F436687
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 408 | 200 | 816 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10002444|Ga0070717_1000244411 |
| Length | 283 |
| Sequence | MEPTQLLEQSHFFASYIIAQQSMKSASETVVRSSGSDRVLVIMAKAPRPGAVKTRLAASLSHAAVTDFYCCLLDDTLALARSLKLKLGDVEVAIMCPESDVNELAQLAGSHSGNSEASVVAQKGEGLAAGLTSVFAHFVDSHQRRIIAFNSDSPHLPSSVLEDAFETLAAHDVVVGPTHDGGYYLVGAKASHPTLFASDGLGTSSALERLLSRARALELSVGFAAPFYDIDVADDLTRLAEELRLAPARAPRTAAWLKEWELAATHSRTSPRTRSRTGKEELE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 81 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 127 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 135 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 1.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.9 |
| Rhizosphere | 93.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10002444 | 3300006028 | Bacteria | 13112 |
| 2 | Ga0070676_10030501 | 3300005328 | Bacteria | 3075 |
| 3 | Ga0070683_100003279 | 3300005329 | Bacteria | 13087 |
| 4 | Ga0070683_100009472 | 3300005329 | Bacteria | 8331 |
| 5 | Ga0070683_100028899 | 3300005329 | Bacteria | 5014 |
| 6 | Ga0070680_100040194 | 3300005336 | Unclassified | 3786 |
| 7 | Ga0070680_100092261 | 3300005336 | Unclassified | 2508 |
| 8 | Ga0070682_100012956 | 3300005337 | Bacteria | 4787 |
| 9 | Ga0068868_100019218 | 3300005338 | Bacteria | 5118 |
| 10 | Ga0070660_100028322 | 3300005339 | Bacteria | 4190 |
| 11 | Ga0070689_100333999 | 3300005340 | Bacteria | 1268 |
| 12 | Ga0070691_10060767 | 3300005341 | Bacteria | 1817 |
| 13 | Ga0070661_100034634 | 3300005344 | Unclassified | 3663 |
| 14 | Ga0070671_100026671 | 3300005355 | Unclassified | 4751 |
| 15 | Ga0070688_100410138 | 3300005365 | Bacteria | 1005 |
| 16 | Ga0070667_100003568 | 3300005367 | Bacteria | 13255 |
| 17 | Ga0070709_10001531 | 3300005434 | Bacteria | 12480 |
| 18 | Ga0070709_10047227 | 3300005434 | Bacteria | 2681 |
| 19 | Ga0070709_10068400 | 3300005434 | Bacteria | 2284 |
| 20 | Ga0070709_10139271 | 3300005434 | Unclassified | 1665 |
| 21 | Ga0070709_10437668 | 3300005434 | Bacteria | 983 |
| 22 | Ga0070714_100225152 | 3300005435 | Unclassified | 1726 |
| 23 | Ga0070714_100239120 | 3300005435 | Unclassified | 1675 |
| 24 | Ga0070714_100407088 | 3300005435 | Bacteria | 1287 |
| 25 | Ga0070713_100000125 | 3300005436 | Bacteria | 50351 |
| 26 | Ga0070713_100000509 | 3300005436 | Bacteria | 24860 |
| 27 | Ga0070713_100050310 | 3300005436 | Unclassified | 3442 |
| 28 | Ga0070713_100418845 | 3300005436 | Unclassified | 1253 |
| 29 | Ga0070713_100650239 | 3300005436 | Unclassified | 1004 |
| 30 | Ga0070710_10000598 | 3300005437 | Bacteria | 17193 |
| 31 | Ga0070711_100000408 | 3300005439 | Bacteria | 22286 |
| 32 | Ga0070711_100185417 | 3300005439 | Unclassified | 1595 |
| 33 | Ga0070711_100321961 | 3300005439 | Bacteria | 1235 |
| 34 | Ga0070711_100466350 | 3300005439 | Unclassified | 1036 |
| 35 | Ga0070694_100318872 | 3300005444 | Unclassified | 1196 |
| 36 | Ga0070708_100040958 | 3300005445 | Bacteria | 4059 |
| 37 | Ga0070708_100134528 | 3300005445 | Bacteria | 2289 |
| 38 | Ga0070708_100272703 | 3300005445 | Unclassified | 1591 |
| 39 | Ga0070663_100001583 | 3300005455 | Bacteria | 12524 |
| 40 | Ga0070663_100086467 | 3300005455 | Bacteria | 2315 |
| 41 | Ga0070678_100225180 | 3300005456 | Bacteria | 1561 |
| 42 | Ga0070681_10013120 | 3300005458 | Bacteria | 8231 |
| 43 | Ga0070681_10088148 | 3300005458 | Bacteria | 3055 |
| 44 | Ga0070681_10120698 | 3300005458 | Unclassified | 2556 |
| 45 | Ga0070681_10199524 | 3300005458 | Bacteria | 1919 |
| 46 | Ga0068867_100055226 | 3300005459 | Bacteria | 2936 |
| 47 | Ga0070706_100182184 | 3300005467 | Bacteria | 1961 |
| 48 | Ga0070706_100249969 | 3300005467 | Bacteria | 1655 |
| 49 | Ga0070707_100000050 | 3300005468 | Bacteria | 102427 |
| 50 | Ga0070707_100130804 | 3300005468 | Unclassified | 2440 |
| 51 | Ga0070707_100217838 | 3300005468 | Bacteria | 1860 |
| 52 | Ga0070707_100255294 | 3300005468 | Bacteria | 1706 |
| 53 | Ga0070707_100269396 | 3300005468 | Bacteria | 1656 |
| 54 | Ga0070707_100325771 | 3300005468 | Bacteria | 1493 |
| 55 | Ga0070698_100006869 | 3300005471 | Bacteria | 12328 |
| 56 | Ga0070698_100008870 | 3300005471 | Bacteria | 10813 |
| 57 | Ga0070698_100677898 | 3300005471 | Unclassified | 972 |
| 58 | Ga0070699_100644620 | 3300005518 | Bacteria | 967 |
| 59 | Ga0070679_100107684 | 3300005530 | Bacteria | 2773 |
| 60 | Ga0070684_100031666 | 3300005535 | Bacteria | 4504 |
| 61 | Ga0070684_100100654 | 3300005535 | Bacteria | 2581 |
| 62 | Ga0070684_100114557 | 3300005535 | Bacteria | 2420 |
| 63 | Ga0070697_100000326 | 3300005536 | Bacteria | 37671 |
| 64 | Ga0070697_100019394 | 3300005536 | Bacteria | 5372 |
| 65 | Ga0070697_100242209 | 3300005536 | Unclassified | 1540 |
| 66 | Ga0070686_100007732 | 3300005544 | Bacteria | 6010 |
| 67 | Ga0070696_100080164 | 3300005546 | Bacteria | 2310 |
| 68 | Ga0070693_100017058 | 3300005547 | Bacteria | 3768 |
| 69 | Ga0070693_100102681 | 3300005547 | Unclassified | 1745 |
| 70 | Ga0070665_100008719 | 3300005548 | Bacteria | 10262 |
| 71 | Ga0068855_100001421 | 3300005563 | Bacteria | 29751 |
