F436687

General Info

Members Datasets Scaffolds Average Seq Length
408 200 816 240

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10002444|Ga0070717_1000244411
Length 283
Sequence MEPTQLLEQSHFFASYIIAQQSMKSASETVVRSSGSDRVLVIMAKAPRPGAVKTRLAASLSHAAVTDFYCCLLDDTLALARSLKLKLGDVEVAIMCPESDVNELAQLAGSHSGNSEASVVAQKGEGLAAGLTSVFAHFVDSHQRRIIAFNSDSPHLPSSVLEDAFETLAAHDVVVGPTHDGGYYLVGAKASHPTLFASDGLGTSSALERLLSRARALELSVGFAAPFYDIDVADDLTRLAEELRLAPARAPRTAAWLKEWELAATHSRTSPRTRSRTGKEELE

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.9
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 30.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10002444 3300006028 Bacteria 13112
2 Ga0070676_10030501 3300005328 Bacteria 3075
3 Ga0070683_100003279 3300005329 Bacteria 13087
4 Ga0070683_100009472 3300005329 Bacteria 8331
5 Ga0070683_100028899 3300005329 Bacteria 5014
6 Ga0070680_100040194 3300005336 Unclassified 3786
7 Ga0070680_100092261 3300005336 Unclassified 2508
8 Ga0070682_100012956 3300005337 Bacteria 4787
9 Ga0068868_100019218 3300005338 Bacteria 5118
10 Ga0070660_100028322 3300005339 Bacteria 4190
11 Ga0070689_100333999 3300005340 Bacteria 1268
12 Ga0070691_10060767 3300005341 Bacteria 1817
13 Ga0070661_100034634 3300005344 Unclassified 3663
14 Ga0070671_100026671 3300005355 Unclassified 4751
15 Ga0070688_100410138 3300005365 Bacteria 1005
16 Ga0070667_100003568 3300005367 Bacteria 13255
17 Ga0070709_10001531 3300005434 Bacteria 12480
18 Ga0070709_10047227 3300005434 Bacteria 2681
19 Ga0070709_10068400 3300005434 Bacteria 2284
20 Ga0070709_10139271 3300005434 Unclassified 1665
21 Ga0070709_10437668 3300005434 Bacteria 983
22 Ga0070714_100225152 3300005435 Unclassified 1726
23 Ga0070714_100239120 3300005435 Unclassified 1675
24 Ga0070714_100407088 3300005435 Bacteria 1287
25 Ga0070713_100000125 3300005436 Bacteria 50351
26 Ga0070713_100000509 3300005436 Bacteria 24860
27 Ga0070713_100050310 3300005436 Unclassified 3442
28 Ga0070713_100418845 3300005436 Unclassified 1253
29 Ga0070713_100650239 3300005436 Unclassified 1004
30 Ga0070710_10000598 3300005437 Bacteria 17193
31 Ga0070711_100000408 3300005439 Bacteria 22286
32 Ga0070711_100185417 3300005439 Unclassified 1595
33 Ga0070711_100321961 3300005439 Bacteria 1235
34 Ga0070711_100466350 3300005439 Unclassified 1036
35 Ga0070694_100318872 3300005444 Unclassified 1196
36 Ga0070708_100040958 3300005445 Bacteria 4059
37 Ga0070708_100134528 3300005445 Bacteria 2289
38 Ga0070708_100272703 3300005445 Unclassified 1591
39 Ga0070663_100001583 3300005455 Bacteria 12524
40 Ga0070663_100086467 3300005455 Bacteria 2315
41 Ga0070678_100225180 3300005456 Bacteria 1561
42 Ga0070681_10013120 3300005458 Bacteria 8231
43 Ga0070681_10088148 3300005458 Bacteria 3055
44 Ga0070681_10120698 3300005458 Unclassified 2556
45 Ga0070681_10199524 3300005458 Bacteria 1919
46 Ga0068867_100055226 3300005459 Bacteria 2936
47 Ga0070706_100182184 3300005467 Bacteria 1961
48 Ga0070706_100249969 3300005467 Bacteria 1655
49 Ga0070707_100000050 3300005468 Bacteria 102427
50 Ga0070707_100130804 3300005468 Unclassified 2440
51 Ga0070707_100217838 3300005468 Bacteria 1860
52 Ga0070707_100255294 3300005468 Bacteria 1706
53 Ga0070707_100269396 3300005468 Bacteria 1656
54 Ga0070707_100325771 3300005468 Bacteria 1493
55 Ga0070698_100006869 3300005471 Bacteria 12328
56 Ga0070698_100008870 3300005471 Bacteria 10813
57 Ga0070698_100677898 3300005471 Unclassified 972
58 Ga0070699_100644620 3300005518 Bacteria 967
59 Ga0070679_100107684 3300005530 Bacteria 2773
60 Ga0070684_100031666 3300005535 Bacteria 4504
61 Ga0070684_100100654 3300005535 Bacteria 2581
62 Ga0070684_100114557 3300005535 Bacteria 2420
63 Ga0070697_100000326 3300005536 Bacteria 37671
64 Ga0070697_100019394 3300005536 Bacteria 5372
65 Ga0070697_100242209 3300005536 Unclassified 1540
66 Ga0070686_100007732 3300005544 Bacteria 6010
67 Ga0070696_100080164 3300005546 Bacteria 2310
68 Ga0070693_100017058 3300005547 Bacteria 3768
69 Ga0070693_100102681 3300005547 Unclassified 1745
70 Ga0070665_100008719 3300005548 Bacteria 10262
71 Ga0068855_100001421 3300005563 Bacteria 29751
72 Ga0068855_100007086 3300005563 Bacteria 13598
73 Ga0068855_100182725 3300005563 Bacteria 2370
74 Ga0068855_100278221 3300005563 Bacteria 1859
75 Ga0070664_100144107 3300005564 Bacteria 2100
