F436645

General Info

Members Datasets Scaffolds Average Seq Length
408 243 370 293

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10041094|Ga0070677_100410942
Length 288
Sequence MAAMKSLAKAGTFKMGSRIVKRLGYGAMQLAGPGVFGPPKDRNAALAVLREVVASGLDHIDTSDFYGPHVTNQILREALHPYPKELVIVTKVGAKRGPQGSWEPAFSAEEITSAVHDNLRNLELDTLEVVNLRVMFAMGPAEGSIAAPLSALVRLQREGKIRHIGLSNVTAQQVEEGRAITEIVCVQNHYNLAHRSDDRLIDSLASAGIAYVPFFPLGGFSPLQSTVLSDVATKLGATPMQVALAWLLRRSPNILLIPGTSSIDHLRENLAAAELELPADAMTSLERI

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
11 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
12 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
13 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
14 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
15 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
16 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
17 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
18 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
19 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
20 2818991450 Burkholderia sp. 604 Isolate Unclassified
21 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
22 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
23 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
24 2884411467 Dyella sp. AD56 Isolate Rhizosphere
25 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
26 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
27 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
28 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
29 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
30 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
31 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
32 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
33 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
240 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
241 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
242 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
243 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.44
Metatranscriptomes 0.25
Isolates 9.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.13
Nodule 3.19
Rhizoplane 1.23
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010377 3300001989 Bacteria 3459
2 JGI25156J39149_1000616 3300002705 Bacteria 19598
3 JGI25406J46586_10021803 3300003203 Bacteria 2564
4 JGI25165J46597_1000492 3300003214 Bacteria 38146
5 rootH1_10092349 3300003323 Bacteria 2984
6 Ga0055533_1000106 3300003756 Bacteria 104514
7 Ga0055533_1002867 3300003756 Bacteria 3718
8 Ga0055532_1000003 3300003758 Bacteria 494004
9 Ga0055527_1000006 3300003760 Bacteria 494004
10 Ga0055535_1000003 3300003761 Bacteria 494004
11 Ga0055542_1000007 3300003762 Bacteria 494004
12 Ga0055529_1000003 3300003763 Bacteria 494004
13 Ga0055531_10001879 3300003794 Bacteria 14715
14 Ga0070677_10041094 3300005333 Bacteria 1824
15 Ga0070682_100141430 3300005337 Bacteria 1641
16 Ga0070668_100005343 3300005347 Bacteria 9534
17 Ga0070667_100129409 3300005367 Bacteria 2202
18 Ga0070681_10118628 3300005458 Bacteria 2582
19 Ga0070665_100033990 3300005548 Bacteria 5128
20 Ga0068855_100035884 3300005563 Bacteria 5904
21 Ga0068855_100098413 3300005563 Bacteria 3370
