F436728

General Info

Members Datasets Scaffolds Average Seq Length
408 170 400 293

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10125082|Ga0182008_101250821
Length 313
Sequence LGKFIGGGIIGLLLKIDKMLMSDQSVFTIVNRQNGNLAFKLLWFDDNSYFDHIQRNNYYSLIWIRNGSGIVTADFSEHNFEKGSLFAFSPYQPFMVATKEKLGGIAFQFHPDFFCIHKHHKEVACHGVLFNNIYEPPFVRVSEAAASTFGMLAENMKTELQNPELAGYELLVSYLKIFLITASRLRKEERGAVLPVSIYEKTPFVLQRLKEAIETDFRKRHAARDYAEALSISVKALAKITKRYFNKTPTELISERIVIEAKRELYLTNKTIKEIAYELGYDDEYYFSRFFKINTDISPQTYRDTVGFAKGVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
6 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
7 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
8 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
126 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
169 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
170 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0.25
Rhizoplane 1.23
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1596339 2162886007 Bacteria 98699
2 SwRhRL2b_contig_674713 2162886007 Bacteria 1151
3 MRS1b_contig_3726434 2162886011 Bacteria 1195
4 rootH2_10042807 3300003320 Bacteria 5922
5 rootL2_10351168 3300003322 Bacteria 2358
6 Ga0055531_10000198 3300003794 Bacteria 66737
7 Ga0065714_10006592 3300005288 Bacteria 3226
8 Ga0065714_10010546 3300005288 Bacteria 4998
9 Ga0065704_10070168 3300005289 Bacteria 171820
10 Ga0065704_10099580 3300005289 Bacteria 2306
11 Ga0065712_10093760 3300005290 Unclassified 2280
12 Ga0065712_10104964 3300005290 Bacteria 1949
13 Ga0065715_10091999 3300005293 Bacteria 5401
14 Ga0070676_10179801 3300005328 Bacteria 1374
15 Ga0070676_10206497 3300005328 Bacteria 1290
16 Ga0070683_100007310 3300005329 Bacteria 9322
17 Ga0070683_100050606 3300005329 Bacteria 3847
18 Ga0070690_100042808 3300005330 Bacteria 2869
19 Ga0070690_100045249 3300005330 Bacteria 2795
20 Ga0070670_100077608 3300005331 Bacteria 2853
21 Ga0070670_100095989 3300005331 Bacteria 2550
22 Ga0070670_100287883 3300005331 Bacteria 1435
23 Ga0070670_100359025 3300005331 Bacteria 1281
24 Ga0070670_100363321 3300005331 Unclassified 1273
25 Ga0068869_100003957 3300005334 Bacteria 9153
26 Ga0068869_100008954 3300005334 Bacteria 6480
27 Ga0068869_100184480 3300005334 Bacteria 1637
28 Ga0070666_10018913 3300005335 Bacteria 4439
29 Ga0070666_10059260 3300005335 Bacteria 2589
30 Ga0070666_10124771 3300005335 Bacteria 1787
31 Ga0068868_100015211 3300005338 Bacteria 5686
32 Ga0068868_100028880 3300005338 Bacteria 4245
33 Ga0068868_100061953 3300005338 Bacteria 2964
34 Ga0068868_100512383 3300005338 Bacteria 1052
35 Ga0070689_100023427 3300005340 Bacteria 4621
36 Ga0070689_100027880 3300005340 Bacteria 4262
37 Ga0070689_100035427 3300005340 Bacteria 3814
38 Ga0070687_100009976 3300005343 Bacteria 4086
39 Ga0070661_100002275 3300005344 Bacteria 13179
40 Ga0070661_100007764 3300005344 Bacteria 7401
41 Ga0070661_100011673 3300005344 Bacteria 6125
42 Ga0070661_100449871 3300005344 Bacteria 1025
43 Ga0070668_100039768 3300005347 Bacteria 3597
44 Ga0070668_100176527 3300005347 Bacteria 1742
45 Ga0070669_100010774 3300005353 Bacteria 6490
46 Ga0070669_100108812 3300005353 Bacteria 2101
47 Ga0070669_100534671 3300005353 Unclassified 976
48 Ga0070675_100021634 3300005354 Bacteria 5139
49 Ga0070675_100030175 3300005354 Bacteria 4375
50 Ga0070675_100076198 3300005354 Bacteria 2789
51 Ga0070675_100275857 3300005354 Bacteria 1476
52 Ga0070671_100030398 3300005355 Bacteria 4457
53 Ga0070671_100030845 3300005355 Unclassified 4425
54 Ga0070671_100141692 3300005355 Bacteria 2029
55 Ga0070674_100026888 3300005356 Bacteria 3765
56 Ga0070674_100315756 3300005356 Bacteria 1251
57 Ga0070673_100025786 3300005364 Bacteria 4332
58 Ga0070673_100046874 3300005364 Unclassified 3359
59 Ga0070673_100046963 3300005364 Bacteria 3357
60 Ga0070688_100002392 3300005365 Bacteria 9476
61 Ga0070688_100008249 3300005365 Bacteria 5648
62 Ga0070688_100010018 3300005365 Bacteria 5207
63 Ga0070688_100045490 3300005365 Unclassified 2712
64 Ga0070659_100078053 3300005366 Bacteria 2642
65 Ga0070667_100013142 3300005367 Bacteria 6844
66 Ga0070667_100016120 3300005367 Bacteria 6182
67 Ga0070667_100076597 3300005367 Bacteria 2856
68 Ga0070667_100110703 3300005367 Unclassified 2381
69 Ga0070667_100120878 3300005367 Bacteria 2278
70 Ga0070678_100174440 3300005456 Bacteria 1754
71 Ga0070678_100191282 3300005456 Bacteria 1683
72 Ga0070662_100007885 3300005457 Bacteria 6919
73 Ga0070662_100011594 3300005457 Bacteria 5818
74 Ga0070662_100103171 3300005457 Bacteria 2162
75 Ga0068867_100006733 3300005459 Bacteria 8122
76 Ga0068867_100068315 3300005459 Bacteria 2652
77 Ga0068867_100223398 3300005459 Bacteria 1519
78 Ga0068867_100322198 3300005459 Bacteria 1281
79 Ga0070698_100018562 3300005471 Bacteria 7322
80 Ga0070684_100001704 3300005535 Bacteria 16004
81 Ga0070684_100023837 3300005535 Bacteria 5126
82 Ga0070684_100026672 3300005535 Unclassified 4869
83 Ga0070684_100083739 3300005535 Bacteria 2826
84 Ga0068853_100526380 3300005539 Bacteria 1118
85 Ga0070672_100020447 3300005543 Bacteria 4828
86 Ga0070672_100092390 3300005543 Bacteria 2443
87 Ga0070686_100101776 3300005544 Unclassified 1942
88 Ga0068855_100629745 3300005563 Bacteria 1154
89 Ga0070664_100004400 3300005564 Bacteria 11316
90 Ga0070664_100027144 3300005564 Unclassified 4757
91 Ga0070664_100104422 3300005564 Bacteria 2467
92 Ga0068857_100007290 3300005577 Bacteria 9524
93 Ga0068857_100173811 3300005577 Bacteria 1959
94 Ga0068852_100064686 3300005616 Bacteria 3189
95 Ga0068852_100157208 3300005616 Bacteria 2119
96 Ga0068852_100167902 3300005616 Unclassified 2054
97 Ga0068859_100003346 3300005617 Bacteria 16312
98 Ga0068859_100005938 3300005617 Bacteria 12396
99 Ga0068859_100006389 3300005617 Bacteria 11958
