
285 Ga0307409_100250299 3300031995 Bacteria 1619
286 Ga0307409_100286518 3300031995 Bacteria 1525
287 Ga0307409_100366582 3300031995 Bacteria 1364
288 Ga0307409_100676145 3300031995 Bacteria 1029
289 Ga0307409_101215207 3300031995 Bacteria 777
290 Ga0307416_100313589 3300032002 Bacteria 1566
291 Ga0307416_100555081 3300032002 Bacteria 1222
292 Ga0307416_101446755 3300032002 Bacteria 793
293 Ga0307414_10002379 3300032004 Bacteria 9832
294 Ga0307414_10470497 3300032004 Bacteria 1106
295 Ga0307414_10472906 3300032004 Bacteria 1104
296 Ga0307414_10493966 3300032004 Bacteria 1081
297 Ga0307411_10005600 3300032005 Bacteria 6190
298 Ga0307411_10008125 3300032005 Bacteria 5411
299 Ga0307411_10031057 3300032005 Bacteria 3282
300 Ga0307411_10068559 3300032005 Bacteria 2391
301 Ga0307411_10103433 3300032005 Bacteria 2020
302 Ga0307411_10467042 3300032005 Bacteria 1059
303 Ga0307411_10959863 3300032005 Bacteria 763
304 Ga0307411_11076260 3300032005 Bacteria 723
305 Ga0307415_100118066 3300032126 Bacteria 1982
306 Ga0307415_100228722 3300032126 Bacteria 1496
307 Ga0307415_100291426 3300032126 Bacteria 1347
308 Ga0307415_100368540 3300032126 Bacteria 1215
309 Ga0307415_100588029 3300032126 Bacteria 988
310 Ga0373959_0141107 3300034820 Bacteria 603
311 Ga0373954_0326885 3300035118 Bacteria 757
312 Ga0373956_0027984 3300035119 Bacteria 2451
313 Ga0373957_0164329 3300035120 Bacteria 915
314 Ga0373955_0012289 3300035172 Bacteria 4113
315 Ga0373931_0269377 3300035691 Bacteria 1042
316 Ga0373933_0134963 3300035724 Bacteria 1554
317 Ga0373937_0016802 3300036401 Bacteria 6505
318 Ga0395899_0005230 3300037312 Bacteria 10092
319 Ga0395899_0024242 3300037312 Bacteria 4588
320 Ga0395899_0108638 3300037312 Bacteria 1996
321 Ga0395899_0126964 3300037312 Bacteria 1823
322 Ga0395899_0247912 3300037312 Bacteria 1223
323 Ga0395899_0272267 3300037312 Bacteria 1155
324 Ga0395899_0282592 3300037312 Bacteria 1128
325 Ga0395899_0378750 3300037312 Bacteria 941
326 Ga0395900_0001684 3300037418 Bacteria 25724
327 Ga0395900_0017863 3300037418 Bacteria 7240
328 Ga0395900_0107699 3300037418 Bacteria 2863
329 Ga0395900_0508805 3300037418 Bacteria 1153
330 Ga0395900_0514160 3300037418 Bacteria 1146
331 Ga0395900_0582864 3300037418 Bacteria 1060
332 Ga0395898_0020031 3300037466 Bacteria 6799
333 Ga0395898_0054992 3300037466 Bacteria 3882
334 Ga0395898_0201363 3300037466 Bacteria 1901
335 Ga0395898_0212243 3300037466 Bacteria 1846
336 Ga0395898_0310025 3300037466 Bacteria 1505
337 Ga0395905_0001994 3300037471 Bacteria 23323
338 Ga0395905_0029530 3300037471 Bacteria 5165
339 Ga0395905_0085827 3300037471 Bacteria 2949
340 Ga0395905_0173696 3300037471 Bacteria 2023
341 Ga0395905_0192737 3300037471 Bacteria 1911
342 Ga0395905_0200886 3300037471 Bacteria 1869
343 Ga0395905_0326197 3300037471 Bacteria 1425
344 Ga0395905_0754715 3300037471 Bacteria 875
345 Ga0395905_1307617 3300037471 Bacteria 629
346 Ga0395901_0000047 3300038443 Bacteria 175221
347 Ga0395901_0004115 3300038443 Bacteria 14655
348 Ga0395901_0034327 3300038443 Bacteria 5238
349 Ga0395901_0035156 3300038443 Bacteria 5177
350 Ga0395901_0039811 3300038443 Bacteria 4864
351 Ga0395901_0048918 3300038443 Bacteria 4391
352 Ga0395901_0200551 3300038443 Bacteria 2091
353 Ga0395901_0204463 3300038443 Bacteria 2069
354 Ga0395901_0661051 3300038443 Bacteria 1047