| 72 | Ga0068855_100007086 | 3300005563 | Bacteria | 13598 |
| 73 | Ga0068855_100182725 | 3300005563 | Bacteria | 2370 |
| 74 | Ga0068855_100278221 | 3300005563 | Bacteria | 1859 |
| 75 | Ga0070664_100144107 | 3300005564 | Bacteria | 2100 |
| 76 | Ga0068857_100222429 | 3300005577 | Bacteria | 1725 |
| 77 | Ga0068857_100380858 | 3300005577 | Bacteria | 1310 |
| 78 | Ga0068854_100107881 | 3300005578 | Bacteria | 2096 |
| 79 | Ga0068856_100001532 | 3300005614 | Bacteria | 24221 |
| 80 | Ga0068856_100001724 | 3300005614 | Bacteria | 22874 |
| 81 | Ga0068856_100013557 | 3300005614 | Bacteria | 7892 |
| 82 | Ga0068856_100312904 | 3300005614 | Unclassified | 1588 |
| 83 | Ga0068856_100372413 | 3300005614 | Bacteria | 1447 |
| 84 | Ga0068856_100676913 | 3300005614 | Bacteria | 1052 |
| 85 | Ga0068864_100002560 | 3300005618 | Bacteria | 15015 |
| 86 | Ga0068864_100734343 | 3300005618 | Bacteria | 967 |
| 87 | Ga0068863_100143065 | 3300005841 | Unclassified | 2287 |
| 88 | Ga0068863_100154788 | 3300005841 | Bacteria | 2194 |
| 89 | Ga0068858_100187257 | 3300005842 | Bacteria | 1955 |
| 90 | Ga0068862_100365351 | 3300005844 | Bacteria | 1342 |
| 91 | Ga0070717_10020392 | 3300006028 | Bacteria | 5213 |
| 92 | Ga0070717_10100743 | 3300006028 | Bacteria | 2453 |
| 93 | Ga0070717_10140585 | 3300006028 | Unclassified | 2082 |
| 94 | Ga0070717_10229468 | 3300006028 | Bacteria | 1634 |
| 95 | Ga0070717_10452154 | 3300006028 | Unclassified | 1158 |
| 96 | Ga0070717_10494684 | 3300006028 | Bacteria | 1105 |
| 97 | Ga0070715_10179053 | 3300006163 | Unclassified | 1062 |
| 98 | Ga0070716_100001646 | 3300006173 | Bacteria | 10079 |
| 99 | Ga0070716_100002081 | 3300006173 | Bacteria | 9175 |
| 100 | Ga0070716_100034791 | 3300006173 | Unclassified | 2765 |
| 101 | Ga0070716_100154491 | 3300006173 | Unclassified | 1480 |
| 102 | Ga0070712_100000067 | 3300006175 | Bacteria | 53056 |
| 103 | Ga0070712_100000134 | 3300006175 | Bacteria | 38860 |
| 104 | Ga0070712_100023999 | 3300006175 | Bacteria | 4035 |
| 105 | Ga0097621_100000034 | 3300006237 | Bacteria | 69159 |
| 106 | Ga0097621_100052269 | 3300006237 | Bacteria | 3328 |
| 107 | Ga0097621_100151459 | 3300006237 | Unclassified | 1989 |
| 108 | Ga0068871_100000819 | 3300006358 | Bacteria | 20831 |
| 109 | Ga0068871_100468502 | 3300006358 | Unclassified | 1131 |
| 110 | Ga0075433_10404487 | 3300006852 | Unclassified | 1204 |
| 111 | Ga0075434_100006014 | 3300006871 | Bacteria | 11103 |
| 112 | Ga0075434_100035447 | 3300006871 | Bacteria | 4933 |
| 113 | Ga0075434_100232600 | 3300006871 | Bacteria | 1863 |
| 114 | Ga0068865_100027442 | 3300006881 | Bacteria | 3762 |
| 115 | Ga0075436_100160032 | 3300006914 | Bacteria | 1587 |
| 116 | Ga0075435_100368740 | 3300007076 | Bacteria | 1232 |
| 117 | Ga0099794_10020138 | 3300007265 | Unclassified | 3016 |
| 118 | Ga0099794_10118333 | 3300007265 | Unclassified | 1331 |
| 119 | Ga0099795_10113786 | 3300007788 | Unclassified | 1075 |
| 120 | Ga0105240_10004264 | 3300009093 | Bacteria | 21862 |
| 121 | Ga0105240_10047360 | 3300009093 | Bacteria | 5441 |
| 122 | Ga0105240_10349200 | 3300009093 | Bacteria | 1679 |
| 123 | Ga0105247_10011209 | 3300009101 | Bacteria | 5406 |
| 124 | Ga0105247_10396412 | 3300009101 | Unclassified | 982 |
| 125 | Ga0114129_10074350 | 3300009147 | Unclassified | 4733 |
| 126 | Ga0105243_10073986 | 3300009148 | Bacteria | 2762 |
| 127 | Ga0105243_10708642 | 3300009148 | Unclassified | 982 |
| 128 | Ga0105241_10039967 | 3300009174 | Unclassified | 3539 |
| 129 | Ga0105241_10545721 | 3300009174 | Unclassified | 1040 |
| 130 | Ga0105248_10011027 | 3300009177 | Bacteria | 9969 |
| 131 | Ga0105248_10069980 | 3300009177 | Unclassified | 3940 |
| 132 | Ga0105237_10174261 | 3300009545 | Bacteria | 2151 |
| 133 | Ga0105238_10007339 | 3300009551 | Bacteria | 11039 |
| 134 | Ga0105238_10034553 | 3300009551 | Bacteria | 5143 |
| 135 | Ga0105238_10365092 | 3300009551 | Bacteria | 1434 |
| 136 | Ga0105239_10021480 | 3300010375 | Bacteria | 7116 |
| 137 | Ga0105239_10203956 | 3300010375 | Unclassified | 2216 |
| 138 | Ga0105239_10204751 | 3300010375 | Bacteria | 2211 |
| 139 | Ga0105239_10270453 | 3300010375 | Bacteria | 1911 |
| 140 | Ga0157373_10007167 | 3300013100 | Bacteria | 8319 |
| 141 | Ga0157371_10049246 | 3300013102 | Bacteria | 2994 |
| 142 | Ga0157371_10138302 | 3300013102 | Bacteria | 1735 |
| 143 | Ga0157370_10002484 | 3300013104 | Bacteria | 22231 |
| 144 | Ga0157370_10498322 | 3300013104 | Unclassified | 1119 |
| 145 | Ga0157370_10540440 | 3300013104 | Unclassified | 1069 |
| 146 | Ga0157369_10010669 | 3300013105 | Bacteria | 10456 |
| 147 | Ga0157369_10119097 | 3300013105 | Unclassified | 2802 |
| 148 | Ga0157369_10203064 | 3300013105 | Bacteria | 2080 |
| 149 | Ga0157369_10228542 | 3300013105 | Bacteria | 1946 |
| 150 | Ga0157369_10792362 | 3300013105 | Unclassified | 974 |
| 151 | Ga0157374_10000249 | 3300013296 | Bacteria | 49808 |
| 152 | Ga0157374_10024162 | 3300013296 | Bacteria | 5446 |
| 153 | Ga0157374_10128064 | 3300013296 | Unclassified | 2455 |
| 154 | Ga0157374_10372138 | 3300013296 | Bacteria | 1422 |