100 Ga0068859_100012004 3300005617 Bacteria 8702
101 Ga0068859_100103039 3300005617 Bacteria 2912
102 Ga0068859_100116801 3300005617 Bacteria 2733
103 Ga0068859_100167042 3300005617 Unclassified 2280
104 Ga0068859_100467642 3300005617 Bacteria 1357
105 Ga0068864_100025093 3300005618 Bacteria 5018
106 Ga0068864_100199666 3300005618 Bacteria 1836
107 Ga0068864_100290520 3300005618 Bacteria 1528
108 Ga0068864_100329058 3300005618 Bacteria 1437
109 Ga0068866_10170163 3300005718 Bacteria 1278
110 Ga0068866_10210165 3300005718 Bacteria 1168
111 Ga0068861_100325600 3300005719 Bacteria 1340
112 Ga0068870_10018887 3300005840 Bacteria 3336
113 Ga0068863_100001806 3300005841 Bacteria 21231
114 Ga0068863_100023879 3300005841 Bacteria 5835
115 Ga0068863_100038687 3300005841 Bacteria 4537
116 Ga0068863_100061895 3300005841 Unclassified 3539
117 Ga0068863_100789845 3300005841 Viruses 947
118 Ga0068858_100007207 3300005842 Bacteria 10780
119 Ga0068858_100122853 3300005842 Bacteria 2429
120 Ga0068858_100459283 3300005842 Unclassified 1228
121 Ga0068860_100275890 3300005843 Unclassified 1642
122 Ga0068860_100323284 3300005843 Unclassified 1514
123 Ga0068860_100598624 3300005843 Bacteria 1108
124 Ga0068862_100008288 3300005844 Bacteria 8600
125 Ga0068862_100072076 3300005844 Bacteria 2983
126 Ga0068862_100279519 3300005844 Bacteria 1529
127 Ga0068862_100521394 3300005844 Bacteria 1131
128 Ga0075366_10001251 3300006195 Bacteria 12603
129 Ga0097621_100000730 3300006237 Bacteria 22991
130 Ga0097621_100008252 3300006237 Bacteria 7493
131 Ga0097621_100075713 3300006237 Bacteria 2790
132 Ga0097621_100098155 3300006237 Unclassified 2460
133 Ga0097621_100178662 3300006237 Bacteria 1833
134 Ga0068871_100001108 3300006358 Bacteria 18066
135 Ga0068871_100006473 3300006358 Bacteria 8288
136 Ga0068871_100056914 3300006358 Bacteria 3180
137 Ga0068871_100070827 3300006358 Bacteria 2866
138 Ga0068871_100076027 3300006358 Bacteria 2773
139 Ga0068871_100095104 3300006358 Bacteria 2487
140 Ga0068871_100342099 3300006358 Bacteria 1321
141 Ga0097620_100003346 3300006931 Bacteria 16312
142 Ga0097620_100005935 3300006931 Bacteria 12396
143 Ga0097620_100006389 3300006931 Bacteria 11958
144 Ga0097620_100012005 3300006931 Bacteria 8702
145 Ga0097620_100103042 3300006931 Bacteria 2912
146 Ga0097620_100116791 3300006931 Bacteria 2733
147 Ga0097620_100167041 3300006931 Unclassified 2280
148 Ga0097620_100467639 3300006931 Bacteria 1357
149 Ga0099824_1000108 3300006942 Bacteria 66974
150 Ga0105251_10107043 3300009011 Bacteria 1276
151 Ga0105241_10119776 3300009174 Bacteria 2118
152 Ga0105242_10006625 3300009176 Bacteria 8928
153 Ga0105242_10026503 3300009176 Bacteria 4595
154 Ga0105242_10081751 3300009176 Bacteria 2702
155 Ga0105242_10094287 3300009176 Bacteria 2525
156 Ga0105242_10281258 3300009176 Bacteria 1511
157 Ga0105248_10033655 3300009177 Bacteria 5726
158 Ga0105248_10133731 3300009177 Unclassified 2798
159 Ga0105237_10164508 3300009545 Bacteria 2217
160 Ga0105237_10301479 3300009545 Bacteria 1605
161 Ga0105249_10018002 3300009553 Bacteria 6279
162 Ga0105249_10023287 3300009553 Bacteria 5556
163 Ga0105249_10068920 3300009553 Bacteria 3263
164 Ga0105249_10077516 3300009553 Bacteria 3082
165 Ga0105249_10229072 3300009553 Bacteria 1832
166 Ga0105249_10230541 3300009553 Unclassified 1826
167 Ga0105249_10302303 3300009553 Bacteria 1605
168 Ga0105249_10543237 3300009553 Bacteria 1212
169 Ga0105239_10000006 3300010375 Bacteria 442319
170 Ga0105239_10083418 3300010375 Bacteria 3520
171 Ga0105239_10101543 3300010375 Bacteria 3182
172 Ga0105239_10246518 3300010375 Bacteria 2006
173 Ga0105246_10035524 3300011119 Bacteria 3332
174 Ga0105246_10158472 3300011119 Bacteria 1722
175 Ga0105246_10205017 3300011119 Unclassified 1536
176 Ga0157373_10000026 3300013100 Bacteria 139930
177 Ga0157373_10000048 3300013100 Bacteria 110104
178 Ga0157373_10120129 3300013100 Bacteria 1847
179 Ga0157373_10240661 3300013100 Bacteria 1279
180 Ga0157371_10016459 3300013102 Bacteria 5518
181 Ga0157370_10001765 3300013104 Bacteria 26690
182 Ga0157370_10011251 3300013104 Bacteria 9381
183 Ga0157374_10001456 3300013296 Bacteria 20010
184 Ga0157374_10008082 3300013296 Bacteria 8994
185 Ga0157374_10009524 3300013296 Bacteria 8340
186 Ga0157374_10016256 3300013296 Bacteria 6539
187 Ga0157374_10134192 3300013296 Bacteria 2398
188 Ga0157378_10005638 3300013297 Bacteria 10969
189 Ga0157378_10020597 3300013297 Bacteria 5800
190 Ga0157378_10082072 3300013297 Bacteria 2915
191 Ga0157378_10092804 3300013297 Bacteria 2747
192 Ga0163162_10001942 3300013306 Bacteria 19416
193 Ga0163162_10002198 3300013306 Bacteria 18310
194 Ga0163162_10005199 3300013306 Bacteria 12550
195 Ga0163162_10007669 3300013306 Bacteria 10508
196 Ga0163162_10025063 3300013306 Bacteria 5894
197 Ga0163162_10109443 3300013306 Bacteria 2860
198 Ga0163162_10127572 3300013306 Bacteria 2651
199 Ga0163162_10384029 3300013306 Bacteria 1538
200 Ga0163162_10482370 3300013306 Bacteria 1371
201 Ga0157372_10404895 3300013307 Bacteria 1590
202 Ga0157375_10001463 3300013308 Bacteria 20315
203 Ga0157375_10002097 3300013308 Bacteria 17213
204 Ga0157375_10005334 3300013308 Bacteria 11170
205 Ga0157375_10060082 3300013308 Bacteria 3768
206 Ga0157375_10100439 3300013308 Unclassified 2974
207 Ga0157375_10116860 3300013308 Bacteria 2772
208 Ga0157375_10150935 3300013308 Bacteria 2459
209 Ga0163163_10000498 3300014325 Bacteria 35378
210 Ga0163163_10001802 3300014325 Bacteria 18058
211 Ga0163163_10018283 3300014325 Bacteria 6556
212 Ga0163163_10068845 3300014325 Bacteria 3523
213 Ga0163163_10130935 3300014325 Unclassified 2549
214 Ga0163163_10181029 3300014325 Bacteria 2155
215 Ga0163163_10637515 3300014325 Bacteria 1129
216 Ga0157380_10004127 3300014326 Bacteria 10035