76 Ga0068857_100222429 3300005577 Bacteria 1725
77 Ga0068857_100380858 3300005577 Bacteria 1310
78 Ga0068854_100107881 3300005578 Bacteria 2096
79 Ga0068856_100001532 3300005614 Bacteria 24221
80 Ga0068856_100001724 3300005614 Bacteria 22874
81 Ga0068856_100013557 3300005614 Bacteria 7892
82 Ga0068856_100312904 3300005614 Unclassified 1588
83 Ga0068856_100372413 3300005614 Bacteria 1447
84 Ga0068856_100676913 3300005614 Bacteria 1052
85 Ga0068864_100002560 3300005618 Bacteria 15015
86 Ga0068864_100734343 3300005618 Bacteria 967
87 Ga0068863_100143065 3300005841 Unclassified 2287
88 Ga0068863_100154788 3300005841 Bacteria 2194
89 Ga0068858_100187257 3300005842 Bacteria 1955
90 Ga0068862_100365351 3300005844 Bacteria 1342
91 Ga0070717_10020392 3300006028 Bacteria 5213
92 Ga0070717_10100743 3300006028 Bacteria 2453
93 Ga0070717_10140585 3300006028 Unclassified 2082
94 Ga0070717_10229468 3300006028 Bacteria 1634
95 Ga0070717_10452154 3300006028 Unclassified 1158
96 Ga0070717_10494684 3300006028 Bacteria 1105
97 Ga0070715_10179053 3300006163 Unclassified 1062
98 Ga0070716_100001646 3300006173 Bacteria 10079
99 Ga0070716_100002081 3300006173 Bacteria 9175
100 Ga0070716_100034791 3300006173 Unclassified 2765
101 Ga0070716_100154491 3300006173 Unclassified 1480
102 Ga0070712_100000067 3300006175 Bacteria 53056
103 Ga0070712_100000134 3300006175 Bacteria 38860
104 Ga0070712_100023999 3300006175 Bacteria 4035
105 Ga0097621_100000034 3300006237 Bacteria 69159
106 Ga0097621_100052269 3300006237 Bacteria 3328
107 Ga0097621_100151459 3300006237 Unclassified 1989
108 Ga0068871_100000819 3300006358 Bacteria 20831
109 Ga0068871_100468502 3300006358 Unclassified 1131
110 Ga0075433_10404487 3300006852 Unclassified 1204
111 Ga0075434_100006014 3300006871 Bacteria 11103
112 Ga0075434_100035447 3300006871 Bacteria 4933
113 Ga0075434_100232600 3300006871 Bacteria 1863
114 Ga0068865_100027442 3300006881 Bacteria 3762
115 Ga0075436_100160032 3300006914 Bacteria 1587
116 Ga0075435_100368740 3300007076 Bacteria 1232
117 Ga0099794_10020138 3300007265 Unclassified 3016
118 Ga0099794_10118333 3300007265 Unclassified 1331
119 Ga0099795_10113786 3300007788 Unclassified 1075
120 Ga0105240_10004264 3300009093 Bacteria 21862
121 Ga0105240_10047360 3300009093 Bacteria 5441
122 Ga0105240_10349200 3300009093 Bacteria 1679
123 Ga0105247_10011209 3300009101 Bacteria 5406
124 Ga0105247_10396412 3300009101 Unclassified 982
125 Ga0114129_10074350 3300009147 Unclassified 4733
126 Ga0105243_10073986 3300009148 Bacteria 2762
127 Ga0105243_10708642 3300009148 Unclassified 982
128 Ga0105241_10039967 3300009174 Unclassified 3539
129 Ga0105241_10545721 3300009174 Unclassified 1040
130 Ga0105248_10011027 3300009177 Bacteria 9969
131 Ga0105248_10069980 3300009177 Unclassified 3940
132 Ga0105237_10174261 3300009545 Bacteria 2151
133 Ga0105238_10007339 3300009551 Bacteria 11039
134 Ga0105238_10034553 3300009551 Bacteria 5143
135 Ga0105238_10365092 3300009551 Bacteria 1434
136 Ga0105239_10021480 3300010375 Bacteria 7116
137 Ga0105239_10203956 3300010375 Unclassified 2216
138 Ga0105239_10204751 3300010375 Bacteria 2211
139 Ga0105239_10270453 3300010375 Bacteria 1911
140 Ga0157373_10007167 3300013100 Bacteria 8319
141 Ga0157371_10049246 3300013102 Bacteria 2994
142 Ga0157371_10138302 3300013102 Bacteria 1735
143 Ga0157370_10002484 3300013104 Bacteria 22231
144 Ga0157370_10498322 3300013104 Unclassified 1119
145 Ga0157370_10540440 3300013104 Unclassified 1069
146 Ga0157369_10010669 3300013105 Bacteria 10456
147 Ga0157369_10119097 3300013105 Unclassified 2802
148 Ga0157369_10203064 3300013105 Bacteria 2080
149 Ga0157369_10228542 3300013105 Bacteria 1946
150 Ga0157369_10792362 3300013105 Unclassified 974
151 Ga0157374_10000249 3300013296 Bacteria 49808
152 Ga0157374_10024162 3300013296 Bacteria 5446
153 Ga0157374_10128064 3300013296 Unclassified 2455
154 Ga0157374_10372138 3300013296 Bacteria 1422
155 Ga0157374_10522975 3300013296 Bacteria 1192
156 Ga0157378_10000008 3300013297 Bacteria 162605
157 Ga0157378_10506767 3300013297 Unclassified 1206
158 Ga0157378_10653328 3300013297 Unclassified 1067
159 Ga0163162_10156206 3300013306 Bacteria 2401
160 Ga0157372_10000436 3300013307 Bacteria 45959
161 Ga0157372_10000992 3300013307 Bacteria 31047
162 Ga0157375_10024068 3300013308 Bacteria 5630