| 155 | Ga0157374_10522975 | 3300013296 | Bacteria | 1192 |
| 156 | Ga0157378_10000008 | 3300013297 | Bacteria | 162605 |
| 157 | Ga0157378_10506767 | 3300013297 | Unclassified | 1206 |
| 158 | Ga0157378_10653328 | 3300013297 | Unclassified | 1067 |
| 159 | Ga0163162_10156206 | 3300013306 | Bacteria | 2401 |
| 160 | Ga0157372_10000436 | 3300013307 | Bacteria | 45959 |
| 161 | Ga0157372_10000992 | 3300013307 | Bacteria | 31047 |
| 162 | Ga0157375_10024068 | 3300013308 | Bacteria | 5630 |
| 163 | Ga0157375_10110043 | 3300013308 | Bacteria | 2852 |
| 164 | Ga0157379_10069936 | 3300014968 | Bacteria | 3140 |
| 165 | Ga0157379_10214893 | 3300014968 | Unclassified | 1741 |
| 166 | Ga0157376_10001493 | 3300014969 | Bacteria | 15434 |
| 167 | Ga0157376_10002140 | 3300014969 | Bacteria | 13309 |
| 168 | Ga0157376_10062070 | 3300014969 | Bacteria | 3144 |
| 169 | Ga0213872_10001338 | 3300021361 | Bacteria | 16267 |
| 170 | Ga0213872_10001709 | 3300021361 | Bacteria | 13824 |
| 171 | Ga0213876_10056935 | 3300021384 | Bacteria | 2064 |
| 172 | Ga0213876_10137196 | 3300021384 | Unclassified | 1301 |
| 173 | Ga0213875_10009771 | 3300021388 | Bacteria | 4843 |
| 174 | Ga0224572_1011965 | 3300024225 | Bacteria | 1644 |
| 175 | Ga0228598_1000303 | 3300024227 | Bacteria | 9589 |
| 176 | Ga0228598_1001702 | 3300024227 | Bacteria | 4809 |
| 177 | Ga0228598_1005197 | 3300024227 | Unclassified | 2734 |
| 178 | Ga0228598_1011880 | 3300024227 | Bacteria | 1731 |
| 179 | Ga0207692_10003006 | 3300025898 | Bacteria | 6536 |
| 180 | Ga0207692_10024007 | 3300025898 | Bacteria | 2828 |
| 181 | Ga0207710_10055988 | 3300025900 | Bacteria | 1779 |
| 182 | Ga0207680_10072352 | 3300025903 | Bacteria | 2140 |
| 183 | Ga0207685_10020451 | 3300025905 | Unclassified | 2200 |
| 184 | Ga0207699_10001629 | 3300025906 | Bacteria | 10643 |
| 185 | Ga0207699_10169371 | 3300025906 | Unclassified | 1460 |
| 186 | Ga0207645_10015810 | 3300025907 | Bacteria | 5001 |
| 187 | Ga0207684_10174497 | 3300025910 | Unclassified | 1853 |
| 188 | Ga0207684_10174853 | 3300025910 | Bacteria | 1851 |
| 189 | Ga0207654_10020050 | 3300025911 | Unclassified | 3538 |
| 190 | Ga0207654_10124108 | 3300025911 | Unclassified | 1626 |
| 191 | Ga0207707_10015200 | 3300025912 | Bacteria | 6702 |
| 192 | Ga0207707_10030578 | 3300025912 | Bacteria | 4711 |
| 193 | Ga0207707_10097307 | 3300025912 | Unclassified | 2572 |
| 194 | Ga0207707_10137709 | 3300025912 | Bacteria | 2134 |
| 195 | Ga0207695_10005455 | 3300025913 | Bacteria | 16847 |
| 196 | Ga0207695_10164711 | 3300025913 | Unclassified | 2146 |
| 197 | Ga0207695_10645636 | 3300025913 | Unclassified | 939 |
| 198 | Ga0207695_10729782 | 3300025913 | Unclassified | 871 |
| 199 | Ga0207671_10192968 | 3300025914 | Bacteria | 1589 |
| 200 | Ga0207693_10000051 | 3300025915 | Bacteria | 99220 |
| 201 | Ga0207693_10000252 | 3300025915 | Bacteria | 49630 |
| 202 | Ga0207693_10300000 | 3300025915 | Unclassified | 1259 |
| 203 | Ga0207693_10515350 | 3300025915 | Unclassified | 933 |
| 204 | Ga0207663_10001998 | 3300025916 | Bacteria | 9690 |
| 205 | Ga0207663_10280277 | 3300025916 | Unclassified | 1238 |
| 206 | Ga0207660_10082600 | 3300025917 | Bacteria | 2364 |
| 207 | Ga0207657_10004369 | 3300025919 | Bacteria | 14960 |
| 208 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 209 | Ga0207646_10003275 | 3300025922 | Bacteria | 18448 |
| 210 | Ga0207646_10076627 | 3300025922 | Bacteria | 2988 |
| 211 | Ga0207646_10105194 | 3300025922 | Unclassified | 2531 |
| 212 | Ga0207646_10156735 | 3300025922 | Bacteria | 2054 |
| 213 | Ga0207646_10231854 | 3300025922 | Bacteria | 1668 |
| 214 | Ga0207646_10318355 | 3300025922 | Unclassified | 1406 |
| 215 | Ga0207646_10341606 | 3300025922 | Bacteria | 1353 |
| 216 | Ga0207646_10603610 | 3300025922 | Bacteria | 985 |
| 217 | Ga0207687_10000141 | 3300025927 | Bacteria | 48006 |
| 218 | Ga0207700_10000381 | 3300025928 | Bacteria | 25771 |
| 219 | Ga0207700_10002753 | 3300025928 | Bacteria | 10131 |
| 220 | Ga0207700_10005864 | 3300025928 | Bacteria | 7384 |
| 221 | Ga0207700_10008629 | 3300025928 | Bacteria | 6326 |
| 222 | Ga0207700_10088286 | 3300025928 | Bacteria | 2441 |
| 223 | Ga0207700_10177776 | 3300025928 | Bacteria | 1780 |
| 224 | Ga0207664_10047411 | 3300025929 | Unclassified | 3375 |
| 225 | Ga0207664_10066497 | 3300025929 | Bacteria | 2890 |
| 226 | Ga0207664_10305755 | 3300025929 | Unclassified | 1400 |
| 227 | Ga0207644_10017386 | 3300025931 | Unclassified | 4855 |
| 228 | Ga0207706_10000296 | 3300025933 | Bacteria | 54072 |
| 229 | Ga0207709_10060019 | 3300025935 | Bacteria | 2370 |
| 230 | Ga0207704_10029307 | 3300025938 | Bacteria | 3067 |
| 231 | Ga0207665_10003709 | 3300025939 | Bacteria | 10199 |
| 232 | Ga0207665_10009975 | 3300025939 | Bacteria | 6234 |
| 233 | Ga0207665_10014915 | 3300025939 | Bacteria | 5105 |
| 234 | Ga0207665_10031223 | 3300025939 | Unclassified | 3524 |
| 235 | Ga0207665_10144117 | 3300025939 | Unclassified | 1701 |
| 236 | Ga0207665_10149897 | 3300025939 | Bacteria | 1670 |
| 237 | Ga0207665_10253604 | 3300025939 | Unclassified | 1301 |
| 238 | Ga0207665_10369448 | 3300025939 | Unclassified | 1086 |