217 Ga0157380_10059102 3300014326 Bacteria 3058
218 Ga0157380_10201018 3300014326 Bacteria 1768
219 Ga0182008_10000452 3300014497 Bacteria 31325
220 Ga0182008_10125082 3300014497 Unclassified 1280
221 Ga0157377_10008786 3300014745 Bacteria 4939
222 Ga0157377_10038298 3300014745 Bacteria 2646
223 Ga0157377_10065872 3300014745 Bacteria 2082
224 Ga0157377_10069544 3300014745 Bacteria 2032
225 Ga0157377_10153233 3300014745 Unclassified 1427
226 Ga0157379_10009870 3300014968 Bacteria 8314
227 Ga0157379_10019981 3300014968 Bacteria 5919
228 Ga0157379_10030528 3300014968 Bacteria 4798
229 Ga0157379_10075663 3300014968 Bacteria 3015
230 Ga0157376_10000944 3300014969 Bacteria 18916
231 Ga0157376_10029802 3300014969 Bacteria 4350
232 Ga0157376_10033069 3300014969 Bacteria 4159
233 Ga0157376_10055354 3300014969 Bacteria 3309
234 Ga0157376_10074219 3300014969 Bacteria 2899
235 Ga0157376_10106752 3300014969 Unclassified 2457
236 Ga0157376_10123756 3300014969 Bacteria 2296
237 Ga0157376_10131997 3300014969 Bacteria 2230
238 Ga0157376_10142190 3300014969 Unclassified 2154
239 Ga0182006_1006710 3300015261 Bacteria 5319
240 Ga0163161_10000235 3300017792 Bacteria 51172
241 Ga0163161_10011840 3300017792 Bacteria 6050
242 Ga0163161_10013460 3300017792 Bacteria 5694
243 Ga0163161_10013973 3300017792 Bacteria 5590
244 Ga0163161_10030545 3300017792 Bacteria 3836
245 Ga0163161_10035966 3300017792 Bacteria 3545
246 Ga0163161_10073133 3300017792 Unclassified 2511
247 Ga0163161_10088347 3300017792 Bacteria 2291
248 Ga0209026_1000612 3300025250 Bacteria 22906
249 Ga0209026_1001863 3300025250 Bacteria 8604
250 Ga0209129_1024081 3300025258 Unclassified 1076
251 Ga0209257_1000008 3300025304 Bacteria 1294570
252 Ga0207697_10041197 3300025315 Bacteria 1897
253 Ga0207697_10133959 3300025315 Bacteria 1072
254 Ga0207680_10022080 3300025903 Bacteria 3456
255 Ga0207647_10009346 3300025904 Bacteria 6968
256 Ga0207647_10009716 3300025904 Bacteria 6825
257 Ga0207643_10005351 3300025908 Bacteria 6869
258 Ga0207643_10032327 3300025908 Bacteria 2922
259 Ga0207695_10229591 3300025913 Bacteria 1761
260 Ga0207662_10010275 3300025918 Bacteria 5166
261 Ga0207649_10072243 3300025920 Bacteria 2207
262 Ga0207650_10008134 3300025925 Bacteria 7148
263 Ga0207650_10015433 3300025925 Bacteria 5320
264 Ga0207650_10055730 3300025925 Bacteria 2935
265 Ga0207650_10068601 3300025925 Bacteria 2663
266 Ga0207650_10490743 3300025925 Bacteria 1026
267 Ga0207659_10072543 3300025926 Bacteria 2517
268 Ga0207659_10264863 3300025926 Bacteria 1400
269 Ga0207644_10012190 3300025931 Bacteria 5704
270 Ga0207644_10039791 3300025931 Bacteria 3320
271 Ga0207690_10316050 3300025932 Bacteria 1226
272 Ga0207706_10009970 3300025933 Bacteria 8708
273 Ga0207706_10032169 3300025933 Bacteria 4671
274 Ga0207706_10187301 3300025933 Bacteria 1817
275 Ga0207686_10012546 3300025934 Bacteria 4660
276 Ga0207686_10014504 3300025934 Bacteria 4388
277 Ga0207670_10011054 3300025936 Bacteria 5224
278 Ga0207670_10013025 3300025936 Bacteria 4890
279 Ga0207670_10056391 3300025936 Bacteria 2659
280 Ga0207669_10054869 3300025937 Bacteria 2410
281 Ga0207691_10034529 3300025940 Bacteria 4702
282 Ga0207691_10138339 3300025940 Bacteria 2147
283 Ga0207691_10283202 3300025940 Unclassified 1426
284 Ga0207711_10023254 3300025941 Bacteria 5187
285 Ga0207711_10245672 3300025941 Unclassified 1642
286 Ga0207689_10003767 3300025942 Bacteria 13815
287 Ga0207689_10004950 3300025942 Bacteria 12000
288 Ga0207689_10010093 3300025942 Bacteria 8140
289 Ga0207689_10014840 3300025942 Bacteria 6613
290 Ga0207661_10030966 3300025944 Bacteria 4127
291 Ga0207661_10050778 3300025944 Unclassified 3306
292 Ga0207661_10241963 3300025944 Bacteria 1601
293 Ga0207661_10261592 3300025944 Bacteria 1541
294 Ga0207661_10365582 3300025944 Bacteria 1304
295 Ga0207679_10006721 3300025945 Bacteria 7284
296 Ga0207679_10052361 3300025945 Bacteria 2993
297 Ga0207679_10091769 3300025945 Bacteria 2351
298 Ga0207679_10239830 3300025945 Bacteria 1536
299 Ga0207651_10033712 3300025960 Unclassified 3306
300 Ga0207651_10055346 3300025960 Bacteria 2724
301 Ga0207651_10176758 3300025960 Bacteria 1689
302 Ga0207651_10264087 3300025960 Unclassified 1415
303 Ga0207712_10008917 3300025961 Bacteria 6342
304 Ga0207712_10018771 3300025961 Bacteria 4509
305 Ga0207712_10021908 3300025961 Bacteria 4200
306 Ga0207712_10038489 3300025961 Bacteria 3271
307 Ga0207668_10129634 3300025972 Bacteria 1924
308 Ga0207658_10020725 3300025986 Unclassified 4554
309 Ga0207658_10047963 3300025986 Bacteria 3129
310 Ga0207658_10107895 3300025986 Bacteria 2195
311 Ga0207677_10026111 3300026023 Bacteria 3657
312 Ga0207677_10028527 3300026023 Bacteria 3532
313 Ga0207677_10053189 3300026023 Bacteria 2755
314 Ga0207677_10417438 3300026023 Bacteria 1142
315 Ga0207703_10049113 3300026035 Bacteria 3410
316 Ga0207703_10323469 3300026035 Unclassified 1413
317 Ga0207703_10400614 3300026035 Bacteria 1273
318 Ga0207639_10350456 3300026041 Unclassified 1318
319 Ga0207639_10414337 3300026041 Bacteria 1217
320 Ga0207639_10421541 3300026041 Bacteria 1207
321 Ga0207678_10021730 3300026067 Bacteria 5628
322 Ga0207708_10050332 3300026075 Bacteria 3171
323 Ga0207708_10146885 3300026075 Bacteria 1853
324 Ga0207708_10169500 3300026075 Bacteria 1728
325 Ga0207641_10000213 3300026088 Bacteria 75051
326 Ga0207641_10000391 3300026088 Bacteria 51728
327 Ga0207641_10162681 3300026088 Bacteria 2030
328 Ga0207641_10412189 3300026088 Bacteria 1299
329 Ga0207648_10011770 3300026089 Bacteria 8223
330 Ga0207648_10052104 3300026089 Bacteria 3578
331 Ga0207648_10069180 3300026089 Bacteria 3076
332 Ga0207648_10099911 3300026089 Unclassified 2541
333 Ga0207648_10134789 3300026089 Bacteria 2175
334 Ga0207648_10373445 3300026089 Bacteria 1288