355 Ga0395901_1060819 3300038443 Bacteria 783
356 Ga0439466_0212130 3300041411 Bacteria 588
357 Ga0451843_0749099 3300041509 Bacteria 837
358 Ga0439448_0065145 3300042005 Bacteria 1208
359 Ga0439448_0088979 3300042005 Bacteria 1042
360 Ga0439432_048565 3300042006 Bacteria 1329
361 Ga0450914_004614 3300042118 Bacteria 1128
362 Ga0450920_015427 3300042122 Bacteria 1452
363 Ga0450898_085742 3300042134 Bacteria 645
364 Ga0466969_0001271 3300044656 Bacteria 13604
365 Ga0466969_0082351 3300044656 Bacteria 1534
366 Ga0466966_0000315 3300044684 Bacteria 31212
367 Ga0466966_0000612 3300044684 Bacteria 22647
368 Ga0466966_0031799 3300044684 Bacteria 3422
369 Ga0466961_0126306 3300044693 Bacteria 1604
370 Ga0466963_0178435 3300044694 Bacteria 1482
371 Ga0466971_0000428 3300044719 Bacteria 16425
372 Ga0466971_0037367 3300044719 Bacteria 2176
373 Ga0466970_0061881 3300044765 Bacteria 2006
374 Ga0466959_0013929 3300045049 Bacteria 5837
375 Ga0466959_0021941 3300045049 Bacteria 4715
376 Ga0466959_0400262 3300045049 Bacteria 933
377 Ga0466958_0000157 3300045836 Bacteria 23916
378 Ga0466967_0168524 3300045976 Bacteria 2059
379 Ga0466967_0261380 3300045976 Bacteria 1656
380 Ga0495585_0047459 3300046492 Bacteria 2392
381 Ga0495606_0510737 3300046507 Bacteria 605
382 Ga0495663_0004803 3300046525 Bacteria 3779
383 Ga0495598_0002775 3300046537 Bacteria 3643
384 Ga0495621_0000245 3300046539 Bacteria 12896
385 Ga0495633_0003100 3300046558 Bacteria 11282
386 Ga0495668_0044621 3300046616 Bacteria 2464
387 Ga0495669_0015678 3300046684 Bacteria 3245
388 Ga0495670_0025849 3300046691 Bacteria 2905
389 Ga0495677_0007435 3300047445 Bacteria 4095
390 Ga0495677_0225561 3300047445 Bacteria 730
391 Ga0496100_0001630 3300048903 Bacteria 11108
392 Ga0496103_0046638 3300048906 Bacteria 2676
393 Ga0496107_0116690 3300048910 Bacteria 1965
394 Ga0496108_0077882 3300048911 Bacteria 2805
395 Ga0496109_0164015 3300048912 Bacteria 2082
396 Ga0496110_0202144 3300048913 Bacteria 1805
397 Ga0496111_0301159 3300048914 Unclassified 1188
398 Ga0496112_0276600 3300048915 Bacteria 1626
399 Ga0496113_0078703 3300048916 Bacteria 2522
400 Ga0496114_0150943 3300048917 Bacteria 2016
401 Ga0496115_0024828 3300048918 Bacteria 4661
402 Ga0501224_003042 3300049664 Bacteria 2321
403 Ga0501235_090808 3300049669 Bacteria 737
404 Ga0501242_029524 3300049674 Bacteria 737
405 Ga0501249_117900 3300049679 Bacteria 646
406 Ga0501221_168731 3300049704 Bacteria 591
407 Ga0495612_0072488 3300053078 Bacteria 1438
408 Ga0466962_0006457 3300061719 Bacteria 5628
409 Ga0395901_0217353
410 JGI24736J21556_1041561
411 JGI24740J21852_10026657
412 JGI24035J26624_1036288
413 Ga0065712_10221706
414 Ga0065715_10142836
415 Ga0065715_10337724
416 Ga0070658_10000405
417 Ga0070658_10000781
418 Ga0070658_10021747
419 Ga0070658_10044962
420 Ga0070658_10048680
421 Ga0070658_10049178
422 Ga0070658_10148074
423 Ga0070658_10202942
424 Ga0070676_10393862
425 Ga0070683_100076233
426 Ga0070683_100468651
427 Ga0070690_100017929
428 Ga0070670_100136107
429 Ga0070670_100191400
430 Ga0070670_100368190
431 Ga0070677_10011002
432 Ga0070677_10020854
433 Ga0070680_100028742
434 Ga0070680_100130668
435 Ga0070680_100175960
436 Ga0070680_100207279
437 Ga0070680_100724871
438 Ga0070682_100124141
439 Ga0070660_100000194
440 Ga0070660_100036776
441 Ga0070660_100052162