| 239 | Ga0207711_10044463 | 3300025941 | Bacteria | 3791 |
| 240 | Ga0207711_10074268 | 3300025941 | Bacteria | 2957 |
| 241 | Ga0207711_10160065 | 3300025941 | Bacteria | 2037 |
| 242 | Ga0207661_10001952 | 3300025944 | Bacteria | 14178 |
| 243 | Ga0207661_10005239 | 3300025944 | Bacteria | 9117 |
| 244 | Ga0207679_10162206 | 3300025945 | Bacteria | 1831 |
| 245 | Ga0207667_10001192 | 3300025949 | Bacteria | 32605 |
| 246 | Ga0207667_10001239 | 3300025949 | Bacteria | 32026 |
| 247 | Ga0207667_10071700 | 3300025949 | Bacteria | 3601 |
| 248 | Ga0207668_10314840 | 3300025972 | Unclassified | 1297 |
| 249 | Ga0207640_10229132 | 3300025981 | Bacteria | 1428 |
| 250 | Ga0207677_10039642 | 3300026023 | Bacteria | 3099 |
| 251 | Ga0207677_10233015 | 3300026023 | Unclassified | 1485 |
| 252 | Ga0207703_10144748 | 3300026035 | Bacteria | 2066 |
| 253 | Ga0207639_10357226 | 3300026041 | Bacteria | 1306 |
| 254 | Ga0207678_10000903 | 3300026067 | Bacteria | 27239 |
| 255 | Ga0207702_10001513 | 3300026078 | Bacteria | 22979 |
| 256 | Ga0207702_10002159 | 3300026078 | Bacteria | 18888 |
| 257 | Ga0207702_10016811 | 3300026078 | Bacteria | 6055 |
| 258 | Ga0207702_10282743 | 3300026078 | Bacteria | 1569 |
| 259 | Ga0207702_10332599 | 3300026078 | Bacteria | 1449 |
| 260 | Ga0207641_10057736 | 3300026088 | Bacteria | 3301 |
| 261 | Ga0207641_10149192 | 3300026088 | Bacteria | 2116 |
| 262 | Ga0207648_10034125 | 3300026089 | Bacteria | 4487 |
| 263 | Ga0207674_10044672 | 3300026116 | Bacteria | 4563 |
| 264 | Ga0207674_10050841 | 3300026116 | Unclassified | 4232 |
| 265 | Ga0207683_10117626 | 3300026121 | Bacteria | 2383 |
| 266 | Ga0207698_10053084 | 3300026142 | Unclassified | 3109 |
| 267 | Ga0207698_10391320 | 3300026142 | Bacteria | 1325 |
| 268 | Ga0268266_10022206 | 3300028379 | Bacteria | 5408 |
| 269 | Ga0268266_10226222 | 3300028379 | Unclassified | 1721 |
| 270 | Ga0268265_10368068 | 3300028380 | Bacteria | 1318 |
| 271 | Ga0265762_1003312 | 3300030760 | Bacteria | 2879 |
| 272 | Ga0265760_10001941 | 3300031090 | Bacteria | 6068 |
| 273 | Ga0265760_10008341 | 3300031090 | Unclassified | 2964 |
| 274 | Ga0265760_10013332 | 3300031090 | Unclassified | 2354 |
| 275 | Ga0265760_10090164 | 3300031090 | Unclassified | 959 |
| 276 | Ga0373926_0000619 | 3300035083 | Bacteria | 9661 |
| 277 | Ga0373926_0001291 | 3300035083 | Bacteria | 7536 |
| 278 | Ga0373926_0016989 | 3300035083 | Bacteria | 2494 |
| 279 | Ga0373923_0000647 | 3300035111 | Bacteria | 8780 |
| 280 | Ga0373923_0085299 | 3300035111 | Bacteria | 1375 |
| 281 | Ga0373923_0128564 | 3300035111 | Bacteria | 1137 |
| 282 | Ga0373932_0008710 | 3300035112 | Bacteria | 2428 |
| 283 | Ga0373936_0022795 | 3300035113 | Unclassified | 2438 |
| 284 | Ga0373936_0100627 | 3300035113 | Unclassified | 1219 |
| 285 | Ga0373945_0007772 | 3300035116 | Bacteria | 3479 |
| 286 | Ga0373945_0097966 | 3300035116 | Unclassified | 1144 |
| 287 | Ga0373943_0037427 | 3300035170 | Unclassified | 2329 |
| 288 | Ga0373946_0001175 | 3300035171 | Bacteria | 9070 |
| 289 | Ga0373946_0005052 | 3300035171 | Bacteria | 4751 |
| 290 | Ga0373946_0015445 | 3300035171 | Bacteria | 2896 |
| 291 | Ga0373942_0014049 | 3300035207 | Unclassified | 1933 |
| 292 | Ga0373924_0000052 | 3300035410 | Bacteria | 29706 |
| 293 | Ga0373931_0036110 | 3300035691 | Unclassified | 2574 |
| 294 | Ga0373931_0078884 | 3300035691 | Bacteria | 1812 |
| 295 | Ga0373931_0096074 | 3300035691 | Unclassified | 1659 |
| 296 | Ga0373935_0000269 | 3300035692 | Bacteria | 25655 |
| 297 | Ga0373935_0042142 | 3300035692 | Bacteria | 2870 |
| 298 | Ga0373935_0154003 | 3300035692 | Unclassified | 1562 |
| 299 | Ga0373935_0408044 | 3300035692 | Unclassified | 976 |
| 300 | Ga0373927_0005076 | 3300035695 | Bacteria | 9107 |
| 301 | Ga0373927_0005951 | 3300035695 | Bacteria | 8352 |
| 302 | Ga0373927_0126082 | 3300035695 | Unclassified | 1671 |
| 303 | Ga0373927_0235405 | 3300035695 | Unclassified | 1203 |
| 304 | Ga0373933_0168737 | 3300035724 | Unclassified | 1392 |
| 305 | Ga0373947_0000632 | 3300035725 | Bacteria | 20796 |
| 306 | Ga0373947_0022859 | 3300035725 | Unclassified | 3629 |
| 307 | Ga0373947_0066916 | 3300035725 | Bacteria | 2193 |
| 308 | Ga0373947_0089791 | 3300035725 | Bacteria | 1914 |
| 309 | Ga0373947_0620886 | 3300035725 | Unclassified | 737 |
| 310 | Ga0373937_0009898 | 3300036401 | Bacteria | 8312 |
| 311 | Ga0373937_0078351 | 3300036401 | Bacteria | 3054 |
| 312 | Ga0373937_0258866 | 3300036401 | Bacteria | 1641 |
| 313 | Ga0373937_0620360 | 3300036401 | Unclassified | 1026 |
| 314 | Ga0373925_0001716 | 3300037068 | Bacteria | 18475 |
| 315 | Ga0373925_0006247 | 3300037068 | Bacteria | 8786 |
| 316 | Ga0373925_0010629 | 3300037068 | Bacteria | 6675 |
| 317 | Ga0373925_0026873 | 3300037068 | Bacteria | 4213 |
| 318 | Ga0373925_0030798 | 3300037068 | Bacteria | 3939 |
| 319 | Ga0373925_0343328 | 3300037068 | Bacteria | 1211 |
| 320 | Ga0373925_1064683 | 3300037068 | Unclassified | 666 |
| 321 | Ga0395898_0364922 | 3300037466 | Unclassified | 1377 |
| 322 | Ga0395905_0431463 | 3300037471 | Bacteria | 1215 |