22 Ga0068857_100285735 3300005577 Bacteria 1518
23 Ga0068856_100337895 3300005614 Bacteria 1524
24 Ga0068859_100000776 3300005617 Bacteria 32237
25 Ga0068851_10164929 3300005834 Bacteria 1219
26 Ga0068858_100056903 3300005842 Bacteria 3614
27 Ga0068860_100135524 3300005843 Bacteria 2364
28 Ga0081539_10008055 3300005985 Bacteria 9335
29 Ga0070716_100122162 3300006173 Bacteria 1632
30 Ga0075434_100025950 3300006871 Bacteria 5737
31 Ga0068865_100002909 3300006881 Bacteria 10213
32 Ga0097620_100000776 3300006931 Bacteria 32237
33 Ga0075435_100232079 3300007076 Bacteria 1568
34 Ga0105240_10015865 3300009093 Bacteria 10221
35 Ga0105240_10061613 3300009093 Bacteria 4675
36 Ga0105247_10073171 3300009101 Bacteria 2147
37 Ga0114129_10465010 3300009147 Bacteria 1657
38 Ga0105237_10072104 3300009545 Bacteria 3448
39 Ga0105237_10267452 3300009545 Bacteria 1713
40 Ga0105237_10330397 3300009545 Bacteria 1529
41 Ga0105238_10087123 3300009551 Bacteria 3110
42 Ga0105239_10302162 3300010375 Bacteria 1802
43 Ga0157370_10186441 3300013104 Bacteria 1926
44 Ga0157369_10005727 3300013105 Bacteria 14436
45 Ga0157369_10163353 3300013105 Bacteria 2349
46 Ga0157372_10166761 3300013307 Bacteria 2547
47 Ga0157372_10947722 3300013307 Bacteria 998
48 Ga0157379_10099917 3300014968 Bacteria 2605
49 Ga0157376_10210893 3300014969 Bacteria 1793
50 Ga0182007_10000313 3300015262 Bacteria 30902
51 Ga0213872_10006515 3300021361 Bacteria 5845
52 Ga0213872_10030010 3300021361 Bacteria 2493
53 Ga0209674_100025 3300025226 Bacteria 515942
54 Ga0209672_100002 3300025228 Bacteria 1733325
55 Ga0209147_100003 3300025229 Bacteria 1733325
56 Ga0209563_101327 3300025230 Bacteria 6738
57 Ga0207427_101885 3300025231 Bacteria 6601
58 Ga0209258_100005 3300025242 Bacteria 1087938
59 Ga0209026_1008048 3300025250 Bacteria 2262
60 Ga0209677_110705 3300025253 Bacteria 1498
61 Ga0209148_1000006 3300025254 Bacteria 1733325
62 Ga0209759_1000006 3300025256 Bacteria 492407
63 Ga0209759_1000086 3300025256 Bacteria 167075
64 Ga0209759_1001197 3300025256 Bacteria 16140
65 Ga0209233_1000018 3300025261 Bacteria 886857
66 Ga0209455_1000003 3300025272 Bacteria 1471893
67 Ga0209455_1000218 3300025272 Bacteria 79966
68 Ga0209673_1023608 3300025273 Bacteria 2089
69 Ga0209050_1001205 3300025298 Bacteria 30315
70 Ga0209256_1000437 3300025299 Bacteria 64248
71 Ga0209051_1005117 3300025303 Bacteria 7787
72 Ga0209257_1000479 3300025304 Bacteria 72716
73 Ga0207656_10119618 3300025321 Bacteria 1225
74 Ga0207713_1001596 3300025735 Bacteria 17724
75 Ga0207647_10027253 3300025904 Bacteria 3727
76 Ga0207647_10080740 3300025904 Bacteria 1950
77 Ga0207647_10082072 3300025904 Bacteria 1931
78 Ga0207707_10020449 3300025912 Bacteria 5781
79 Ga0207695_10064613 3300025913 Bacteria 3766
80 Ga0207671_10287320 3300025914 Bacteria 1298
81 Ga0207660_10103853 3300025917 Bacteria 2127
82 Ga0207704_10153816 3300025938 Bacteria 1627
83 Ga0207704_10158521 3300025938 Bacteria 1607
84 Ga0207667_10025316 3300025949 Bacteria 6497
85 Ga0207667_10107629 3300025949 Bacteria 2876
86 Ga0207668_10006252 3300025972 Bacteria 7035
87 Ga0207640_10050497 3300025981 Bacteria 2699
88 Ga0207658_10251058 3300025986 Bacteria 1503
89 Ga0207678_10052904 3300026067 Bacteria 3501
90 Ga0207702_10002786 3300026078 Bacteria 16383