335 Ga0207676_10009334 3300026095 Bacteria 6980
336 Ga0207676_10011051 3300026095 Bacteria 6442
337 Ga0207676_10020461 3300026095 Bacteria 4842
338 Ga0207676_10178075 3300026095 Bacteria 1859
339 Ga0207676_10287555 3300026095 Bacteria 1495
340 Ga0207674_10005755 3300026116 Bacteria 14710
341 Ga0207674_10046605 3300026116 Bacteria 4450
342 Ga0207674_10068062 3300026116 Bacteria 3584
343 Ga0207674_10121273 3300026116 Bacteria 2582
344 Ga0207675_100022651 3300026118 Bacteria 5847
345 Ga0207675_100277464 3300026118 Unclassified 1628
346 Ga0207683_10249278 3300026121 Bacteria 1620
347 Ga0207683_10292358 3300026121 Bacteria 1490
348 Ga0268265_10027841 3300028380 Bacteria 4039
349 Ga0268265_10384221 3300028380 Bacteria 1293
350 Ga0268265_10465211 3300028380 Bacteria 1184
351 Ga0268265_10489006 3300028380 Unclassified 1157
352 Ga0268264_10037934 3300028381 Bacteria 3974
353 Ga0316177_1078208 3300030731 Bacteria 4238
354 Ga0316176_1124656 3300030732 Bacteria 38772
355 Ga0265327_10000207 3300031251 Bacteria 123193
356 Ga0307413_10098218 3300031824 Bacteria 1927
357 Ga0307414_10025301 3300032004 Bacteria 3800
358 Ga0307414_10162086 3300032004 Bacteria 1777
359 Ga0373955_0027696 3300035172 Bacteria 2933
360 Ga0373935_0194658 3300035692 Bacteria 1398
361 Ga0373937_0012356 3300036401 Bacteria 7509
362 Ga0373937_0617997 3300036401 Bacteria 1028
363 Ga0373925_0135238 3300037068 Unclassified 1926
364 Ga0451802_1309639 3300041460 Bacteria 1470
365 Ga0451853_1422469 3300041512 Bacteria 2264
366 Ga0439441_004633 3300042001 Bacteria 2094
367 Ga0439457_002466 3300042014 Bacteria 5276
368 Ga0439462_0011842 3300042015 Bacteria 2224
369 Ga0451577_0060431 3300042876 Bacteria 3379
370 Ga0453683_0024682 3300044673 Bacteria 3822
371 Ga0453684_0001542 3300044712 Bacteria 64357
372 Ga0451576_0016888 3300045051 Bacteria 8040
373 Ga0495638_0000008 3300046460 Bacteria 565643
374 Ga0495650_0006109 3300046471 Bacteria 7588
375 Ga0495662_0138670 3300046476 Bacteria 1197
376 Ga0495585_0154695 3300046492 Unclassified 1194
377 Ga0495608_0224049 3300046511 Bacteria 1179
378 Ga0495618_0134412 3300046514 Bacteria 1582
379 Ga0495628_0023646 3300046516 Bacteria 5042
380 Ga0495630_0009510 3300046517 Bacteria 6992
381 Ga0495652_0188698 3300046529 Bacteria 1575
382 Ga0495640_0401009 3300046533 Viruses 842
383 Ga0495634_0061278 3300046642 Bacteria 2501
384 Ga0495599_0089699 3300046678 Bacteria 1919
385 Ga0495674_0025531 3300047319 Bacteria 5416
386 Ga0495680_0114570 3300047322 Bacteria 1995
387 Ga0495684_0011350 3300047471 Bacteria 6878
388 Ga0495686_0033652 3300047472 Bacteria 3307
389 Ga0496101_0018594 3300048904 Bacteria 4728
390 Ga0496110_0029502 3300048913 Bacteria 4722
391 Ga0496112_0072575 3300048915 Unclassified 3403
392 Ga0496114_0188466 3300048917 Bacteria 1804
393 Ga0496126_0016120 3300048929 Bacteria 7488
394 Ga0496126_0020780 3300048929 Bacteria 6427
395 Ga0501241_002453 3300049758 Bacteria 3588
396 nmdc:mga0k408_1778_c1 3300050493 Bacteria 11562
397 Ga0495619_0008622 3300053085 Bacteria 6450
398 Ga0500616_0000004 3300053153 Bacteria 1002714
399 Ga0500616_0010252 3300053153 Bacteria 5619
400 Ga0500611_000167 3300053727 Bacteria 9605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0188466 Ga0496114_0188466_681_1430 248
2 3300035172 Ga0373955_0027696 Ga0373955_0027696_2117_2869 249
3 3300046533 Ga0495640_0401009 Ga0495640_0401009_60_812 249
4 3300013100 Ga0157373_10120129 Ga0157373_101201293 259
5 3300005328 Ga0070676_10179801 Ga0070676_101798012 272
6 3300005347 Ga0070668_100176527 Ga0070668_1001765272 276
7 3300005367 Ga0070667_100076597 Ga0070667_1000765971 276
8 3300005617 Ga0068859_100103039 Ga0068859_1001030392 276
9 3300005618 Ga0068864_100290520 Ga0068864_1002905202 276
10 3300005844 Ga0068862_100072076 Ga0068862_1000720762 276
11 3300006931 Ga0097620_100103042 Ga0097620_1001030424 276
12 3300026095 Ga0207676_10178075 Ga0207676_101780752 276
13 3300028381 Ga0268264_10037934 Ga0268264_100379346 276
14 3300031251 Ga0265327_10000207 Ga0265327_10000207104 285
15 3300009176 Ga0105242_10094287 Ga0105242_100942874 286
16 3300025936 Ga0207670_10013025 Ga0207670_100130254 287
17 3300025960 Ga0207651_10033712 Ga0207651_100337123 287
18 iso_pu_bacteria 2881359912 2881363950 288
19 iso_pu_bacteria 2993372514 2993375343 288
20 iso_pu_bacteria 8055592153 8055595863 288
21 3300032004 Ga0307414_10025301 Ga0307414_100253013 289
22 3300049758 Ga0501241_002453 Ga0501241_002453_1761_2633 289
23 iso_pu_bacteria 2588254257 2590612386 289
24 iso_pu_bacteria 2643221600 2644011266 289
25 iso_pu_bacteria 2739367874 2740057295 289
26 iso_pu_bacteria 2904555929 2904556975 289
27 iso_pu_bacteria 8003151029 8003152600 289
28 3300046460 Ga0495638_0000008 Ga0495638_0000008_174537_175409 290
29 3300053153 Ga0500616_0000004 Ga0500616_0000004_101019_101891 290
30 3300031824 Ga0307413_10098218 Ga0307413_100982182 291
31 3300044712 Ga0453684_0001542 Ga0453684_0001542_18416_19291 291
32 3300047472 Ga0495686_0033652 Ga0495686_0033652_1963_2838 291
33 2162886011 MRS1b_contig_3726434 MRS1b_0763.00000740 292
34 3300005290 Ga0065712_10093760 Ga0065712_100937602 292
35 3300005290 Ga0065712_10104964 Ga0065712_101049641 292
36 3300005293 Ga0065715_10091999 Ga0065715_100919991 292
37 3300005328 Ga0070676_10206497 Ga0070676_102064972 292
38 3300005329 Ga0070683_100007310 Ga0070683_1000073104 292
39 3300005329 Ga0070683_100050606 Ga0070683_1000506062 292
40 3300005330 Ga0070690_100042808 Ga0070690_1000428082 292
41 3300005330 Ga0070690_100045249 Ga0070690_1000452492 292
42 3300005331 Ga0070670_100077608 Ga0070670_1000776085 292
43 3300005331 Ga0070670_100095989 Ga0070670_1000959892 292
44 3300005331 Ga0070670_100287883 Ga0070670_1002878832 292
45 3300005331 Ga0070670_100359025 Ga0070670_1003590252 292