| 323 | Ga0436364_1151258 | 3300037853 | Bacteria | 35036 |
| 324 | Ga0436365_1035977 | 3300039437 | Bacteria | 3956 |
| 325 | Ga0436365_1116478 | 3300039437 | Bacteria | 7415 |
| 326 | Ga0436361_0133987 | 3300039447 | Bacteria | 1975 |
| 327 | Ga0436361_0400616 | 3300039447 | Bacteria | 83329 |
| 328 | Ga0436361_0672781 | 3300039447 | Unclassified | 3722 |
| 329 | Ga0436361_1219991 | 3300039447 | Bacteria | 1861 |
| 330 | Ga0436363_0031689 | 3300039450 | Bacteria | 1111 |
| 331 | Ga0436363_0166757 | 3300039450 | Bacteria | 1108 |
| 332 | Ga0436362_0539068 | 3300039453 | Bacteria | 6207 |
| 333 | Ga0436362_1273954 | 3300039453 | Unclassified | 833 |
| 334 | Ga0451577_0047198 | 3300042876 | Bacteria | 3851 |
| 335 | Ga0453683_0037003 | 3300044673 | Unclassified | 3070 |
| 336 | Ga0453683_0159854 | 3300044673 | Bacteria | 1425 |
| 337 | Ga0466963_0013283 | 3300044694 | Bacteria | 5054 |
| 338 | Ga0466964_0045685 | 3300044706 | Bacteria | 1783 |
| 339 | Ga0453684_0189029 | 3300044712 | Unclassified | 2410 |
| 340 | Ga0451576_0048982 | 3300045051 | Unclassified | 4434 |
| 341 | Ga0451576_0112174 | 3300045051 | Bacteria | 2838 |
| 342 | Ga0466967_0009451 | 3300045976 | Bacteria | 7233 |
| 343 | Ga0495592_0300982 | 3300046454 | Unclassified | 1042 |
| 344 | Ga0495603_0214508 | 3300046455 | Unclassified | 1111 |
| 345 | Ga0495629_0126204 | 3300046459 | Unclassified | 1782 |
| 346 | Ga0495651_0221463 | 3300046462 | Unclassified | 1309 |
| 347 | Ga0495580_0001878 | 3300046472 | Bacteria | 18487 |
| 348 | Ga0495580_0051162 | 3300046472 | Bacteria | 2921 |
| 349 | Ga0495580_0097544 | 3300046472 | Unclassified | 2044 |
| 350 | Ga0495580_0312608 | 3300046472 | Bacteria | 1069 |
| 351 | Ga0495582_0000858 | 3300046473 | Bacteria | 16887 |
| 352 | Ga0495662_0169145 | 3300046476 | Bacteria | 1077 |
| 353 | Ga0495608_0068672 | 3300046511 | Bacteria | 2317 |
| 354 | Ga0495630_0005548 | 3300046517 | Bacteria | 8904 |
| 355 | Ga0495630_0007052 | 3300046517 | Bacteria | 8008 |
| 356 | Ga0495665_0005064 | 3300046531 | Bacteria | 7105 |
| 357 | Ga0495665_0156945 | 3300046531 | Unclassified | 1187 |
| 358 | Ga0495587_0383716 | 3300046536 | Unclassified | 781 |
| 359 | Ga0495645_0081315 | 3300046543 | Unclassified | 2324 |
| 360 | Ga0495645_0446475 | 3300046543 | Unclassified | 816 |
| 361 | Ga0495635_0042083 | 3300046663 | Bacteria | 3156 |
| 362 | Ga0495657_0237443 | 3300046675 | Bacteria | 1101 |
| 363 | Ga0495646_0183834 | 3300046680 | Unclassified | 1146 |
| 364 | Ga0495647_0151352 | 3300046681 | Unclassified | 995 |
| 365 | Ga0495658_0158999 | 3300046683 | Unclassified | 1392 |
| 366 | Ga0495669_0117267 | 3300046684 | Bacteria | 1246 |
| 367 | Ga0495669_0269287 | 3300046684 | Unclassified | 819 |
| 368 | Ga0495581_0033735 | 3300047315 | Unclassified | 2963 |
| 369 | Ga0495674_0265743 | 3300047319 | Bacteria | 1409 |
| 370 | Ga0495674_0470356 | 3300047319 | Bacteria | 1008 |
| 371 | Ga0495676_0146067 | 3300047321 | Bacteria | 1689 |
| 372 | Ga0495680_0077285 | 3300047322 | Bacteria | 2522 |
| 373 | Ga0495675_0108908 | 3300047444 | Bacteria | 1730 |
| 374 | Ga0495593_0236190 | 3300047673 | Bacteria | 916 |
| 375 | Ga0495602_0199881 | 3300048088 | Bacteria | 1526 |
| 376 | Ga0496101_0081636 | 3300048904 | Unclassified | 2392 |
| 377 | Ga0496102_0139271 | 3300048905 | Unclassified | 2275 |
| 378 | Ga0496102_0162658 | 3300048905 | Bacteria | 2100 |
| 379 | Ga0496102_0880666 | 3300048905 | Unclassified | 817 |
| 380 | Ga0496103_0465201 | 3300048906 | Unclassified | 811 |
| 381 | Ga0496104_0087783 | 3300048907 | Unclassified | 2971 |
| 382 | Ga0496104_0119542 | 3300048907 | Unclassified | 2530 |
| 383 | Ga0496104_0504071 | 3300048907 | Bacteria | 1122 |
| 384 | Ga0496105_0040427 | 3300048908 | Bacteria | 3845 |
| 385 | Ga0496106_0672479 | 3300048909 | Bacteria | 826 |
| 386 | Ga0496109_0121848 | 3300048912 | Bacteria | 2430 |
| 387 | Ga0496110_0355258 | 3300048913 | Bacteria | 1335 |
| 388 | Ga0496111_0270300 | 3300048914 | Unclassified | 1261 |
| 389 | Ga0496112_0006548 | 3300048915 | Bacteria | 10248 |
| 390 | Ga0496112_0021016 | 3300048915 | Bacteria | 6200 |
| 391 | Ga0496112_0081996 | 3300048915 | Bacteria | 3190 |
| 392 | Ga0496112_0109408 | 3300048915 | Unclassified | 2733 |
| 393 | Ga0496112_0475652 | 3300048915 | Bacteria | 1186 |
| 394 | Ga0496113_0189290 | 3300048916 | Bacteria | 1633 |
| 395 | Ga0496115_0005746 | 3300048918 | Bacteria | 9033 |
| 396 | nmdc:mga05p37_42655_c1 | 3300050507 | Bacteria | 5576 |
| 397 | nmdc:mga0qj67_329635_c1 | 3300050509 | Bacteria | 1235 |
| 398 | nmdc:mga0n895_29788_c1 | 3300050512 | Bacteria | 5208 |
| 399 | nmdc:mga0n895_3159_c1 | 3300050512 | Bacteria | 13159 |
| 400 | nmdc:mga0rr50_240060_c1 | 3300050513 | Bacteria | 1502 |
| 401 | nmdc:mga0rr50_418030_c1 | 3300050513 | Bacteria | 1134 |
| 402 | nmdc:mga08x19_155575_c1 | 3300050514 | Bacteria | 1550 |
| 403 | nmdc:mga08x19_43093_c1 | 3300050514 | Bacteria | 2879 |
| 404 | nmdc:mga0a205_13919_c1 | 3300050515 | Bacteria | 7501 |
| 405 | Ga0495601_0003529 | 3300053077 | Bacteria | 8994 |
| 406 | Ga0495601_0078692 | 3300053077 | Bacteria | 2113 |