91 Ga0265356_1000148 3300028017 Bacteria 12602
92 Ga0268264_10012782 3300028381 Bacteria 6909
93 Ga0265338_10000325 3300028800 Bacteria 86856
94 Ga0265760_10015115 3300031090 Bacteria 2212
95 Ga0307408_100028018 3300031548 Bacteria 3889
96 Ga0307405_10066283 3300031731 Bacteria 2302
97 Ga0307412_10000002 3300031911 Bacteria 743446
98 Ga0307411_10076605 3300032005 Bacteria 2287
99 Ga0395899_0000018 3300037312 Bacteria 423194
100 Ga0395905_0000039 3300037471 Bacteria 253197
101 Ga0395901_0326264 3300038443 Bacteria 1588
102 Ga0436361_0118308 3300039447 Bacteria 2024
103 Ga0436361_0451010 3300039447 Bacteria 8636
104 Ga0436361_1012054 3300039447 Bacteria 3663
105 Ga0439452_025335 3300042010 Bacteria 1507
106 Ga0466982_0004950 3300044672 Bacteria 6151
107 Ga0466966_0106311 3300044684 Bacteria 1732
108 Ga0466961_0004292 3300044693 Bacteria 8926
109 Ga0466961_0166134 3300044693 Bacteria 1374
110 Ga0466963_0229529 3300044694 Bacteria 1301
111 Ga0466971_0120898 3300044719 Bacteria 1212
112 Ga0466970_0149260 3300044765 Bacteria 1290
113 Ga0466957_0143908 3300044842 Bacteria 1538
114 Ga0466960_0008234 3300044901 Bacteria 4263
115 Ga0466958_0001035 3300045836 Bacteria 12709
116 Ga0466958_0061920 3300045836 Bacteria 2280
117 Ga0495592_0027540 3300046454 Bacteria 4308
118 Ga0495592_0092645 3300046454 Bacteria 2165
119 Ga0495603_0001966 3300046455 Bacteria 12112
120 Ga0495603_0059289 3300046455 Bacteria 2263
121 Ga0495590_0008566 3300046457 Bacteria 3904
122 Ga0495591_000055 3300046458 Bacteria 135355
123 Ga0495591_000644 3300046458 Bacteria 25785
124 Ga0495591_003404 3300046458 Bacteria 8240
125 Ga0495591_009689 3300046458 Bacteria 3803
126 Ga0495629_0000031 3300046459 Bacteria 124543
127 Ga0495629_0005434 3300046459 Bacteria 9498
128 Ga0495629_0006054 3300046459 Bacteria 8988
129 Ga0495629_0022984 3300046459 Bacteria 4444
130 Ga0495638_0032420 3300046460 Bacteria 3349
131 Ga0495641_0036108 3300046461 Bacteria 2325
132 Ga0495651_0044167 3300046462 Bacteria 3454
133 Ga0495653_0002304 3300046463 Bacteria 15123
134 Ga0495653_0005627 3300046463 Bacteria 10228
135 Ga0495653_0102515 3300046463 Bacteria 2071
136 Ga0495653_0107661 3300046463 Bacteria 2008
137 Ga0495650_0000316 3300046471 Bacteria 86653
138 Ga0495650_0008503 3300046471 Bacteria 5975
139 Ga0495580_0000310 3300046472 Bacteria 39754
140 Ga0495580_0000442 3300046472 Bacteria 34202
141 Ga0495580_0006600 3300046472 Bacteria 9431
142 Ga0495580_0039771 3300046472 Bacteria 3364
143 Ga0495580_0167245 3300046472 Bacteria 1521
144 Ga0495580_0169535 3300046472 Bacteria 1509
145 Ga0495582_0008041 3300046473 Bacteria 5821
146 Ga0495582_0101934 3300046473 Bacteria 1607
147 Ga0495582_0179390 3300046473 Bacteria 1206
148 Ga0495605_0000007 3300046474 Bacteria 358289
149 Ga0495605_0000688 3300046474 Bacteria 25300
150 Ga0495605_0004538 3300046474 Bacteria 8133
151 Ga0495605_0008098 3300046474 Bacteria 5945
152 Ga0495664_0010897 3300046477 Bacteria 5112
153 Ga0495584_0004381 3300046491 Bacteria 7604
154 Ga0495594_0010000 3300046499 Bacteria 4914
155 Ga0495596_0008066 3300046500 Bacteria 4703
156 Ga0495596_0017803 3300046500 Bacteria 2936
157 Ga0495596_0050248 3300046500 Bacteria 1634
158 Ga0495607_0010501 3300046501 Bacteria 6222
159 Ga0495607_0077391 3300046501 Bacteria 1837