442 Ga0070660_100060303
443 Ga0070660_100109271
444 Ga0070660_100252078
445 Ga0070691_10265387
446 Ga0070661_100038079
447 Ga0070661_100079514
448 Ga0070661_100361085
449 Ga0070661_100823909
450 Ga0070661_101318091
451 Ga0070692_10012066
452 Ga0070692_10016653
453 Ga0070692_10080504
454 Ga0070668_100130199
455 Ga0070669_100282736
456 Ga0070675_100005199
457 Ga0070675_100068461
458 Ga0070671_100079870
459 Ga0070674_100212294
460 Ga0070673_100126161
461 Ga0070673_100153250
462 Ga0070659_100011533
463 Ga0070659_100052003
464 Ga0070659_100213778
465 Ga0070659_100328830
466 Ga0070659_100334698
467 Ga0070659_100370034
468 Ga0070659_100481923
469 Ga0070659_101134161
470 Ga0070667_100163232
471 Ga0070663_100010487
472 Ga0070663_100143035
473 Ga0070678_100089503
474 Ga0070662_100007827
475 Ga0070662_100196609
476 Ga0070662_100629808
477 Ga0070681_10451968
478 Ga0070681_11003572
479 Ga0068867_100125804
480 Ga0070679_100485558
481 Ga0070684_100013895
482 Ga0070684_100497065
483 Ga0070684_101767269
484 Ga0068853_100266044
485 Ga0068853_100281636
486 Ga0068853_100469278
487 Ga0070672_100390400
488 Ga0070686_100042064
489 Ga0070696_100043762
490 Ga0070693_100346224
491 Ga0070665_100025405
492 Ga0068855_100001534
493 Ga0068855_100005402
494 Ga0068855_100366953
495 Ga0068855_101410642
496 Ga0070664_100167132
497 Ga0070664_100314366
498 Ga0068854_100080329
499 Ga0068854_100379823
500 Ga0068856_100040349
501 Ga0068852_100003939
502 Ga0068852_100032849
503 Ga0068852_100052233
504 Ga0068852_100120101
505 Ga0068852_100203709
506 Ga0068852_100273673
507 Ga0068859_100045260
508 Ga0068859_100339476
509 Ga0068864_100056191
510 Ga0068864_100124471
511 Ga0068866_10013193
512 Ga0068851_10044712
513 Ga0068863_100554575
514 Ga0068858_100098599
515 Ga0068858_100549377
516 Ga0068860_100361584
517 Ga0068862_100037534
518 Ga0068862_100175742
519 Ga0081539_10104480
520 Ga0097621_100222162
521 Ga0068865_100063406
522 Ga0097620_100045261
523 Ga0097620_100339488
524 Ga0105240_10025922
525 Ga0105245_10029483
526 Ga0105247_10171167
527 Ga0105243_10430271
528 Ga0105248_10543702
529 Ga0105237_10373666
530 Ga0105238_10215689
531 Ga0105238_10217959
532 Ga0105239_10833469
533 Ga0157373_10040621
534 Ga0157373_10046794
535 Ga0157373_10132488
536 Ga0157373_10489969
537 Ga0157371_10000915
538 Ga0157371_10062143
539 Ga0157371_10075734
540 Ga0157371_10350210
541 Ga0157371_10376224
542 Ga0157371_10602281
543 Ga0157370_10080854
544 Ga0157370_10273384
545 Ga0157370_10305110
546 Ga0157370_10784554
547 Ga0157370_10812321
548 Ga0157369_10000457
549 Ga0157369_10007383
550 Ga0157369_10016418
551 Ga0157374_10004629
552 Ga0157374_10723207
553 Ga0157378_10691718
554 Ga0157372_10296025
555 Ga0157372_10308587
556 Ga0157380_10233125
557 Ga0157380_10595977
558 Ga0157376_10119729
559 Ga0206354_10310964
560 Ga0207697_10008367
561 Ga0207656_10082936
562 Ga0207656_10138771
563 Ga0207682_10002626
564 Ga0207682_10036703
565 Ga0207682_10048684
566 Ga0207642_10468327
567 Ga0207688_10225046
568 Ga0207647_10012060
569 Ga0207647_10019837
570 Ga0207647_10248236
571 Ga0207647_10488623
572 Ga0207645_10018758
573 Ga0207645_10260620
574 Ga0207705_10000192
575 Ga0207705_10000276
576 Ga0207705_10000692
577 Ga0207705_10009275
578 Ga0207705_10028712
579 Ga0207705_10047161
580 Ga0207705_10056314
581 Ga0207705_10060060
582 Ga0207705_10065095