46 3300005331 Ga0070670_100363321 Ga0070670_1003633211 292
47 3300005334 Ga0068869_100003957 Ga0068869_1000039571 292
48 3300005334 Ga0068869_100008954 Ga0068869_1000089545 292
49 3300005334 Ga0068869_100184480 Ga0068869_1001844802 292
50 3300005335 Ga0070666_10018913 Ga0070666_100189135 292
51 3300005335 Ga0070666_10059260 Ga0070666_100592604 292
52 3300005338 Ga0068868_100015211 Ga0068868_1000152114 292
53 3300005338 Ga0068868_100028880 Ga0068868_1000288802 292
54 3300005338 Ga0068868_100061953 Ga0068868_1000619532 292
55 3300005338 Ga0068868_100512383 Ga0068868_1005123831 292
56 3300005340 Ga0070689_100023427 Ga0070689_1000234271 292
57 3300005340 Ga0070689_100027880 Ga0070689_1000278803 292
58 3300005340 Ga0070689_100035427 Ga0070689_1000354272 292
59 3300005343 Ga0070687_100009976 Ga0070687_1000099762 292
60 3300005344 Ga0070661_100002275 Ga0070661_1000022751 292
61 3300005344 Ga0070661_100007764 Ga0070661_1000077644 292
62 3300005344 Ga0070661_100011673 Ga0070661_1000116738 292
63 3300005344 Ga0070661_100449871 Ga0070661_1004498711 292
64 3300005347 Ga0070668_100039768 Ga0070668_1000397683 292
65 3300005353 Ga0070669_100010774 Ga0070669_1000107744 292
66 3300005353 Ga0070669_100108812 Ga0070669_1001088121 292
67 3300005353 Ga0070669_100534671 Ga0070669_1005346711 292
68 3300005354 Ga0070675_100021634 Ga0070675_1000216343 292
69 3300005354 Ga0070675_100030175 Ga0070675_1000301752 292
70 3300005354 Ga0070675_100076198 Ga0070675_1000761984 292
71 3300005354 Ga0070675_100275857 Ga0070675_1002758571 292
72 3300005355 Ga0070671_100030398 Ga0070671_1000303983 292
73 3300005355 Ga0070671_100030845 Ga0070671_1000308454 292
74 3300005356 Ga0070674_100026888 Ga0070674_1000268884 292
75 3300005356 Ga0070674_100315756 Ga0070674_1003157562 292
76 3300005364 Ga0070673_100025786 Ga0070673_1000257864 292
77 3300005364 Ga0070673_100046874 Ga0070673_1000468743 292
78 3300005364 Ga0070673_100046963 Ga0070673_1000469634 292
79 3300005365 Ga0070688_100002392 Ga0070688_1000023928 292
80 3300005365 Ga0070688_100008249 Ga0070688_1000082493 292
81 3300005365 Ga0070688_100010018 Ga0070688_1000100185 292
82 3300005365 Ga0070688_100045490 Ga0070688_1000454902 292
83 3300005366 Ga0070659_100078053 Ga0070659_1000780533 292
84 3300005367 Ga0070667_100013142 Ga0070667_1000131424 292
85 3300005367 Ga0070667_100016120 Ga0070667_1000161204 292
86 3300005367 Ga0070667_100110703 Ga0070667_1001107032 292
87 3300005367 Ga0070667_100120878 Ga0070667_1001208782 292
88 3300005456 Ga0070678_100174440 Ga0070678_1001744401 292
89 3300005456 Ga0070678_100191282 Ga0070678_1001912822 292
90 3300005457 Ga0070662_100007885 Ga0070662_1000078852 292
91 3300005457 Ga0070662_100011594 Ga0070662_1000115944 292
92 3300005457 Ga0070662_100103171 Ga0070662_1001031713 292
93 3300005459 Ga0068867_100006733 Ga0068867_1000067333 292
94 3300005459 Ga0068867_100068315 Ga0068867_1000683153 292
95 3300005459 Ga0068867_100223398 Ga0068867_1002233982 292
96 3300005459 Ga0068867_100322198 Ga0068867_1003221981 292
97 3300005471 Ga0070698_100018562 Ga0070698_1000185629 292
98 3300005535 Ga0070684_100001704 Ga0070684_1000017043 292
99 3300005535 Ga0070684_100023837 Ga0070684_1000238375 292
100 3300005535 Ga0070684_100026672 Ga0070684_1000266724 292
101 3300005535 Ga0070684_100083739 Ga0070684_1000837393 292
102 3300005539 Ga0068853_100526380 Ga0068853_1005263801 292
103 3300005543 Ga0070672_100020447 Ga0070672_1000204472 292
104 3300005543 Ga0070672_100092390 Ga0070672_1000923903 292
105 3300005544 Ga0070686_100101776 Ga0070686_1001017762 292
106 3300005563 Ga0068855_100629745 Ga0068855_1006297452 292
107 3300005564 Ga0070664_100004400 Ga0070664_1000044007 292
108 3300005564 Ga0070664_100027144 Ga0070664_1000271442 292
109 3300005564 Ga0070664_100104422 Ga0070664_1001044223 292
110 3300005577 Ga0068857_100007290 Ga0068857_1000072906 292
111 3300005577 Ga0068857_100173811 Ga0068857_1001738111 292
112 3300005616 Ga0068852_100064686 Ga0068852_1000646863 292
113 3300005616 Ga0068852_100157208 Ga0068852_1001572082 292
114 3300005616 Ga0068852_100167902 Ga0068852_1001679022 292
115 3300005617 Ga0068859_100005938 Ga0068859_1000059384 292
116 3300005617 Ga0068859_100006389 Ga0068859_1000063892 292
117 3300005617 Ga0068859_100012004 Ga0068859_1000120046 292
118 3300005617 Ga0068859_100167042 Ga0068859_1001670423 292
119 3300005617 Ga0068859_100467642 Ga0068859_1004676422 292
120 3300005618 Ga0068864_100025093 Ga0068864_1000250933 292
121 3300005618 Ga0068864_100199666 Ga0068864_1001996663 292
122 3300005718 Ga0068866_10170163 Ga0068866_101701632 292
123 3300005718 Ga0068866_10210165 Ga0068866_102101652 292
124 3300005719 Ga0068861_100325600 Ga0068861_1003256001 292
125 3300005840 Ga0068870_10018887 Ga0068870_100188872 292
126 3300005841 Ga0068863_100038687 Ga0068863_1000386874 292
127 3300005841 Ga0068863_100061895 Ga0068863_1000618953 292
128 3300005841 Ga0068863_100789845 Ga0068863_1007898451 292
129 3300005842 Ga0068858_100007207 Ga0068858_1000072076 292
130 3300005842 Ga0068858_100122853 Ga0068858_1001228532 292
131 3300005842 Ga0068858_100459283 Ga0068858_1004592831 292
132 3300005843 Ga0068860_100275890 Ga0068860_1002758902 292
133 3300005843 Ga0068860_100323284 Ga0068860_1003232842 292
134 3300005843 Ga0068860_100598624 Ga0068860_1005986242 292
135 3300005844 Ga0068862_100008288 Ga0068862_1000082882 292
136 3300005844 Ga0068862_100279519 Ga0068862_1002795192 292
137 3300005844 Ga0068862_100521394 Ga0068862_1005213942 292
138 3300006237 Ga0097621_100000730 Ga0097621_1000007305 292
139 3300006237 Ga0097621_100075713 Ga0097621_1000757133 292
140 3300006237 Ga0097621_100098155 Ga0097621_1000981551 292
141 3300006237 Ga0097621_100178662 Ga0097621_1001786622 292
142 3300006358 Ga0068871_100001108 Ga0068871_1000011084 292