160 Ga0495607_0160157 3300046501 Bacteria 1144
161 Ga0495583_0000007 3300046506 Bacteria 434661
162 Ga0495583_0000848 3300046506 Bacteria 37200
163 Ga0495583_0014646 3300046506 Bacteria 4314
164 Ga0495606_0000281 3300046507 Bacteria 88474
165 Ga0495606_0015538 3300046507 Bacteria 5858
166 Ga0495606_0027096 3300046507 Bacteria 4069
167 Ga0495608_0078871 3300046511 Bacteria 2141
168 Ga0495610_0009281 3300046512 Bacteria 6236
169 Ga0495610_0127109 3300046512 Bacteria 1110
170 Ga0495616_0044991 3300046513 Bacteria 2236
171 Ga0495618_0004949 3300046514 Bacteria 8144
172 Ga0495618_0024415 3300046514 Bacteria 3743
173 Ga0495618_0077070 3300046514 Bacteria 2124
174 Ga0495618_0082858 3300046514 Bacteria 2048
175 Ga0495620_0000110 3300046515 Bacteria 65755
176 Ga0495620_0004123 3300046515 Bacteria 8247
177 Ga0495628_0002024 3300046516 Bacteria 18373
178 Ga0495628_0010253 3300046516 Bacteria 7969
179 Ga0495628_0122098 3300046516 Bacteria 1997
180 Ga0495628_0130143 3300046516 Bacteria 1925
181 Ga0495628_0358751 3300046516 Bacteria 1070
182 Ga0495630_0002742 3300046517 Bacteria 12221
183 Ga0495630_0003392 3300046517 Bacteria 11096
184 Ga0495630_0017212 3300046517 Bacteria 5292
185 Ga0495630_0220926 3300046517 Bacteria 1446
186 Ga0495631_0022920 3300046518 Bacteria 2900
187 Ga0495631_0024087 3300046518 Bacteria 2814
188 Ga0495632_0007793 3300046519 Bacteria 6673
189 Ga0495632_0050733 3300046519 Bacteria 2044
190 Ga0495632_0059143 3300046519 Bacteria 1865
191 Ga0495632_0075924 3300046519 Bacteria 1608
192 Ga0495637_0001570 3300046520 Bacteria 13299
193 Ga0495637_0001761 3300046520 Bacteria 12408
194 Ga0495643_0056552 3300046522 Bacteria 2094
195 Ga0495643_0058648 3300046522 Bacteria 2048
196 Ga0495644_0046470 3300046523 Bacteria 1631
197 Ga0495648_0001324 3300046524 Bacteria 24557
198 Ga0495648_0010438 3300046524 Bacteria 7075
199 Ga0495648_0016068 3300046524 Bacteria 5404
200 Ga0495648_0047480 3300046524 Bacteria 2653
201 Ga0495648_0170105 3300046524 Bacteria 1117
202 Ga0495666_0004866 3300046526 Bacteria 6789
203 Ga0495666_0007264 3300046526 Bacteria 5557
204 Ga0495666_0009818 3300046526 Bacteria 4783
205 Ga0495666_0124634 3300046526 Bacteria 1205
206 Ga0495652_0006700 3300046529 Bacteria 10692
207 Ga0495652_0040343 3300046529 Bacteria 4035
208 Ga0495652_0058891 3300046529 Bacteria 3251
209 Ga0495654_0002972 3300046530 Bacteria 10609
210 Ga0495654_0006577 3300046530 Bacteria 6583
211 Ga0495654_0037855 3300046530 Bacteria 2415
212 Ga0495665_0005375 3300046531 Bacteria 6904
213 Ga0495665_0037827 3300046531 Bacteria 2575
214 Ga0495640_0046287 3300046533 Bacteria 3014
215 Ga0495586_0005006 3300046535 Bacteria 7092
216 Ga0495586_0041496 3300046535 Bacteria 2478
217 Ga0495587_0012657 3300046536 Bacteria 5305
218 Ga0495609_0000004 3300046538 Bacteria 697346
219 Ga0495609_0000188 3300046538 Bacteria 61830
220 Ga0495609_0015847 3300046538 Bacteria 3522
221 Ga0495597_0000467 3300046542 Bacteria 34288
222 Ga0495597_0001306 3300046542 Bacteria 18280
223 Ga0495645_0001666 3300046543 Bacteria 15092
224 Ga0495645_0145529 3300046543 Bacteria 1651
225 Ga0495622_0029251 3300046557 Bacteria 2574
226 Ga0495633_0000020 3300046558 Bacteria 227180
227 Ga0495633_0017564 3300046558 Bacteria 3654
228 Ga0495667_0044559 3300046559 Bacteria 2938