583 Ga0207705_10112449
584 Ga0207705_10196024
585 Ga0207707_10300467
586 Ga0207707_10616675
587 Ga0207707_10691829
588 Ga0207695_10124702
589 Ga0207657_10000218
590 Ga0207657_10001140
591 Ga0207657_10002119
592 Ga0207657_10006417
593 Ga0207657_10044206
594 Ga0207657_10111056
595 Ga0207649_10001340
596 Ga0207649_10178438
597 Ga0207649_10348094
598 Ga0207649_10719567
599 Ga0207649_10786287
600 Ga0207652_10029641
601 Ga0207652_10045606
602 Ga0207681_10028727
603 Ga0207694_10007706
604 Ga0207650_10141498
605 Ga0207650_10164015
606 Ga0207650_10361910
607 Ga0207659_10035092
608 Ga0207659_10060744
609 Ga0207687_10449818
610 Ga0207644_10023079
611 Ga0207690_10015551
612 Ga0207690_10109282
613 Ga0207690_10286833
614 Ga0207690_10325336
615 Ga0207690_10478000
616 Ga0207690_10849715
617 Ga0207706_10004392
618 Ga0207706_10063144
619 Ga0207706_10095708
620 Ga0207706_10347558
621 Ga0207669_10193511
622 Ga0207691_10069099
623 Ga0207691_10245113
624 Ga0207691_10528056
625 Ga0207691_10697175
626 Ga0207711_10081589
627 Ga0207711_10085287
628 Ga0207661_10165617
629 Ga0207661_10174154
630 Ga0207661_10327719
631 Ga0207679_10691496
632 Ga0207679_10832053
633 Ga0207667_10000122
634 Ga0207667_10008267
635 Ga0207667_10027779
636 Ga0207667_10124314
637 Ga0207667_10299034
638 Ga0207667_10352440
639 Ga0207651_10068468
640 Ga0207668_10177936
641 Ga0207640_10001597
642 Ga0207640_10040971
643 Ga0207640_10413196
644 Ga0207640_10770077
645 Ga0207658_10027886
646 Ga0207677_10014319
647 Ga0207703_10476544
648 Ga0207639_10548358
649 Ga0207639_10751482
650 Ga0207639_10754606
651 Ga0207678_10013354
652 Ga0207678_10029999
653 Ga0207678_10085620
654 Ga0207678_10371113
655 Ga0207678_10431450
656 Ga0207702_10004475
657 Ga0207702_10010676
658 Ga0207702_10237488
659 Ga0207702_10629440
660 Ga0207648_10646338
661 Ga0207676_10040159
662 Ga0207676_10062492
663 Ga0207675_100923449
664 Ga0207683_10002271
665 Ga0207683_10076011
666 Ga0207698_10006930
667 Ga0207698_10019546
668 Ga0207698_10523678
669 Ga0207698_10747557
670 Ga0209983_1019085
671 Ga0209971_1024982
672 Ga0268266_10262838
673 Ga0268265_10230459
674 Ga0268264_10259566
675 Ga0268264_11039363
676 Ga0307408_100233393
677 Ga0307408_100242648
678 Ga0307408_100551424
679 Ga0307408_100800672
680 Ga0307408_101021037
681 Ga0307405_10226509
682 Ga0307413_10129520
683 Ga0307413_10205477
684 Ga0307413_10651908
685 Ga0307410_10095783
686 Ga0307410_10123879
687 Ga0307410_10260712
688 Ga0307410_10550448
689 Ga0307412_10094899
690 Ga0307412_10357182
691 Ga0307412_10618582
692 Ga0307409_100075150
693 Ga0307409_100250299
694 Ga0307409_100286518
695 Ga0307409_100366582
696 Ga0307409_100676145
697 Ga0307409_101215207
698 Ga0307416_100313589
699 Ga0307416_100555081
700 Ga0307416_101446755
701 Ga0307414_10002379
702 Ga0307414_10470497
703 Ga0307414_10472906
704 Ga0307414_10493966
705 Ga0307411_10005600
706 Ga0307411_10008125
707 Ga0307411_10031057
708 Ga0307411_10068559
709 Ga0307411_10103433
710 Ga0307411_10467042
711 Ga0307411_10959863
712 Ga0307411_11076260
713 Ga0307415_100118066
714 Ga0307415_100228722
715 Ga0307415_100291426
716 Ga0307415_100368540
717 Ga0307415_100588029
718 Ga0373959_0141107
719 Ga0373954_0326885
720 Ga0373956_0027984
721 Ga0373957_0164329
722 Ga0373955_0012289
723 Ga0373931_0269377
724 Ga0373933_0134963
725 Ga0373937_0016802