143 3300006358 Ga0068871_100056914 Ga0068871_1000569142 292
144 3300006358 Ga0068871_100070827 Ga0068871_1000708273 292
145 3300006358 Ga0068871_100076027 Ga0068871_1000760273 292
146 3300006358 Ga0068871_100095104 Ga0068871_1000951042 292
147 3300006931 Ga0097620_100005935 Ga0097620_1000059354 292
148 3300006931 Ga0097620_100006389 Ga0097620_1000063892 292
149 3300006931 Ga0097620_100012005 Ga0097620_1000120056 292
150 3300006931 Ga0097620_100167041 Ga0097620_1001670413 292
151 3300006931 Ga0097620_100467639 Ga0097620_1004676392 292
152 3300006942 Ga0099824_1000108 Ga0099824_100010851 292
153 3300009011 Ga0105251_10107043 Ga0105251_101070431 292
154 3300009174 Ga0105241_10119776 Ga0105241_101197761 292
155 3300009176 Ga0105242_10006625 Ga0105242_100066254 292
156 3300009176 Ga0105242_10026503 Ga0105242_100265034 292
157 3300009176 Ga0105242_10081751 Ga0105242_100817513 292
158 3300009177 Ga0105248_10033655 Ga0105248_100336554 292
159 3300009177 Ga0105248_10133731 Ga0105248_101337312 292
160 3300009545 Ga0105237_10301479 Ga0105237_103014792 292
161 3300009553 Ga0105249_10018002 Ga0105249_100180022 292
162 3300009553 Ga0105249_10023287 Ga0105249_100232874 292
163 3300009553 Ga0105249_10068920 Ga0105249_100689201 292
164 3300009553 Ga0105249_10229072 Ga0105249_102290722 292
165 3300009553 Ga0105249_10230541 Ga0105249_102305412 292
166 3300009553 Ga0105249_10302303 Ga0105249_103023032 292
167 3300009553 Ga0105249_10543237 Ga0105249_105432371 292
168 3300010375 Ga0105239_10101543 Ga0105239_101015432 292
169 3300010375 Ga0105239_10246518 Ga0105239_102465182 292
170 3300011119 Ga0105246_10035524 Ga0105246_100355244 292
171 3300011119 Ga0105246_10158472 Ga0105246_101584722 292
172 3300011119 Ga0105246_10205017 Ga0105246_102050171 292
173 3300013100 Ga0157373_10000026 Ga0157373_1000002616 292
174 3300013104 Ga0157370_10011251 Ga0157370_100112514 292
175 3300013296 Ga0157374_10001456 Ga0157374_1000145616 292
176 3300013296 Ga0157374_10008082 Ga0157374_100080825 292
177 3300013296 Ga0157374_10009524 Ga0157374_100095247 292
178 3300013296 Ga0157374_10016256 Ga0157374_100162565 292
179 3300013296 Ga0157374_10134192 Ga0157374_101341923 292
180 3300013297 Ga0157378_10005638 Ga0157378_100056384 292
181 3300013297 Ga0157378_10082072 Ga0157378_100820723 292
182 3300013297 Ga0157378_10092804 Ga0157378_100928042 292
183 3300013306 Ga0163162_10001942 Ga0163162_1000194210 292
184 3300013306 Ga0163162_10005199 Ga0163162_1000519910 292
185 3300013306 Ga0163162_10007669 Ga0163162_100076695 292
186 3300013306 Ga0163162_10109443 Ga0163162_101094433 292
187 3300013306 Ga0163162_10384029 Ga0163162_103840291 292
188 3300013306 Ga0163162_10482370 Ga0163162_104823702 292
189 3300013307 Ga0157372_10404895 Ga0157372_104048952 292
190 3300013308 Ga0157375_10001463 Ga0157375_100014632 292
191 3300013308 Ga0157375_10002097 Ga0157375_100020978 292
192 3300013308 Ga0157375_10005334 Ga0157375_100053346 292
193 3300013308 Ga0157375_10060082 Ga0157375_100600823 292
194 3300013308 Ga0157375_10100439 Ga0157375_101004392 292
195 3300013308 Ga0157375_10116860 Ga0157375_101168602 292
196 3300013308 Ga0157375_10150935 Ga0157375_101509352 292
197 3300014325 Ga0163163_10001802 Ga0163163_100018028 292
198 3300014325 Ga0163163_10018283 Ga0163163_100182834 292
199 3300014325 Ga0163163_10068845 Ga0163163_100688454 292
200 3300014325 Ga0163163_10130935 Ga0163163_101309351 292
201 3300014325 Ga0163163_10181029 Ga0163163_101810292 292
202 3300014325 Ga0163163_10637515 Ga0163163_106375151 292
203 3300014326 Ga0157380_10004127 Ga0157380_100041273 292
204 3300014326 Ga0157380_10059102 Ga0157380_100591026 292
205 3300014326 Ga0157380_10201018 Ga0157380_102010182 292
206 3300014745 Ga0157377_10008786 Ga0157377_100087865 292
207 3300014745 Ga0157377_10038298 Ga0157377_100382982 292
208 3300014745 Ga0157377_10065872 Ga0157377_100658722 292
209 3300014745 Ga0157377_10069544 Ga0157377_100695442 292
210 3300014745 Ga0157377_10153233 Ga0157377_101532332 292
211 3300014968 Ga0157379_10009870 Ga0157379_100098708 292
212 3300014968 Ga0157379_10030528 Ga0157379_100305282 292
213 3300014968 Ga0157379_10075663 Ga0157379_100756635 292
214 3300014969 Ga0157376_10000944 Ga0157376_100009443 292
215 3300014969 Ga0157376_10033069 Ga0157376_100330691 292
216 3300014969 Ga0157376_10055354 Ga0157376_100553541 292
217 3300014969 Ga0157376_10074219 Ga0157376_100742193 292
218 3300014969 Ga0157376_10106752 Ga0157376_101067523 292
219 3300014969 Ga0157376_10123756 Ga0157376_101237561 292
220 3300014969 Ga0157376_10131997 Ga0157376_101319972 292
221 3300017792 Ga0163161_10013460 Ga0163161_100134604 292
222 3300017792 Ga0163161_10013973 Ga0163161_100139734 292
223 3300017792 Ga0163161_10030545 Ga0163161_100305452 292
224 3300017792 Ga0163161_10035966 Ga0163161_100359661 292
225 3300017792 Ga0163161_10073133 Ga0163161_100731333 292
226 3300017792 Ga0163161_10088347 Ga0163161_100883471 292
227 3300025315 Ga0207697_10041197 Ga0207697_100411972 292
228 3300025315 Ga0207697_10133959 Ga0207697_101339591 292
229 3300025903 Ga0207680_10022080 Ga0207680_100220802 292
230 3300025904 Ga0207647_10009346 Ga0207647_100093464 292
231 3300025904 Ga0207647_10009716 Ga0207647_100097162 292
232 3300025908 Ga0207643_10005351 Ga0207643_1000535110 292
233 3300025908 Ga0207643_10032327 Ga0207643_100323272 292
234 3300025918 Ga0207662_10010275 Ga0207662_100102754 292
235 3300025920 Ga0207649_10072243 Ga0207649_100722431 292
236 3300025925 Ga0207650_10008134 Ga0207650_100081345 292
237 3300025925 Ga0207650_10015433 Ga0207650_100154333 292
238 3300025925 Ga0207650_10055730 Ga0207650_100557306 292
239 3300025925 Ga0207650_10490743 Ga0207650_104907432 292
240 3300025926 Ga0207659_10072543 Ga0207659_100725432 292