229 Ga0495668_0005036 3300046616 Bacteria 9105
230 Ga0495668_0007537 3300046616 Bacteria 6943
231 Ga0495634_0005210 3300046642 Bacteria 10045
232 Ga0495634_0072434 3300046642 Bacteria 2266
233 Ga0495634_0202454 3300046642 Bacteria 1232
234 Ga0495611_0023398 3300046648 Bacteria 2680
235 Ga0495611_0053370 3300046648 Bacteria 1824
236 Ga0495611_0135742 3300046648 Bacteria 1148
237 Ga0495625_0000004 3300046660 Bacteria 611314
238 Ga0495635_0017117 3300046663 Bacteria 5063
239 Ga0495635_0043863 3300046663 Bacteria 3085
240 Ga0495661_0000006 3300046665 Bacteria 427288
241 Ga0495661_0000009 3300046665 Bacteria 291327
242 Ga0495661_0003186 3300046665 Bacteria 12266
243 Ga0495661_0056089 3300046665 Bacteria 2358
244 Ga0495588_0008274 3300046674 Bacteria 4766
245 Ga0495657_0039157 3300046675 Bacteria 3259
246 Ga0495657_0163978 3300046675 Bacteria 1373
247 Ga0495599_0022450 3300046678 Bacteria 3939
248 Ga0495599_0025052 3300046678 Bacteria 3733
249 Ga0495599_0056764 3300046678 Bacteria 2450
250 Ga0495623_0006463 3300046679 Bacteria 7629
251 Ga0495623_0007438 3300046679 Bacteria 7110
252 Ga0495623_0009674 3300046679 Bacteria 6258
253 Ga0495623_0039453 3300046679 Bacteria 3017
254 Ga0495646_0000947 3300046680 Bacteria 16527
255 Ga0495646_0004463 3300046680 Bacteria 8814
256 Ga0495646_0007123 3300046680 Bacteria 7105
257 Ga0495646_0021475 3300046680 Bacteria 4076
258 Ga0495646_0023659 3300046680 Bacteria 3867
259 Ga0495646_0082192 3300046680 Bacteria 1874
260 Ga0495624_0003069 3300046690 Bacteria 12504
261 Ga0495624_0004592 3300046690 Bacteria 10077
262 Ga0495624_0004820 3300046690 Bacteria 9810
263 Ga0495671_0004461 3300046692 Bacteria 8369
264 Ga0495671_0012420 3300046692 Bacteria 4653
265 Ga0495671_0051431 3300046692 Bacteria 2049
266 Ga0495649_0041880 3300046694 Bacteria 2503
267 Ga0495589_0001222 3300046794 Bacteria 15244
268 Ga0495589_0007080 3300046794 Bacteria 5879
269 Ga0495589_0016648 3300046794 Bacteria 3777
270 Ga0495589_0137730 3300046794 Bacteria 1170
271 Ga0495600_0004853 3300046809 Bacteria 8074
272 Ga0495660_0000741 3300046810 Bacteria 24710
273 Ga0495660_0064400 3300046810 Bacteria 1959
274 Ga0495660_0074658 3300046810 Bacteria 1791
275 Ga0495581_0003818 3300047315 Bacteria 8664
276 Ga0495581_0010402 3300047315 Bacteria 5382
277 Ga0495581_0056749 3300047315 Bacteria 2260
278 Ga0495604_0000745 3300047317 Bacteria 27317
279 Ga0495604_0011048 3300047317 Bacteria 7167
280 Ga0495604_0017087 3300047317 Bacteria 5804
281 Ga0495604_0196035 3300047317 Bacteria 1404
282 Ga0495674_0016136 3300047319 Bacteria 6971
283 Ga0495674_0050541 3300047319 Bacteria 3668
284 Ga0495674_0077968 3300047319 Bacteria 2848
285 Ga0495672_0012099 3300047320 Bacteria 6042
286 Ga0495672_0012358 3300047320 Bacteria 5961
287 Ga0495672_0015413 3300047320 Bacteria 5190
288 Ga0495672_0091746 3300047320 Bacteria 1666
289 Ga0495676_0000493 3300047321 Bacteria 32407
290 Ga0495676_0016267 3300047321 Bacteria 6605
291 Ga0495676_0081056 3300047321 Bacteria 2461
292 Ga0495676_0086242 3300047321 Bacteria 2363
293 Ga0495680_0003122 3300047322 Bacteria 16496
294 Ga0495680_0130897 3300047322 Bacteria 1843
295 Ga0495683_0000003 3300047323 Bacteria 383992
296 Ga0495683_0001914 3300047323 Bacteria 13001