163 Ga0157375_10110043 3300013308 Bacteria 2852
164 Ga0157379_10069936 3300014968 Bacteria 3140
165 Ga0157379_10214893 3300014968 Unclassified 1741
166 Ga0157376_10001493 3300014969 Bacteria 15434
167 Ga0157376_10002140 3300014969 Bacteria 13309
168 Ga0157376_10062070 3300014969 Bacteria 3144
169 Ga0213872_10001338 3300021361 Bacteria 16267
170 Ga0213872_10001709 3300021361 Bacteria 13824
171 Ga0213876_10056935 3300021384 Bacteria 2064
172 Ga0213876_10137196 3300021384 Unclassified 1301
173 Ga0213875_10009771 3300021388 Bacteria 4843
174 Ga0224572_1011965 3300024225 Bacteria 1644
175 Ga0228598_1000303 3300024227 Bacteria 9589
176 Ga0228598_1001702 3300024227 Bacteria 4809
177 Ga0228598_1005197 3300024227 Unclassified 2734
178 Ga0228598_1011880 3300024227 Bacteria 1731
179 Ga0207692_10003006 3300025898 Bacteria 6536
180 Ga0207692_10024007 3300025898 Bacteria 2828
181 Ga0207710_10055988 3300025900 Bacteria 1779
182 Ga0207680_10072352 3300025903 Bacteria 2140
183 Ga0207685_10020451 3300025905 Unclassified 2200
184 Ga0207699_10001629 3300025906 Bacteria 10643
185 Ga0207699_10169371 3300025906 Unclassified 1460
186 Ga0207645_10015810 3300025907 Bacteria 5001
187 Ga0207684_10174497 3300025910 Unclassified 1853
188 Ga0207684_10174853 3300025910 Bacteria 1851
189 Ga0207654_10020050 3300025911 Unclassified 3538
190 Ga0207654_10124108 3300025911 Unclassified 1626
191 Ga0207707_10015200 3300025912 Bacteria 6702
192 Ga0207707_10030578 3300025912 Bacteria 4711
193 Ga0207707_10097307 3300025912 Unclassified 2572
194 Ga0207707_10137709 3300025912 Bacteria 2134
195 Ga0207695_10005455 3300025913 Bacteria 16847
196 Ga0207695_10164711 3300025913 Unclassified 2146
197 Ga0207695_10645636 3300025913 Unclassified 939
198 Ga0207695_10729782 3300025913 Unclassified 871
199 Ga0207671_10192968 3300025914 Bacteria 1589
200 Ga0207693_10000051 3300025915 Bacteria 99220
201 Ga0207693_10000252 3300025915 Bacteria 49630
202 Ga0207693_10300000 3300025915 Unclassified 1259
203 Ga0207693_10515350 3300025915 Unclassified 933
204 Ga0207663_10001998 3300025916 Bacteria 9690
205 Ga0207663_10280277 3300025916 Unclassified 1238
206 Ga0207660_10082600 3300025917 Bacteria 2364
207 Ga0207657_10004369 3300025919 Bacteria 14960
208 Ga0207646_10000037 3300025922 Bacteria 196362
209 Ga0207646_10003275 3300025922 Bacteria 18448
210 Ga0207646_10076627 3300025922 Bacteria 2988
211 Ga0207646_10105194 3300025922 Unclassified 2531
212 Ga0207646_10156735 3300025922 Bacteria 2054
213 Ga0207646_10231854 3300025922 Bacteria 1668
214 Ga0207646_10318355 3300025922 Unclassified 1406
215 Ga0207646_10341606 3300025922 Bacteria 1353
216 Ga0207646_10603610 3300025922 Bacteria 985
217 Ga0207687_10000141 3300025927 Bacteria 48006
218 Ga0207700_10000381 3300025928 Bacteria 25771
219 Ga0207700_10002753 3300025928 Bacteria 10131
220 Ga0207700_10005864 3300025928 Bacteria 7384
221 Ga0207700_10008629 3300025928 Bacteria 6326
222 Ga0207700_10088286 3300025928 Bacteria 2441
223 Ga0207700_10177776 3300025928 Bacteria 1780
224 Ga0207664_10047411 3300025929 Unclassified 3375
225 Ga0207664_10066497 3300025929 Bacteria 2890
226 Ga0207664_10305755 3300025929 Unclassified 1400
227 Ga0207644_10017386 3300025931 Unclassified 4855
228 Ga0207706_10000296 3300025933 Bacteria 54072
229 Ga0207709_10060019 3300025935 Bacteria 2370
230 Ga0207704_10029307 3300025938 Bacteria 3067
231 Ga0207665_10003709 3300025939 Bacteria 10199
232 Ga0207665_10009975 3300025939 Bacteria 6234
233 Ga0207665_10014915 3300025939 Bacteria 5105
234 Ga0207665_10031223 3300025939 Unclassified 3524
235 Ga0207665_10144117 3300025939 Unclassified 1701
236 Ga0207665_10149897 3300025939 Bacteria 1670
237 Ga0207665_10253604 3300025939 Unclassified 1301
238 Ga0207665_10369448 3300025939 Unclassified 1086
239 Ga0207711_10044463 3300025941 Bacteria 3791
240 Ga0207711_10074268 3300025941 Bacteria 2957
241 Ga0207711_10160065 3300025941 Bacteria 2037
242 Ga0207661_10001952 3300025944 Bacteria 14178
243 Ga0207661_10005239 3300025944 Bacteria 9117
244 Ga0207679_10162206 3300025945 Bacteria 1831
245 Ga0207667_10001192 3300025949 Bacteria 32605
246 Ga0207667_10001239 3300025949 Bacteria 32026
247 Ga0207667_10071700 3300025949 Bacteria 3601
248 Ga0207668_10314840 3300025972 Unclassified 1297
249 Ga0207640_10229132 3300025981 Bacteria 1428