726 Ga0395899_0005230
727 Ga0395899_0024242
728 Ga0395899_0108638
729 Ga0395899_0126964
730 Ga0395899_0247912
731 Ga0395899_0272267
732 Ga0395899_0282592
733 Ga0395899_0378750
734 Ga0395900_0001684
735 Ga0395900_0017863
736 Ga0395900_0107699
737 Ga0395900_0508805
738 Ga0395900_0514160
739 Ga0395900_0582864
740 Ga0395898_0020031
741 Ga0395898_0054992
742 Ga0395898_0201363
743 Ga0395898_0212243
744 Ga0395898_0310025
745 Ga0395905_0001994
746 Ga0395905_0029530
747 Ga0395905_0085827
748 Ga0395905_0173696
749 Ga0395905_0192737
750 Ga0395905_0200886
751 Ga0395905_0326197
752 Ga0395905_0754715
753 Ga0395905_1307617
754 Ga0395901_0000047
755 Ga0395901_0004115
756 Ga0395901_0034327
757 Ga0395901_0035156
758 Ga0395901_0039811
759 Ga0395901_0048918
760 Ga0395901_0200551
761 Ga0395901_0204463
762 Ga0395901_0661051
763 Ga0395901_1060819
764 Ga0439466_0212130
765 Ga0451843_0749099
766 Ga0439448_0065145
767 Ga0439448_0088979
768 Ga0439432_048565
769 Ga0450914_004614
770 Ga0450920_015427
771 Ga0450898_085742
772 Ga0466969_0001271
773 Ga0466969_0082351
774 Ga0466966_0000315
775 Ga0466966_0000612
776 Ga0466966_0031799
777 Ga0466961_0126306
778 Ga0466963_0178435
779 Ga0466971_0000428
780 Ga0466971_0037367
781 Ga0466970_0061881
782 Ga0466959_0013929
783 Ga0466959_0021941
784 Ga0466959_0400262
785 Ga0466958_0000157
786 Ga0466967_0168524
787 Ga0466967_0261380
788 Ga0495585_0047459
789 Ga0495606_0510737
790 Ga0495663_0004803
791 Ga0495598_0002775
792 Ga0495621_0000245
793 Ga0495633_0003100
794 Ga0495668_0044621
795 Ga0495669_0015678
796 Ga0495670_0025849
797 Ga0495677_0007435
798 Ga0495677_0225561
799 Ga0496100_0001630
800 Ga0496103_0046638
801 Ga0496107_0116690
802 Ga0496108_0077882
803 Ga0496109_0164015
804 Ga0496110_0202144
805 Ga0496111_0301159
806 Ga0496112_0276600
807 Ga0496113_0078703
808 Ga0496114_0150943
809 Ga0496115_0024828
810 Ga0501224_003042
811 Ga0501235_090808
812 Ga0501242_029524
813 Ga0501249_117900
814 Ga0501221_168731
815 Ga0495612_0072488
816 Ga0466962_0006457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

49

192

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8823 7 152
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8659 4 149
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8601 7 152
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8472 7 151
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8406 4 148
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8886 11 152 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8712 11 152 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8309 11 152 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8147 11 152 3.90.1420.10
af_B6TC68_118_236_1.20.120.900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Pex19, mPTS binding domain 0.8059 66 113 1.20.120.900
ID Description Score Start End GO Terms
AF-A0A4R6FSJ9-F1-model_v4 deleted 0.9751 1 157
AF-A0A1X7GFX9-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9727 2 162 GO:0004190
GO:0005886
GO:0006508
AF-A0A351T5B3-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.971 1 152 GO:0004190
GO:0005886
GO:0006508
AF-A0A7Y2BRD3-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.968 2 156 GO:0004190
GO:0005886
GO:0006508
AF-A0A558R4Y0-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.967 2 166 GO:0004190
GO:0005886
GO:0006508

Map