297 Ga0495683_0002324 3300047323 Bacteria 11555
298 Ga0495683_0096265 3300047323 Bacteria 1428
299 Ga0495687_023573 3300047443 Bacteria 2938
300 Ga0495675_0007759 3300047444 Bacteria 6621
301 Ga0495675_0043759 3300047444 Bacteria 2852
302 Ga0495675_0089568 3300047444 Bacteria 1931
303 Ga0495675_0209331 3300047444 Bacteria 1184
304 Ga0495679_000006 3300047446 Bacteria 449956
305 Ga0495679_000015 3300047446 Bacteria 287256
306 Ga0495679_000122 3300047446 Bacteria 68748
307 Ga0495679_000599 3300047446 Bacteria 24563
308 Ga0495679_005235 3300047446 Bacteria 5790
309 Ga0495673_0002158 3300047469 Bacteria 14281
310 Ga0495673_0007145 3300047469 Bacteria 6460
311 Ga0495673_0013562 3300047469 Bacteria 4275
312 Ga0495673_0020783 3300047469 Bacteria 3260
313 Ga0495681_0005337 3300047470 Bacteria 8620
314 Ga0495681_0009073 3300047470 Bacteria 6165
315 Ga0495684_0017524 3300047471 Bacteria 5514
316 Ga0495684_0193621 3300047471 Bacteria 1502
317 Ga0495686_0000099 3300047472 Bacteria 180546
318 Ga0495686_0116331 3300047472 Bacteria 1598
319 Ga0495593_0002281 3300047673 Bacteria 11501
320 Ga0495593_0025920 3300047673 Bacteria 3243
321 Ga0495593_0033702 3300047673 Bacteria 2788
322 Ga0495602_0025980 3300048088 Bacteria 5657
323 Ga0495602_0026203 3300048088 Bacteria 5626
324 Ga0495602_0329631 3300048088 Bacteria 1107
325 Ga0495614_0000386 3300048089 Bacteria 17870
326 Ga0495614_0010541 3300048089 Bacteria 4075
327 Ga0495626_0000201 3300048091 Bacteria 72576
328 Ga0495626_0007475 3300048091 Bacteria 6079
329 Ga0496102_0115698 3300048905 Bacteria 2502
330 Ga0496104_0000016 3300048907 Bacteria 335025
331 Ga0496105_0000010 3300048908 Bacteria 309880
332 Ga0496115_0000544 3300048918 Bacteria 29353
333 Ga0496116_0010692 3300048919 Bacteria 7663
334 Ga0496117_0005723 3300048920 Bacteria 12925
335 Ga0496117_0012367 3300048920 Bacteria 7532
336 Ga0496118_0002759 3300048921 Bacteria 23058
337 Ga0496118_0009927 3300048921 Bacteria 9511
338 Ga0496118_0010169 3300048921 Bacteria 9347
339 Ga0496118_0017426 3300048921 Bacteria 6538
340 Ga0496119_0002615 3300048922 Bacteria 19529
341 Ga0496120_0000015 3300048923 Bacteria 310795
342 Ga0496121_0000985 3300048924 Bacteria 51003
343 Ga0496121_0013089 3300048924 Bacteria 8955
344 Ga0496122_0024500 3300048925 Bacteria 5278
345 Ga0496123_0143545 3300048926 Bacteria 1300
346 Ga0496124_0000383 3300048927 Bacteria 80834
347 Ga0496124_0269096 3300048927 Bacteria 1249
348 Ga0496126_0000102 3300048929 Bacteria 201540
349 Ga0496126_0006025 3300048929 Bacteria 13609
350 Ga0496126_0019611 3300048929 Bacteria 6658
351 Ga0495678_000007 3300049459 Bacteria 448039
352 Ga0495678_000394 3300049459 Bacteria 44121
353 Ga0495678_012135 3300049459 Bacteria 4092
354 Ga0495678_030139 3300049459 Bacteria 2272
355 Ga0495682_0018900 3300049460 Bacteria 2594
356 Ga0501031_0174233 3300049568 Bacteria 1405
357 Ga0501033_0077031 3300049570 Bacteria 2447
358 Ga0501033_0284111 3300049570 Bacteria 1168
359 Ga0501043_0167156 3300049579 Bacteria 1717
360 Ga0501046_0046415 3300049580 Bacteria 3448
361 Ga0501047_0040463 3300049581 Bacteria 4508
362 Ga0501047_0046890 3300049581 Bacteria 4175
363 Ga0501070_0048584 3300049586 Bacteria 3524
364 Ga0501241_005206 3300049758 Bacteria 2426
365 Ga0501035_0024057 3300049822 Bacteria 5589