241 3300025926 Ga0207659_10264863 Ga0207659_102648632 292
242 3300025931 Ga0207644_10012190 Ga0207644_100121903 292
243 3300025931 Ga0207644_10039791 Ga0207644_100397913 292
244 3300025932 Ga0207690_10316050 Ga0207690_103160502 292
245 3300025933 Ga0207706_10009970 Ga0207706_100099704 292
246 3300025933 Ga0207706_10032169 Ga0207706_100321693 292
247 3300025933 Ga0207706_10187301 Ga0207706_101873012 292
248 3300025934 Ga0207686_10012546 Ga0207686_100125464 292
249 3300025934 Ga0207686_10014504 Ga0207686_100145045 292
250 3300025936 Ga0207670_10011054 Ga0207670_100110542 292
251 3300025936 Ga0207670_10056391 Ga0207670_100563911 292
252 3300025937 Ga0207669_10054869 Ga0207669_100548692 292
253 3300025940 Ga0207691_10034529 Ga0207691_100345291 292
254 3300025940 Ga0207691_10138339 Ga0207691_101383393 292
255 3300025940 Ga0207691_10283202 Ga0207691_102832021 292
256 3300025941 Ga0207711_10023254 Ga0207711_100232544 292
257 3300025941 Ga0207711_10245672 Ga0207711_102456722 292
258 3300025942 Ga0207689_10003767 Ga0207689_1000376716 292
259 3300025942 Ga0207689_10004950 Ga0207689_1000495013 292
260 3300025942 Ga0207689_10010093 Ga0207689_100100934 292
261 3300025942 Ga0207689_10014840 Ga0207689_100148404 292
262 3300025944 Ga0207661_10030966 Ga0207661_100309664 292
263 3300025944 Ga0207661_10050778 Ga0207661_100507782 292
264 3300025944 Ga0207661_10241963 Ga0207661_102419632 292
265 3300025944 Ga0207661_10261592 Ga0207661_102615922 292
266 3300025944 Ga0207661_10365582 Ga0207661_103655821 292
267 3300025945 Ga0207679_10006721 Ga0207679_100067215 292
268 3300025945 Ga0207679_10052361 Ga0207679_100523612 292
269 3300025945 Ga0207679_10091769 Ga0207679_100917692 292
270 3300025945 Ga0207679_10239830 Ga0207679_102398302 292
271 3300025960 Ga0207651_10055346 Ga0207651_100553464 292
272 3300025960 Ga0207651_10176758 Ga0207651_101767581 292
273 3300025960 Ga0207651_10264087 Ga0207651_102640872 292
274 3300025961 Ga0207712_10008917 Ga0207712_100089174 292
275 3300025961 Ga0207712_10018771 Ga0207712_100187712 292
276 3300025961 Ga0207712_10021908 Ga0207712_100219084 292
277 3300025961 Ga0207712_10038489 Ga0207712_100384891 292
278 3300025972 Ga0207668_10129634 Ga0207668_101296341 292
279 3300025986 Ga0207658_10020725 Ga0207658_100207254 292
280 3300025986 Ga0207658_10047963 Ga0207658_100479632 292
281 3300025986 Ga0207658_10107895 Ga0207658_101078952 292
282 3300026023 Ga0207677_10026111 Ga0207677_100261111 292
283 3300026023 Ga0207677_10028527 Ga0207677_100285272 292
284 3300026023 Ga0207677_10053189 Ga0207677_100531893 292
285 3300026023 Ga0207677_10417438 Ga0207677_104174381 292
286 3300026035 Ga0207703_10049113 Ga0207703_100491133 292
287 3300026035 Ga0207703_10323469 Ga0207703_103234691 292
288 3300026035 Ga0207703_10400614 Ga0207703_104006141 292
289 3300026041 Ga0207639_10350456 Ga0207639_103504562 292
290 3300026041 Ga0207639_10421541 Ga0207639_104215412 292
291 3300026067 Ga0207678_10021730 Ga0207678_100217304 292
292 3300026075 Ga0207708_10050332 Ga0207708_100503322 292
293 3300026075 Ga0207708_10146885 Ga0207708_101468852 292
294 3300026075 Ga0207708_10169500 Ga0207708_101695002 292
295 3300026088 Ga0207641_10000391 Ga0207641_1000039133 292
296 3300026088 Ga0207641_10162681 Ga0207641_101626812 292
297 3300026088 Ga0207641_10412189 Ga0207641_104121891 292
298 3300026089 Ga0207648_10011770 Ga0207648_100117703 292
299 3300026089 Ga0207648_10052104 Ga0207648_100521043 292
300 3300026089 Ga0207648_10069180 Ga0207648_100691804 292
301 3300026089 Ga0207648_10099911 Ga0207648_100999113 292
302 3300026089 Ga0207648_10134789 Ga0207648_101347892 292
303 3300026089 Ga0207648_10373445 Ga0207648_103734452 292
304 3300026095 Ga0207676_10009334 Ga0207676_100093342 292
305 3300026095 Ga0207676_10020461 Ga0207676_100204614 292
306 3300026095 Ga0207676_10287555 Ga0207676_102875551 292
307 3300026116 Ga0207674_10005755 Ga0207674_1000575515 292
308 3300026116 Ga0207674_10046605 Ga0207674_100466054 292
309 3300026116 Ga0207674_10068062 Ga0207674_100680624 292
310 3300026116 Ga0207674_10121273 Ga0207674_101212732 292
311 3300026118 Ga0207675_100022651 Ga0207675_1000226512 292
312 3300026118 Ga0207675_100277464 Ga0207675_1002774642 292
313 3300026121 Ga0207683_10249278 Ga0207683_102492782 292
314 3300026121 Ga0207683_10292358 Ga0207683_102923582 292
315 3300028380 Ga0268265_10027841 Ga0268265_100278412 292
316 3300028380 Ga0268265_10384221 Ga0268265_103842211 292
317 3300028380 Ga0268265_10465211 Ga0268265_104652111 292
318 3300028380 Ga0268265_10489006 Ga0268265_104890061 292
319 3300035692 Ga0373935_0194658 Ga0373935_0194658_313_1194 292
320 3300036401 Ga0373937_0012356 Ga0373937_0012356_4397_5278 292
321 3300036401 Ga0373937_0617997 Ga0373937_0617997_59_967 292
322 3300037068 Ga0373925_0135238 Ga0373925_0135238_711_1592 292
323 3300042001 Ga0439441_004633 Ga0439441_004633_527_1411 292
324 3300042014 Ga0439457_002466 Ga0439457_002466_4217_5098 292
325 3300042015 Ga0439462_0011842 Ga0439462_0011842_119_1000 292
326 3300042876 Ga0451577_0060431 Ga0451577_0060431_1642_2520 292
327 3300044673 Ga0453683_0024682 Ga0453683_0024682_686_1564 292
328 3300045051 Ga0451576_0016888 Ga0451576_0016888_5339_6217 292
329 3300046476 Ga0495662_0138670 Ga0495662_0138670_226_1107 292
330 3300046492 Ga0495585_0154695 Ga0495585_0154695_167_1075 292
331 3300046511 Ga0495608_0224049 Ga0495608_0224049_276_1157 292
332 3300046514 Ga0495618_0134412 Ga0495618_0134412_281_1162 292
333 3300046516 Ga0495628_0023646 Ga0495628_0023646_2186_3067 292
334 3300046517 Ga0495630_0009510 Ga0495630_0009510_2062_2943 292
335 3300046529 Ga0495652_0188698 Ga0495652_0188698_80_961 292
336 3300046642 Ga0495634_0061278 Ga0495634_0061278_744_1625 292
337 3300046678 Ga0495599_0089699 Ga0495599_0089699_909_1790 292