250 Ga0207677_10039642 3300026023 Bacteria 3099
251 Ga0207677_10233015 3300026023 Unclassified 1485
252 Ga0207703_10144748 3300026035 Bacteria 2066
253 Ga0207639_10357226 3300026041 Bacteria 1306
254 Ga0207678_10000903 3300026067 Bacteria 27239
255 Ga0207702_10001513 3300026078 Bacteria 22979
256 Ga0207702_10002159 3300026078 Bacteria 18888
257 Ga0207702_10016811 3300026078 Bacteria 6055
258 Ga0207702_10282743 3300026078 Bacteria 1569
259 Ga0207702_10332599 3300026078 Bacteria 1449
260 Ga0207641_10057736 3300026088 Bacteria 3301
261 Ga0207641_10149192 3300026088 Bacteria 2116
262 Ga0207648_10034125 3300026089 Bacteria 4487
263 Ga0207674_10044672 3300026116 Bacteria 4563
264 Ga0207674_10050841 3300026116 Unclassified 4232
265 Ga0207683_10117626 3300026121 Bacteria 2383
266 Ga0207698_10053084 3300026142 Unclassified 3109
267 Ga0207698_10391320 3300026142 Bacteria 1325
268 Ga0268266_10022206 3300028379 Bacteria 5408
269 Ga0268266_10226222 3300028379 Unclassified 1721
270 Ga0268265_10368068 3300028380 Bacteria 1318
271 Ga0265762_1003312 3300030760 Bacteria 2879
272 Ga0265760_10001941 3300031090 Bacteria 6068
273 Ga0265760_10008341 3300031090 Unclassified 2964
274 Ga0265760_10013332 3300031090 Unclassified 2354
275 Ga0265760_10090164 3300031090 Unclassified 959
276 Ga0373926_0000619 3300035083 Bacteria 9661
277 Ga0373926_0001291 3300035083 Bacteria 7536
278 Ga0373926_0016989 3300035083 Bacteria 2494
279 Ga0373923_0000647 3300035111 Bacteria 8780
280 Ga0373923_0085299 3300035111 Bacteria 1375
281 Ga0373923_0128564 3300035111 Bacteria 1137
282 Ga0373932_0008710 3300035112 Bacteria 2428
283 Ga0373936_0022795 3300035113 Unclassified 2438
284 Ga0373936_0100627 3300035113 Unclassified 1219
285 Ga0373945_0007772 3300035116 Bacteria 3479
286 Ga0373945_0097966 3300035116 Unclassified 1144
287 Ga0373943_0037427 3300035170 Unclassified 2329
288 Ga0373946_0001175 3300035171 Bacteria 9070
289 Ga0373946_0005052 3300035171 Bacteria 4751
290 Ga0373946_0015445 3300035171 Bacteria 2896
291 Ga0373942_0014049 3300035207 Unclassified 1933
292 Ga0373924_0000052 3300035410 Bacteria 29706
293 Ga0373931_0036110 3300035691 Unclassified 2574
294 Ga0373931_0078884 3300035691 Bacteria 1812
295 Ga0373931_0096074 3300035691 Unclassified 1659
296 Ga0373935_0000269 3300035692 Bacteria 25655
297 Ga0373935_0042142 3300035692 Bacteria 2870
298 Ga0373935_0154003 3300035692 Unclassified 1562
299 Ga0373935_0408044 3300035692 Unclassified 976
300 Ga0373927_0005076 3300035695 Bacteria 9107
301 Ga0373927_0005951 3300035695 Bacteria 8352
302 Ga0373927_0126082 3300035695 Unclassified 1671
303 Ga0373927_0235405 3300035695 Unclassified 1203
304 Ga0373933_0168737 3300035724 Unclassified 1392
305 Ga0373947_0000632 3300035725 Bacteria 20796
306 Ga0373947_0022859 3300035725 Unclassified 3629
307 Ga0373947_0066916 3300035725 Bacteria 2193
308 Ga0373947_0089791 3300035725 Bacteria 1914
309 Ga0373947_0620886 3300035725 Unclassified 737
310 Ga0373937_0009898 3300036401 Bacteria 8312
311 Ga0373937_0078351 3300036401 Bacteria 3054
312 Ga0373937_0258866 3300036401 Bacteria 1641
313 Ga0373937_0620360 3300036401 Unclassified 1026
314 Ga0373925_0001716 3300037068 Bacteria 18475
315 Ga0373925_0006247 3300037068 Bacteria 8786
316 Ga0373925_0010629 3300037068 Bacteria 6675
317 Ga0373925_0026873 3300037068 Bacteria 4213
318 Ga0373925_0030798 3300037068 Bacteria 3939
319 Ga0373925_0343328 3300037068 Bacteria 1211
320 Ga0373925_1064683 3300037068 Unclassified 666
321 Ga0395898_0364922 3300037466 Unclassified 1377
322 Ga0395905_0431463 3300037471 Bacteria 1215
323 Ga0436364_1151258 3300037853 Bacteria 35036
324 Ga0436365_1035977 3300039437 Bacteria 3956
325 Ga0436365_1116478 3300039437 Bacteria 7415
326 Ga0436361_0133987 3300039447 Bacteria 1975
327 Ga0436361_0400616 3300039447 Bacteria 83329
328 Ga0436361_0672781 3300039447 Unclassified 3722
329 Ga0436361_1219991 3300039447 Bacteria 1861
330 Ga0436363_0031689 3300039450 Bacteria 1111
331 Ga0436363_0166757 3300039450 Bacteria 1108
332 Ga0436362_0539068 3300039453 Bacteria 6207
333 Ga0436362_1273954 3300039453 Unclassified 833
334 Ga0451577_0047198 3300042876 Bacteria 3851
335 Ga0453683_0037003 3300044673 Unclassified 3070
336 Ga0453683_0159854 3300044673 Bacteria 1425
337 Ga0466963_0013283 3300044694 Bacteria 5054