| 407 | Ga0495619_0024018 | 3300053085 | Unclassified | 3910 |
| 408 | Ga0495619_0387439 | 3300053085 | Bacteria | 966 |
| 409 | Ga0070717_10002444 | |||
| 410 | Ga0070676_10030501 | |||
| 411 | Ga0070683_100003279 | |||
| 412 | Ga0070683_100009472 | |||
| 413 | Ga0070683_100028899 | |||
| 414 | Ga0070680_100040194 | |||
| 415 | Ga0070680_100092261 | |||
| 416 | Ga0070682_100012956 | |||
| 417 | Ga0068868_100019218 | |||
| 418 | Ga0070660_100028322 | |||
| 419 | Ga0070689_100333999 | |||
| 420 | Ga0070691_10060767 | |||
| 421 | Ga0070661_100034634 | |||
| 422 | Ga0070671_100026671 | |||
| 423 | Ga0070688_100410138 | |||
| 424 | Ga0070667_100003568 | |||
| 425 | Ga0070709_10001531 | |||
| 426 | Ga0070709_10047227 | |||
| 427 | Ga0070709_10068400 | |||
| 428 | Ga0070709_10139271 | |||
| 429 | Ga0070709_10437668 | |||
| 430 | Ga0070714_100225152 | |||
| 431 | Ga0070714_100239120 | |||
| 432 | Ga0070714_100407088 | |||
| 433 | Ga0070713_100000125 | |||
| 434 | Ga0070713_100000509 | |||
| 435 | Ga0070713_100050310 | |||
| 436 | Ga0070713_100418845 | |||
| 437 | Ga0070713_100650239 | |||
| 438 | Ga0070710_10000598 | |||
| 439 | Ga0070711_100000408 | |||
| 440 | Ga0070711_100185417 | |||
| 441 | Ga0070711_100321961 | |||
| 442 | Ga0070711_100466350 | |||
| 443 | Ga0070694_100318872 | |||
| 444 | Ga0070708_100040958 | |||
| 445 | Ga0070708_100134528 | |||
| 446 | Ga0070708_100272703 | |||
| 447 | Ga0070663_100001583 | |||
| 448 | Ga0070663_100086467 | |||
| 449 | Ga0070678_100225180 | |||
| 450 | Ga0070681_10013120 | |||
| 451 | Ga0070681_10088148 | |||
| 452 | Ga0070681_10120698 | |||
| 453 | Ga0070681_10199524 | |||
| 454 | Ga0068867_100055226 | |||
| 455 | Ga0070706_100182184 | |||
| 456 | Ga0070706_100249969 | |||
| 457 | Ga0070707_100000050 | |||
| 458 | Ga0070707_100130804 | |||
| 459 | Ga0070707_100217838 | |||
| 460 | Ga0070707_100255294 | |||
| 461 | Ga0070707_100269396 | |||
| 462 | Ga0070707_100325771 | |||
| 463 | Ga0070698_100006869 | |||
| 464 | Ga0070698_100008870 | |||
| 465 | Ga0070698_100677898 | |||
| 466 | Ga0070699_100644620 | |||
| 467 | Ga0070679_100107684 | |||
| 468 | Ga0070684_100031666 | |||
| 469 | Ga0070684_100100654 | |||
| 470 | Ga0070684_100114557 | |||
| 471 | Ga0070697_100000326 | |||
| 472 | Ga0070697_100019394 | |||
| 473 | Ga0070697_100242209 | |||
| 474 | Ga0070686_100007732 | |||
| 475 | Ga0070696_100080164 | |||
| 476 | Ga0070693_100017058 | |||
| 477 | Ga0070693_100102681 | |||
| 478 | Ga0070665_100008719 | |||
| 479 | Ga0068855_100001421 | |||
| 480 | Ga0068855_100007086 | |||
| 481 | Ga0068855_100182725 | |||
| 482 | Ga0068855_100278221 | |||
| 483 | Ga0070664_100144107 | |||
| 484 | Ga0068857_100222429 | |||
| 485 | Ga0068857_100380858 | |||
| 486 | Ga0068854_100107881 | |||
| 487 | Ga0068856_100001532 | |||
| 488 | Ga0068856_100001724 | |||
| 489 | Ga0068856_100013557 | |||
| 490 | Ga0068856_100312904 | |||
| 491 | Ga0068856_100372413 | |||
| 492 | Ga0068856_100676913 | |||
| 493 | Ga0068864_100002560 | |||
| 494 | Ga0068864_100734343 | |||
| 495 | Ga0068863_100143065 | |||
| 496 | Ga0068863_100154788 | |||
| 497 | Ga0068858_100187257 | |||
| 498 | Ga0068862_100365351 | |||
| 499 | Ga0070717_10020392 | |||
| 500 | Ga0070717_10100743 | |||
| 501 | Ga0070717_10140585 | |||
| 502 | Ga0070717_10229468 | |||
| 503 | Ga0070717_10452154 | |||
| 504 | Ga0070717_10494684 | |||
| 505 | Ga0070715_10179053 | |||
| 506 | Ga0070716_100001646 | |||
| 507 | Ga0070716_100002081 | |||
| 508 | Ga0070716_100034791 | |||
| 509 | Ga0070716_100154491 | |||
| 510 | Ga0070712_100000067 | |||
| 511 | Ga0070712_100000134 | |||
| 512 | Ga0070712_100023999 | |||
| 513 | Ga0097621_100000034 | |||
| 514 | Ga0097621_100052269 | |||
| 515 | Ga0097621_100151459 | |||
| 516 | Ga0068871_100000819 | |||
| 517 | Ga0068871_100468502 | |||
| 518 | Ga0075433_10404487 | |||
| 519 | Ga0075434_100006014 | |||
| 520 | Ga0075434_100035447 | |||
| 521 | Ga0075434_100232600 | |||
| 522 | Ga0068865_100027442 | |||
| 523 | Ga0075436_100160032 | |||
| 524 | Ga0075435_100368740 | |||
| 525 | Ga0099794_10020138 | |||
| 526 | Ga0099794_10118333 | |||
| 527 | Ga0099795_10113786 | |||
| 528 | Ga0105240_10004264 | |||
| 529 | Ga0105240_10047360 | |||
| 530 | Ga0105240_10349200 | |||
| 531 | Ga0105247_10011209 | |||
| 532 | Ga0105247_10396412 | |||
| 533 | Ga0114129_10074350 | |||
| 534 | Ga0105243_10073986 | |||
| 535 | Ga0105243_10708642 | |||
| 536 | Ga0105241_10039967 | |||
| 537 | Ga0105241_10545721 | |||
| 538 | Ga0105248_10011027 | |||
| 539 | Ga0105248_10069980 | |||
| 540 | Ga0105237_10174261 | |||
| 541 | Ga0105238_10007339 | |||
| 542 | Ga0105238_10034553 | |||
| 543 | Ga0105238_10365092 | |||
| 544 | Ga0105239_10021480 | |||
| 545 | Ga0105239_10203956 | |||
| 546 | Ga0105239_10204751 | |||
| 547 | Ga0105239_10270453 | |||
| 548 | Ga0157373_10007167 | |||
| 549 | Ga0157371_10049246 | |||
| 550 | Ga0157371_10138302 | |||
| 551 | Ga0157370_10002484 | |||
| 552 | Ga0157370_10498322 | |||
| 553 | Ga0157370_10540440 | |||
| 554 | Ga0157369_10010669 | |||
| 555 | Ga0157369_10119097 | |||
| 556 | Ga0157369_10203064 | |||
| 557 | Ga0157369_10228542 | |||