338 3300047319 Ga0495674_0025531 Ga0495674_0025531_2403_3284 292
339 3300047322 Ga0495680_0114570 Ga0495680_0114570_157_1038 292
340 3300047471 Ga0495684_0011350 Ga0495684_0011350_1450_2331 292
341 3300048913 Ga0496110_0029502 Ga0496110_0029502_863_1744 292
342 3300048915 Ga0496112_0072575 Ga0496112_0072575_274_1155 292
343 3300053085 Ga0495619_0008622 Ga0495619_0008622_3178_4059 292
344 3300053153 Ga0500616_0010252 Ga0500616_0010252_4034_4912 292
345 2162886007 SwRhRL2b_contig_1596339 SwRhRL2b_0713.00001280 293
346 2162886007 SwRhRL2b_contig_674713 SwRhRL2b_0093.00003260 293
347 3300003320 rootH2_10042807 rootH2_100428074 293
348 3300003322 rootL2_10351168 rootL2_103511683 293
349 3300003794 Ga0055531_10000198 Ga0055531_1000019810 293
350 3300005288 Ga0065714_10006592 Ga0065714_100065921 293
351 3300005288 Ga0065714_10010546 Ga0065714_100105463 293
352 3300005289 Ga0065704_10070168 Ga0065704_1007016823 293
353 3300005289 Ga0065704_10099580 Ga0065704_100995802 293
354 3300005335 Ga0070666_10124771 Ga0070666_101247711 293
355 3300005355 Ga0070671_100141692 Ga0070671_1001416922 293
356 3300005617 Ga0068859_100003346 Ga0068859_10000334611 293
357 3300005617 Ga0068859_100116801 Ga0068859_1001168012 293
358 3300005618 Ga0068864_100329058 Ga0068864_1003290583 293
359 3300005841 Ga0068863_100001806 Ga0068863_10000180612 293
360 3300005841 Ga0068863_100023879 Ga0068863_1000238791 293
361 3300006195 Ga0075366_10001251 Ga0075366_1000125111 293
362 3300006237 Ga0097621_100008252 Ga0097621_1000082523 293
363 3300006358 Ga0068871_100006473 Ga0068871_1000064738 293
364 3300006358 Ga0068871_100342099 Ga0068871_1003420991 293
365 3300006931 Ga0097620_100003346 Ga0097620_10000334610 293
366 3300006931 Ga0097620_100116791 Ga0097620_1001167912 293
367 3300009176 Ga0105242_10281258 Ga0105242_102812582 293
368 3300009545 Ga0105237_10164508 Ga0105237_101645082 293
369 3300009553 Ga0105249_10077516 Ga0105249_100775165 293
370 3300010375 Ga0105239_10000006 Ga0105239_10000006269 293
371 3300010375 Ga0105239_10083418 Ga0105239_100834183 293
372 3300013100 Ga0157373_10000048 Ga0157373_1000004893 293
373 3300013100 Ga0157373_10240661 Ga0157373_102406612 293
374 3300013102 Ga0157371_10016459 Ga0157371_100164594 293
375 3300013104 Ga0157370_10001765 Ga0157370_1000176512 293
376 3300013297 Ga0157378_10020597 Ga0157378_100205976 293
377 3300013306 Ga0163162_10002198 Ga0163162_1000219812 293
378 3300013306 Ga0163162_10025063 Ga0163162_100250634 293
379 3300013306 Ga0163162_10127572 Ga0163162_101275722 293
380 3300014325 Ga0163163_10000498 Ga0163163_100004985 293
381 3300014497 Ga0182008_10000452 Ga0182008_1000045211 293
382 3300014497 Ga0182008_10125082 Ga0182008_101250821 293
383 3300014968 Ga0157379_10019981 Ga0157379_100199811 293
384 3300014969 Ga0157376_10029802 Ga0157376_100298022 293
385 3300014969 Ga0157376_10142190 Ga0157376_101421903 293
386 3300015261 Ga0182006_1006710 Ga0182006_10067105 293
387 3300017792 Ga0163161_10000235 Ga0163161_1000023519 293
388 3300017792 Ga0163161_10011840 Ga0163161_100118408 293
389 3300025250 Ga0209026_1000612 Ga0209026_10006127 293
390 3300025250 Ga0209026_1001863 Ga0209026_10018632 293
391 3300025258 Ga0209129_1024081 Ga0209129_10240812 293
392 3300025304 Ga0209257_1000008 Ga0209257_1000008505 293
393 3300025913 Ga0207695_10229591 Ga0207695_102295913 293
394 3300025925 Ga0207650_10068601 Ga0207650_100686012 293
395 3300026041 Ga0207639_10414337 Ga0207639_104143372 293
396 3300026088 Ga0207641_10000213 Ga0207641_1000021345 293
397 3300026095 Ga0207676_10011051 Ga0207676_100110517 293
398 3300030731 Ga0316177_1078208 Ga0316177_10782082 293
399 3300030732 Ga0316176_1124656 Ga0316176_112465627 293
400 3300032004 Ga0307414_10162086 Ga0307414_101620862 293
401 3300041460 Ga0451802_1309639 Ga0451802_1309639_232_1113 293
402 3300041512 Ga0451853_1422469 Ga0451853_1422469_1048_1929 293
403 3300046471 Ga0495650_0006109 Ga0495650_0006109_5202_6083 293
404 3300048904 Ga0496101_0018594 Ga0496101_0018594_310_1200 293
405 3300048929 Ga0496126_0016120 Ga0496126_0016120_5185_6066 293
406 3300048929 Ga0496126_0020780 Ga0496126_0020780_318_1199 293
407 3300050493 nmdc:mga0k408_1778_c1 nmdc:mga0k408_1778_c1_9663_10544 293
408 3300053727 Ga0500611_000167 Ga0500611_000167_954_1835 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

226

305

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

263

304

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.956 185 288
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.955 189 283
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9348 189 273
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9308 189 278
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9087 186 286
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9747 239 283 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9646 236 283 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9629 240 283 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9479 236 285 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 240 283 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3C1YJM9-F1-model_v4 AraC family transcriptional regulator 0.9583 184 284 GO:0003700
GO:0043565
AF-A0A5S5CLG3-F1-model_v4 AraC family transcriptional regulator of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase 0.9497 182 285 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A8B1B359-F1-model_v4 deleted 0.9478 191 285
AF-A0A2D8UXM9-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9468 184 292 GO:0000976
GO:0003700
AF-A0A7W3MX04-F1-model_v4 AraC family transcriptional activator FtrA 0.9417 189 285 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
85.82 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map