338 Ga0466964_0045685 3300044706 Bacteria 1783
339 Ga0453684_0189029 3300044712 Unclassified 2410
340 Ga0451576_0048982 3300045051 Unclassified 4434
341 Ga0451576_0112174 3300045051 Bacteria 2838
342 Ga0466967_0009451 3300045976 Bacteria 7233
343 Ga0495592_0300982 3300046454 Unclassified 1042
344 Ga0495603_0214508 3300046455 Unclassified 1111
345 Ga0495629_0126204 3300046459 Unclassified 1782
346 Ga0495651_0221463 3300046462 Unclassified 1309
347 Ga0495580_0001878 3300046472 Bacteria 18487
348 Ga0495580_0051162 3300046472 Bacteria 2921
349 Ga0495580_0097544 3300046472 Unclassified 2044
350 Ga0495580_0312608 3300046472 Bacteria 1069
351 Ga0495582_0000858 3300046473 Bacteria 16887
352 Ga0495662_0169145 3300046476 Bacteria 1077
353 Ga0495608_0068672 3300046511 Bacteria 2317
354 Ga0495630_0005548 3300046517 Bacteria 8904
355 Ga0495630_0007052 3300046517 Bacteria 8008
356 Ga0495665_0005064 3300046531 Bacteria 7105
357 Ga0495665_0156945 3300046531 Unclassified 1187
358 Ga0495587_0383716 3300046536 Unclassified 781
359 Ga0495645_0081315 3300046543 Unclassified 2324
360 Ga0495645_0446475 3300046543 Unclassified 816
361 Ga0495635_0042083 3300046663 Bacteria 3156
362 Ga0495657_0237443 3300046675 Bacteria 1101
363 Ga0495646_0183834 3300046680 Unclassified 1146
364 Ga0495647_0151352 3300046681 Unclassified 995
365 Ga0495658_0158999 3300046683 Unclassified 1392
366 Ga0495669_0117267 3300046684 Bacteria 1246
367 Ga0495669_0269287 3300046684 Unclassified 819
368 Ga0495581_0033735 3300047315 Unclassified 2963
369 Ga0495674_0265743 3300047319 Bacteria 1409
370 Ga0495674_0470356 3300047319 Bacteria 1008
371 Ga0495676_0146067 3300047321 Bacteria 1689
372 Ga0495680_0077285 3300047322 Bacteria 2522
373 Ga0495675_0108908 3300047444 Bacteria 1730
374 Ga0495593_0236190 3300047673 Bacteria 916
375 Ga0495602_0199881 3300048088 Bacteria 1526
376 Ga0496101_0081636 3300048904 Unclassified 2392
377 Ga0496102_0139271 3300048905 Unclassified 2275
378 Ga0496102_0162658 3300048905 Bacteria 2100
379 Ga0496102_0880666 3300048905 Unclassified 817
380 Ga0496103_0465201 3300048906 Unclassified 811
381 Ga0496104_0087783 3300048907 Unclassified 2971
382 Ga0496104_0119542 3300048907 Unclassified 2530
383 Ga0496104_0504071 3300048907 Bacteria 1122
384 Ga0496105_0040427 3300048908 Bacteria 3845
385 Ga0496106_0672479 3300048909 Bacteria 826
386 Ga0496109_0121848 3300048912 Bacteria 2430
387 Ga0496110_0355258 3300048913 Bacteria 1335
388 Ga0496111_0270300 3300048914 Unclassified 1261
389 Ga0496112_0006548 3300048915 Bacteria 10248
390 Ga0496112_0021016 3300048915 Bacteria 6200
391 Ga0496112_0081996 3300048915 Bacteria 3190
392 Ga0496112_0109408 3300048915 Unclassified 2733
393 Ga0496112_0475652 3300048915 Bacteria 1186
394 Ga0496113_0189290 3300048916 Bacteria 1633
395 Ga0496115_0005746 3300048918 Bacteria 9033
396 nmdc:mga05p37_42655_c1 3300050507 Bacteria 5576
397 nmdc:mga0qj67_329635_c1 3300050509 Bacteria 1235
398 nmdc:mga0n895_29788_c1 3300050512 Bacteria 5208
399 nmdc:mga0n895_3159_c1 3300050512 Bacteria 13159
400 nmdc:mga0rr50_240060_c1 3300050513 Bacteria 1502
401 nmdc:mga0rr50_418030_c1 3300050513 Bacteria 1134
402 nmdc:mga08x19_155575_c1 3300050514 Bacteria 1550
403 nmdc:mga08x19_43093_c1 3300050514 Bacteria 2879
404 nmdc:mga0a205_13919_c1 3300050515 Bacteria 7501
405 Ga0495601_0003529 3300053077 Bacteria 8994
406 Ga0495601_0078692 3300053077 Bacteria 2113
407 Ga0495619_0024018 3300053085 Unclassified 3910
408 Ga0495619_0387439 3300053085 Bacteria 966
409 Ga0070717_10002444
410 Ga0070676_10030501
411 Ga0070683_100003279
412 Ga0070683_100009472
413 Ga0070683_100028899
414 Ga0070680_100040194
415 Ga0070680_100092261
416 Ga0070682_100012956
417 Ga0068868_100019218
418 Ga0070660_100028322
419 Ga0070689_100333999
420 Ga0070691_10060767
421 Ga0070661_100034634
422 Ga0070671_100026671
423 Ga0070688_100410138
424 Ga0070667_100003568
425 Ga0070709_10001531
426 Ga0070709_10047227
427 Ga0070709_10068400
428 Ga0070709_10139271
429 Ga0070709_10437668
430 Ga0070714_100225152
431 Ga0070714_100239120
432 Ga0070714_100407088
433 Ga0070713_100000125
434 Ga0070713_100000509
435 Ga0070713_100050310
436 Ga0070713_100418845
437 Ga0070713_100650239
438 Ga0070710_10000598
439 Ga0070711_100000408
440 Ga0070711_100185417
441 Ga0070711_100321961
442 Ga0070711_100466350