| 558 | Ga0157369_10792362 | |||
| 559 | Ga0157374_10000249 | |||
| 560 | Ga0157374_10024162 | |||
| 561 | Ga0157374_10128064 | |||
| 562 | Ga0157374_10372138 | |||
| 563 | Ga0157374_10522975 | |||
| 564 | Ga0157378_10000008 | |||
| 565 | Ga0157378_10506767 | |||
| 566 | Ga0157378_10653328 | |||
| 567 | Ga0163162_10156206 | |||
| 568 | Ga0157372_10000436 | |||
| 569 | Ga0157372_10000992 | |||
| 570 | Ga0157375_10024068 | |||
| 571 | Ga0157375_10110043 | |||
| 572 | Ga0157379_10069936 | |||
| 573 | Ga0157379_10214893 | |||
| 574 | Ga0157376_10001493 | |||
| 575 | Ga0157376_10002140 | |||
| 576 | Ga0157376_10062070 | |||
| 577 | Ga0213872_10001338 | |||
| 578 | Ga0213872_10001709 | |||
| 579 | Ga0213876_10056935 | |||
| 580 | Ga0213876_10137196 | |||
| 581 | Ga0213875_10009771 | |||
| 582 | Ga0224572_1011965 | |||
| 583 | Ga0228598_1000303 | |||
| 584 | Ga0228598_1001702 | |||
| 585 | Ga0228598_1005197 | |||
| 586 | Ga0228598_1011880 | |||
| 587 | Ga0207692_10003006 | |||
| 588 | Ga0207692_10024007 | |||
| 589 | Ga0207710_10055988 | |||
| 590 | Ga0207680_10072352 | |||
| 591 | Ga0207685_10020451 | |||
| 592 | Ga0207699_10001629 | |||
| 593 | Ga0207699_10169371 | |||
| 594 | Ga0207645_10015810 | |||
| 595 | Ga0207684_10174497 | |||
| 596 | Ga0207684_10174853 | |||
| 597 | Ga0207654_10020050 | |||
| 598 | Ga0207654_10124108 | |||
| 599 | Ga0207707_10015200 | |||
| 600 | Ga0207707_10030578 | |||
| 601 | Ga0207707_10097307 | |||
| 602 | Ga0207707_10137709 | |||
| 603 | Ga0207695_10005455 | |||
| 604 | Ga0207695_10164711 | |||
| 605 | Ga0207695_10645636 | |||
| 606 | Ga0207695_10729782 | |||
| 607 | Ga0207671_10192968 | |||
| 608 | Ga0207693_10000051 | |||
| 609 | Ga0207693_10000252 | |||
| 610 | Ga0207693_10300000 | |||
| 611 | Ga0207693_10515350 | |||
| 612 | Ga0207663_10001998 | |||
| 613 | Ga0207663_10280277 | |||
| 614 | Ga0207660_10082600 | |||
| 615 | Ga0207657_10004369 | |||
| 616 | Ga0207646_10000037 | |||
| 617 | Ga0207646_10003275 | |||
| 618 | Ga0207646_10076627 | |||
| 619 | Ga0207646_10105194 | |||
| 620 | Ga0207646_10156735 | |||
| 621 | Ga0207646_10231854 | |||
| 622 | Ga0207646_10318355 | |||
| 623 | Ga0207646_10341606 | |||
| 624 | Ga0207646_10603610 | |||
| 625 | Ga0207687_10000141 | |||
| 626 | Ga0207700_10000381 | |||
| 627 | Ga0207700_10002753 | |||
| 628 | Ga0207700_10005864 | |||
| 629 | Ga0207700_10008629 | |||
| 630 | Ga0207700_10088286 | |||
| 631 | Ga0207700_10177776 | |||
| 632 | Ga0207664_10047411 | |||
| 633 | Ga0207664_10066497 | |||
| 634 | Ga0207664_10305755 | |||
| 635 | Ga0207644_10017386 | |||
| 636 | Ga0207706_10000296 | |||
| 637 | Ga0207709_10060019 | |||
| 638 | Ga0207704_10029307 | |||
| 639 | Ga0207665_10003709 | |||
| 640 | Ga0207665_10009975 | |||
| 641 | Ga0207665_10014915 | |||
| 642 | Ga0207665_10031223 | |||
| 643 | Ga0207665_10144117 | |||
| 644 | Ga0207665_10149897 | |||
| 645 | Ga0207665_10253604 | |||
| 646 | Ga0207665_10369448 | |||
| 647 | Ga0207711_10044463 | |||
| 648 | Ga0207711_10074268 | |||
| 649 | Ga0207711_10160065 | |||
| 650 | Ga0207661_10001952 | |||
| 651 | Ga0207661_10005239 | |||
| 652 | Ga0207679_10162206 | |||
| 653 | Ga0207667_10001192 | |||
| 654 | Ga0207667_10001239 | |||
| 655 | Ga0207667_10071700 | |||
| 656 | Ga0207668_10314840 | |||
| 657 | Ga0207640_10229132 | |||
| 658 | Ga0207677_10039642 | |||
| 659 | Ga0207677_10233015 | |||
| 660 | Ga0207703_10144748 | |||
| 661 | Ga0207639_10357226 | |||
| 662 | Ga0207678_10000903 | |||
| 663 | Ga0207702_10001513 | |||
| 664 | Ga0207702_10002159 | |||
| 665 | Ga0207702_10016811 | |||
| 666 | Ga0207702_10282743 | |||
| 667 | Ga0207702_10332599 | |||
| 668 | Ga0207641_10057736 | |||
| 669 | Ga0207641_10149192 | |||
| 670 | Ga0207648_10034125 | |||
| 671 | Ga0207674_10044672 | |||
| 672 | Ga0207674_10050841 | |||
| 673 | Ga0207683_10117626 | |||
| 674 | Ga0207698_10053084 | |||
| 675 | Ga0207698_10391320 | |||
| 676 | Ga0268266_10022206 | |||
| 677 | Ga0268266_10226222 | |||
| 678 | Ga0268265_10368068 | |||
| 679 | Ga0265762_1003312 | |||
| 680 | Ga0265760_10001941 | |||
| 681 | Ga0265760_10008341 | |||
| 682 | Ga0265760_10013332 | |||
| 683 | Ga0265760_10090164 | |||
| 684 | Ga0373926_0000619 | |||
| 685 | Ga0373926_0001291 | |||
| 686 | Ga0373926_0016989 | |||
| 687 | Ga0373923_0000647 | |||
| 688 | Ga0373923_0085299 | |||
| 689 | Ga0373923_0128564 | |||
| 690 | Ga0373932_0008710 | |||
| 691 | Ga0373936_0022795 | |||
| 692 | Ga0373936_0100627 | |||
| 693 | Ga0373945_0007772 | |||
| 694 | Ga0373945_0097966 | |||
| 695 | Ga0373943_0037427 | |||
| 696 | Ga0373946_0001175 | |||
| 697 | Ga0373946_0005052 | |||
| 698 | Ga0373946_0015445 | |||
| 699 | Ga0373942_0014049 | |||
| 700 | Ga0373924_0000052 | |||
| 701 | Ga0373931_0036110 | |||
| 702 | Ga0373931_0078884 | |||
| 703 | Ga0373931_0096074 | |||
| 704 | Ga0373935_0000269 | |||
| 705 | Ga0373935_0042142 | |||
| 706 | Ga0373935_0154003 | |||
| 707 | Ga0373935_0408044 | |||
| 708 | Ga0373927_0005076 | |||
| 709 | Ga0373927_0005951 | |||
| 710 | Ga0373927_0126082 | |||
| 711 | Ga0373927_0235405 | |||
| 712 | Ga0373933_0168737 | |||
| 713 | Ga0373947_0000632 | |||