443 Ga0070694_100318872
444 Ga0070708_100040958
445 Ga0070708_100134528
446 Ga0070708_100272703
447 Ga0070663_100001583
448 Ga0070663_100086467
449 Ga0070678_100225180
450 Ga0070681_10013120
451 Ga0070681_10088148
452 Ga0070681_10120698
453 Ga0070681_10199524
454 Ga0068867_100055226
455 Ga0070706_100182184
456 Ga0070706_100249969
457 Ga0070707_100000050
458 Ga0070707_100130804
459 Ga0070707_100217838
460 Ga0070707_100255294
461 Ga0070707_100269396
462 Ga0070707_100325771
463 Ga0070698_100006869
464 Ga0070698_100008870
465 Ga0070698_100677898
466 Ga0070699_100644620
467 Ga0070679_100107684
468 Ga0070684_100031666
469 Ga0070684_100100654
470 Ga0070684_100114557
471 Ga0070697_100000326
472 Ga0070697_100019394
473 Ga0070697_100242209
474 Ga0070686_100007732
475 Ga0070696_100080164
476 Ga0070693_100017058
477 Ga0070693_100102681
478 Ga0070665_100008719
479 Ga0068855_100001421
480 Ga0068855_100007086
481 Ga0068855_100182725
482 Ga0068855_100278221
483 Ga0070664_100144107
484 Ga0068857_100222429
485 Ga0068857_100380858
486 Ga0068854_100107881
487 Ga0068856_100001532
488 Ga0068856_100001724
489 Ga0068856_100013557
490 Ga0068856_100312904
491 Ga0068856_100372413
492 Ga0068856_100676913
493 Ga0068864_100002560
494 Ga0068864_100734343
495 Ga0068863_100143065
496 Ga0068863_100154788
497 Ga0068858_100187257
498 Ga0068862_100365351
499 Ga0070717_10020392
500 Ga0070717_10100743
501 Ga0070717_10140585
502 Ga0070717_10229468
503 Ga0070717_10452154
504 Ga0070717_10494684
505 Ga0070715_10179053
506 Ga0070716_100001646
507 Ga0070716_100002081
508 Ga0070716_100034791
509 Ga0070716_100154491
510 Ga0070712_100000067
511 Ga0070712_100000134
512 Ga0070712_100023999
513 Ga0097621_100000034
514 Ga0097621_100052269
515 Ga0097621_100151459
516 Ga0068871_100000819
517 Ga0068871_100468502
518 Ga0075433_10404487
519 Ga0075434_100006014
520 Ga0075434_100035447
521 Ga0075434_100232600
522 Ga0068865_100027442
523 Ga0075436_100160032
524 Ga0075435_100368740
525 Ga0099794_10020138
526 Ga0099794_10118333
527 Ga0099795_10113786
528 Ga0105240_10004264
529 Ga0105240_10047360
530 Ga0105240_10349200
531 Ga0105247_10011209
532 Ga0105247_10396412
533 Ga0114129_10074350
534 Ga0105243_10073986
535 Ga0105243_10708642
536 Ga0105241_10039967
537 Ga0105241_10545721
538 Ga0105248_10011027
539 Ga0105248_10069980
540 Ga0105237_10174261
541 Ga0105238_10007339
542 Ga0105238_10034553
543 Ga0105238_10365092
544 Ga0105239_10021480
545 Ga0105239_10203956
546 Ga0105239_10204751
547 Ga0105239_10270453
548 Ga0157373_10007167
549 Ga0157371_10049246
550 Ga0157371_10138302
551 Ga0157370_10002484
552 Ga0157370_10498322
553 Ga0157370_10540440
554 Ga0157369_10010669
555 Ga0157369_10119097
556 Ga0157369_10203064
557 Ga0157369_10228542
558 Ga0157369_10792362
559 Ga0157374_10000249
560 Ga0157374_10024162
561 Ga0157374_10128064
562 Ga0157374_10372138
563 Ga0157374_10522975
564 Ga0157378_10000008
565 Ga0157378_10506767
566 Ga0157378_10653328
567 Ga0163162_10156206
568 Ga0157372_10000436
569 Ga0157372_10000992
570 Ga0157375_10024068
571 Ga0157375_10110043
572 Ga0157379_10069936
573 Ga0157379_10214893
574 Ga0157376_10001493
575 Ga0157376_10002140
576 Ga0157376_10062070
577 Ga0213872_10001338
578 Ga0213872_10001709
579 Ga0213876_10056935
580 Ga0213876_10137196
581 Ga0213875_10009771
582 Ga0224572_1011965
583 Ga0228598_1000303
584 Ga0228598_1001702
585 Ga0228598_1005197
586 Ga0228598_1011880
587 Ga0207692_10003006
588 Ga0207692_10024007
589 Ga0207710_10055988
590 Ga0207680_10072352
591 Ga0207685_10020451
592 Ga0207699_10001629
593 Ga0207699_10169371
594 Ga0207645_10015810
595 Ga0207684_10174497
596 Ga0207684_10174853
597 Ga0207654_10020050
598 Ga0207654_10124108
599 Ga0207707_10015200
600 Ga0207707_10030578
601 Ga0207707_10097307
602 Ga0207707_10137709
603 Ga0207695_10005455
604 Ga0207695_10164711
605 Ga0207695_10645636
606 Ga0207695_10729782
607 Ga0207671_10192968
608 Ga0207693_10000051
609 Ga0207693_10000252
610 Ga0207693_10300000
611 Ga0207693_10515350
612 Ga0207663_10001998
613 Ga0207663_10280277
614 Ga0207660_10082600
615 Ga0207657_10004369
616 Ga0207646_10000037
617 Ga0207646_10003275
618 Ga0207646_10076627
619 Ga0207646_10105194
620 Ga0207646_10156735
621 Ga0207646_10231854
622 Ga0207646_10318355
623 Ga0207646_10341606
624 Ga0207646_10603610
625 Ga0207687_10000141
626 Ga0207700_10000381
627 Ga0207700_10002753
628 Ga0207700_10005864
629 Ga0207700_10008629
630 Ga0207700_10088286
631 Ga0207700_10177776
632 Ga0207664_10047411
633 Ga0207664_10066497
634 Ga0207664_10305755
635 Ga0207644_10017386
636 Ga0207706_10000296
637 Ga0207709_10060019
638 Ga0207704_10029307
639 Ga0207665_10003709
640 Ga0207665_10009975
641 Ga0207665_10014915
642 Ga0207665_10031223
643 Ga0207665_10144117
644 Ga0207665_10149897
645 Ga0207665_10253604
646 Ga0207665_10369448
647 Ga0207711_10044463
648 Ga0207711_10074268
649 Ga0207711_10160065
650 Ga0207661_10001952
651 Ga0207661_10005239
652 Ga0207679_10162206
653 Ga0207667_10001192
654 Ga0207667_10001239
655 Ga0207667_10071700
656 Ga0207668_10314840
657 Ga0207640_10229132
658 Ga0207677_10039642
659 Ga0207677_10233015
660 Ga0207703_10144748
661 Ga0207639_10357226
662 Ga0207678_10000903
663 Ga0207702_10001513
664 Ga0207702_10002159
665 Ga0207702_10016811
666 Ga0207702_10282743
667 Ga0207702_10332599
668 Ga0207641_10057736
669 Ga0207641_10149192
670 Ga0207648_10034125
671 Ga0207674_10044672
672 Ga0207674_10050841
673 Ga0207683_10117626
674 Ga0207698_10053084
675 Ga0207698_10391320
676 Ga0268266_10022206
677 Ga0268266_10226222
678 Ga0268265_10368068
679 Ga0265762_1003312
680 Ga0265760_10001941
681 Ga0265760_10008341
682 Ga0265760_10013332
683 Ga0265760_10090164
684 Ga0373926_0000619
685 Ga0373926_0001291
686 Ga0373926_0016989
687 Ga0373923_0000647
688 Ga0373923_0085299
689 Ga0373923_0128564
690 Ga0373932_0008710
691 Ga0373936_0022795
692 Ga0373936_0100627
693 Ga0373945_0007772
694 Ga0373945_0097966
695 Ga0373943_0037427
696 Ga0373946_0001175
697 Ga0373946_0005052
698 Ga0373946_0015445
699 Ga0373942_0014049
700 Ga0373924_0000052
701 Ga0373931_0036110
702 Ga0373931_0078884
703 Ga0373931_0096074
704 Ga0373935_0000269
705 Ga0373935_0042142
706 Ga0373935_0154003
707 Ga0373935_0408044
708 Ga0373927_0005076
709 Ga0373927_0005951
710 Ga0373927_0126082
711 Ga0373927_0235405
712 Ga0373933_0168737
713 Ga0373947_0000632
714 Ga0373947_0022859
715 Ga0373947_0066916
716 Ga0373947_0089791
717 Ga0373947_0620886
718 Ga0373937_0009898
719 Ga0373937_0078351
720 Ga0373937_0258866
721 Ga0373937_0620360
722 Ga0373925_0001716
723 Ga0373925_0006247
724 Ga0373925_0010629
725 Ga0373925_0026873
726 Ga0373925_0030798
727 Ga0373925_0343328
728 Ga0373925_1064683
729 Ga0395898_0364922
730 Ga0395905_0431463
731 Ga0436364_1151258
732 Ga0436365_1035977
733 Ga0436365_1116478
734 Ga0436361_0133987
735 Ga0436361_0400616
736 Ga0436361_0672781
737 Ga0436361_1219991
738 Ga0436363_0031689
739 Ga0436363_0166757
740 Ga0436362_0539068
741 Ga0436362_1273954
742 Ga0451577_0047198
743 Ga0453683_0037003
744 Ga0453683_0159854
745 Ga0466963_0013283
746 Ga0466964_0045685
747 Ga0453684_0189029
748 Ga0451576_0048982
749 Ga0451576_0112174
750 Ga0466967_0009451
751 Ga0495592_0300982
752 Ga0495603_0214508
753 Ga0495629_0126204
754 Ga0495651_0221463
755 Ga0495580_0001878
756 Ga0495580_0051162
757 Ga0495580_0097544
758 Ga0495580_0312608
759 Ga0495582_0000858
760 Ga0495662_0169145
761 Ga0495608_0068672
762 Ga0495630_0005548
763 Ga0495630_0007052
764 Ga0495665_0005064
765 Ga0495665_0156945
766 Ga0495587_0383716
767 Ga0495645_0081315
768 Ga0495645_0446475
769 Ga0495635_0042083
770 Ga0495657_0237443
771 Ga0495646_0183834
772 Ga0495647_0151352
773 Ga0495658_0158999
774 Ga0495669_0117267
775 Ga0495669_0269287
776 Ga0495581_0033735
777 Ga0495674_0265743
778 Ga0495674_0470356
779 Ga0495676_0146067
780 Ga0495680_0077285
781 Ga0495675_0108908
782 Ga0495593_0236190
783 Ga0495602_0199881
784 Ga0496101_0081636
785 Ga0496102_0139271
786 Ga0496102_0162658
787 Ga0496102_0880666
788 Ga0496103_0465201
789 Ga0496104_0087783
790 Ga0496104_0119542
791 Ga0496104_0504071
792 Ga0496105_0040427
793 Ga0496106_0672479
794 Ga0496109_0121848
795 Ga0496110_0355258
796 Ga0496111_0270300
797 Ga0496112_0006548
798 Ga0496112_0021016
799 Ga0496112_0081996
800 Ga0496112_0109408
801 Ga0496112_0475652
802 Ga0496113_0189290
803 Ga0496115_0005746
804 nmdc:mga05p37_42655_c1
805 nmdc:mga0qj67_329635_c1
806 nmdc:mga0n895_29788_c1
807 nmdc:mga0n895_3159_c1
808 nmdc:mga0rr50_240060_c1
809 nmdc:mga0rr50_418030_c1
810 nmdc:mga08x19_155575_c1
811 nmdc:mga08x19_43093_c1
812 nmdc:mga0a205_13919_c1
813 Ga0495601_0003529
814 Ga0495601_0078692
815 Ga0495619_0024018
816 Ga0495619_0387439