| 714 | Ga0373947_0022859 | |||
| 715 | Ga0373947_0066916 | |||
| 716 | Ga0373947_0089791 | |||
| 717 | Ga0373947_0620886 | |||
| 718 | Ga0373937_0009898 | |||
| 719 | Ga0373937_0078351 | |||
| 720 | Ga0373937_0258866 | |||
| 721 | Ga0373937_0620360 | |||
| 722 | Ga0373925_0001716 | |||
| 723 | Ga0373925_0006247 | |||
| 724 | Ga0373925_0010629 | |||
| 725 | Ga0373925_0026873 | |||
| 726 | Ga0373925_0030798 | |||
| 727 | Ga0373925_0343328 | |||
| 728 | Ga0373925_1064683 | |||
| 729 | Ga0395898_0364922 | |||
| 730 | Ga0395905_0431463 | |||
| 731 | Ga0436364_1151258 | |||
| 732 | Ga0436365_1035977 | |||
| 733 | Ga0436365_1116478 | |||
| 734 | Ga0436361_0133987 | |||
| 735 | Ga0436361_0400616 | |||
| 736 | Ga0436361_0672781 | |||
| 737 | Ga0436361_1219991 | |||
| 738 | Ga0436363_0031689 | |||
| 739 | Ga0436363_0166757 | |||
| 740 | Ga0436362_0539068 | |||
| 741 | Ga0436362_1273954 | |||
| 742 | Ga0451577_0047198 | |||
| 743 | Ga0453683_0037003 | |||
| 744 | Ga0453683_0159854 | |||
| 745 | Ga0466963_0013283 | |||
| 746 | Ga0466964_0045685 | |||
| 747 | Ga0453684_0189029 | |||
| 748 | Ga0451576_0048982 | |||
| 749 | Ga0451576_0112174 | |||
| 750 | Ga0466967_0009451 | |||
| 751 | Ga0495592_0300982 | |||
| 752 | Ga0495603_0214508 | |||
| 753 | Ga0495629_0126204 | |||
| 754 | Ga0495651_0221463 | |||
| 755 | Ga0495580_0001878 | |||
| 756 | Ga0495580_0051162 | |||
| 757 | Ga0495580_0097544 | |||
| 758 | Ga0495580_0312608 | |||
| 759 | Ga0495582_0000858 | |||
| 760 | Ga0495662_0169145 | |||
| 761 | Ga0495608_0068672 | |||
| 762 | Ga0495630_0005548 | |||
| 763 | Ga0495630_0007052 | |||
| 764 | Ga0495665_0005064 | |||
| 765 | Ga0495665_0156945 | |||
| 766 | Ga0495587_0383716 | |||
| 767 | Ga0495645_0081315 | |||
| 768 | Ga0495645_0446475 | |||
| 769 | Ga0495635_0042083 | |||
| 770 | Ga0495657_0237443 | |||
| 771 | Ga0495646_0183834 | |||
| 772 | Ga0495647_0151352 | |||
| 773 | Ga0495658_0158999 | |||
| 774 | Ga0495669_0117267 | |||
| 775 | Ga0495669_0269287 | |||
| 776 | Ga0495581_0033735 | |||
| 777 | Ga0495674_0265743 | |||
| 778 | Ga0495674_0470356 | |||
| 779 | Ga0495676_0146067 | |||
| 780 | Ga0495680_0077285 | |||
| 781 | Ga0495675_0108908 | |||
| 782 | Ga0495593_0236190 | |||
| 783 | Ga0495602_0199881 | |||
| 784 | Ga0496101_0081636 | |||
| 785 | Ga0496102_0139271 | |||
| 786 | Ga0496102_0162658 | |||
| 787 | Ga0496102_0880666 | |||
| 788 | Ga0496103_0465201 | |||
| 789 | Ga0496104_0087783 | |||
| 790 | Ga0496104_0119542 | |||
| 791 | Ga0496104_0504071 | |||
| 792 | Ga0496105_0040427 | |||
| 793 | Ga0496106_0672479 | |||
| 794 | Ga0496109_0121848 | |||
| 795 | Ga0496110_0355258 | |||
| 796 | Ga0496111_0270300 | |||
| 797 | Ga0496112_0006548 | |||
| 798 | Ga0496112_0021016 | |||
| 799 | Ga0496112_0081996 | |||
| 800 | Ga0496112_0109408 | |||
| 801 | Ga0496112_0475652 | |||
| 802 | Ga0496113_0189290 | |||
| 803 | Ga0496115_0005746 | |||
| 804 | nmdc:mga05p37_42655_c1 | |||
| 805 | nmdc:mga0qj67_329635_c1 | |||
| 806 | nmdc:mga0n895_29788_c1 | |||
| 807 | nmdc:mga0n895_3159_c1 | |||
| 808 | nmdc:mga0rr50_240060_c1 | |||
| 809 | nmdc:mga0rr50_418030_c1 | |||
| 810 | nmdc:mga08x19_155575_c1 | |||
| 811 | nmdc:mga08x19_43093_c1 | |||
| 812 | nmdc:mga0a205_13919_c1 | |||
| 813 | Ga0495601_0003529 | |||
| 814 | Ga0495601_0078692 | |||
| 815 | Ga0495619_0024018 | |||
| 816 | Ga0495619_0387439 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cgx-assembly1.cif.gz_A | crystal structure of putative nucleotide-diphospho-sugar transferase (yp_389115.1) from desulfovibrio desulfuricans g20 at 1.90 a resolution | 0.8929 | 6 | 227 |
| 3cgx-assembly1.cif.gz_A | crystal structure of putative nucleotide-diphospho-sugar transferase (yp_389115.1) from desulfovibrio desulfuricans g20 at 1.90 a resolution | 0.8567 | 6 | 227 |
| 2i5e-assembly1.cif.gz_B | crystal structure of a protein of unknown function mm2497 from methanosarcina mazei go1, probable nucleotidyltransferase | 0.8563 | 7 | 202 |
| 7p97-assembly2.cif.gz_BBB | structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound | 0.8147 | 9 | 204 |
| 7p97-assembly2.cif.gz_BBB | structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound | 0.7995 | 9 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cgxA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8734 | 6 | 227 | 3.90.550.10 |
| af_O06406_6_218_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8649 | 9 | 220 | 3.90.550.10 |
| 3cgxA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8552 | 6 | 227 | 3.90.550.10 |
| af_O06406_6_218_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8535 | 9 | 220 | 3.90.550.10 |
| 2i5eB01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8241 | 8 | 191 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8Z0D1-F1-model_v4 | Glycosyltransferase | 0.9775 | 4 | 227 |
GO:0016740
|
| AF-A0A2V8Z0D1-F1-model_v4 | Glycosyltransferase | 0.969 | 4 | 227 |
GO:0016740
|
| AF-A0A2V9ACN5-F1-model_v4 | Glycosyltransferase | 0.9594 | 4 | 227 |
GO:0016740
|
| AF-A0A1Q7N479-F1-model_v4 | Glycosyltransferase | 0.9568 | 69 | 227 |
|
| AF-A0A534ZK72-F1-model_v4 | DUF2064 domain-containing protein | 0.9547 | 1 | 224 |
|