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09837

DUF2064

Uncharacterized protein conserved in bacteria (DUF2064)

79

203

0.86

PF01983

CofC

Guanylyl transferase CofC like

38

275

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cgx-assembly1.cif.gz_A crystal structure of putative nucleotide-diphospho-sugar transferase (yp_389115.1) from desulfovibrio desulfuricans g20 at 1.90 a resolution 0.8929 6 227
3cgx-assembly1.cif.gz_A crystal structure of putative nucleotide-diphospho-sugar transferase (yp_389115.1) from desulfovibrio desulfuricans g20 at 1.90 a resolution 0.8567 6 227
2i5e-assembly1.cif.gz_B crystal structure of a protein of unknown function mm2497 from methanosarcina mazei go1, probable nucleotidyltransferase 0.8563 7 202
7p97-assembly2.cif.gz_BBB structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound 0.8147 9 204
7p97-assembly2.cif.gz_BBB structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound 0.7995 9 204
ID Description Score Start End Superfamily
3cgxA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8734 6 227 3.90.550.10
af_O06406_6_218_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8649 9 220 3.90.550.10
3cgxA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8552 6 227 3.90.550.10
af_O06406_6_218_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8535 9 220 3.90.550.10
2i5eB01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8241 8 191 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V8Z0D1-F1-model_v4 Glycosyltransferase 0.9775 4 227 GO:0016740
AF-A0A2V8Z0D1-F1-model_v4 Glycosyltransferase 0.969 4 227 GO:0016740
AF-A0A2V9ACN5-F1-model_v4 Glycosyltransferase 0.9594 4 227 GO:0016740
AF-A0A1Q7N479-F1-model_v4 Glycosyltransferase 0.9568 69 227
AF-A0A534ZK72-F1-model_v4 DUF2064 domain-containing protein 0.9547 1 224

Map