366 Ga0501035_0127149 3300049822 Bacteria 2224
367 Ga0501044_0003627 3300049823 Bacteria 17369
368 Ga0501044_0462303 3300049823 Bacteria 1174
369 nmdc:mga0n895_16777_c1 3300050512 Bacteria 6730
370 nmdc:mga0rr50_219769_c1 3300050513 Bacteria 1568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049758 Ga0501241_005206 Ga0501241_005206_12_827 269
2 3300047317 Ga0495604_0196035 Ga0495604_0196035_439_1377 280
3 3300049581 Ga0501047_0040463 Ga0501047_0040463_2727_3581 283
4 iso_pu_bacteria 2643221645 2644251636 283
5 3300044694 Ga0466963_0229529 Ga0466963_0229529_53_946 284
6 3300044842 Ga0466957_0143908 Ga0466957_0143908_350_1243 284
7 3300005333 Ga0070677_10041094 Ga0070677_100410942 285
8 3300044684 Ga0466966_0106311 Ga0466966_0106311_815_1675 285
9 iso_pu_bacteria 2808606384 2808974220 285
10 iso_pu_bacteria 2808606390 2809009006 285
11 iso_pu_bacteria 2808606391 2809016157 285
12 iso_pu_bacteria 2884411467 2884414184 285
13 3300025938 Ga0207704_10153816 Ga0207704_101538162 286
14 3300046459 Ga0495629_0006054 Ga0495629_0006054_3987_4847 286
15 3300046463 Ga0495653_0107661 Ga0495653_0107661_462_1322 286
16 3300047323 Ga0495683_0096265 Ga0495683_0096265_495_1355 286
17 3300047446 Ga0495679_000015 Ga0495679_000015_63208_64068 286
18 3300048924 Ga0496121_0000985 Ga0496121_0000985_12252_13112 286
19 3300048929 Ga0496126_0006025 Ga0496126_0006025_6739_7599 286
20 iso_pu_bacteria 2600255067 2600815205 286
21 3300006173 Ga0070716_100122162 Ga0070716_1001221623 287
22 3300006871 Ga0075434_100025950 Ga0075434_1000259504 287
23 3300007076 Ga0075435_100232079 Ga0075435_1002320792 287
24 3300009147 Ga0114129_10465010 Ga0114129_104650102 287
25 3300021361 Ga0213872_10006515 Ga0213872_100065157 287
26 3300021361 Ga0213872_10030010 Ga0213872_100300103 287
27 3300039447 Ga0436361_0118308 Ga0436361_0118308_799_1665 287
28 3300039447 Ga0436361_0451010 Ga0436361_0451010_3022_3888 287
29 3300039447 Ga0436361_1012054 Ga0436361_1012054_799_1665 287
30 3300044719 Ga0466971_0120898 Ga0466971_0120898_101_976 287
31 3300045836 Ga0466958_0001035 Ga0466958_0001035_877_1752 287
32 3300046458 Ga0495591_000644 Ga0495591_000644_10683_11546 287
33 3300046458 Ga0495591_009689 Ga0495591_009689_1073_1936 287
34 3300046471 Ga0495650_0000316 Ga0495650_0000316_59132_59995 287
35 3300046471 Ga0495650_0008503 Ga0495650_0008503_1939_2802 287
36 3300046474 Ga0495605_0000007 Ga0495605_0000007_196538_197419 287
37 3300046474 Ga0495605_0008098 Ga0495605_0008098_5008_5871 287
38 3300046491 Ga0495584_0004381 Ga0495584_0004381_3298_4161 287
39 3300046499 Ga0495594_0010000 Ga0495594_0010000_3933_4814 287
40 3300046500 Ga0495596_0017803 Ga0495596_0017803_151_1014 287
41 3300046501 Ga0495607_0010501 Ga0495607_0010501_5074_5937 287
42 3300046501 Ga0495607_0077391 Ga0495607_0077391_134_997 287
43 3300046501 Ga0495607_0160157 Ga0495607_0160157_14_877 287
44 3300046506 Ga0495583_0000007 Ga0495583_0000007_155227_156108 287
45 3300046506 Ga0495583_0000848 Ga0495583_0000848_20914_21777 287
46 3300046506 Ga0495583_0014646 Ga0495583_0014646_2529_3392 287
47 3300046507 Ga0495606_0000281 Ga0495606_0000281_26327_27190 287
48 3300046512 Ga0495610_0127109 Ga0495610_0127109_180_1061 287
49 3300046513 Ga0495616_0044991 Ga0495616_0044991_878_1741 287
50 3300046515 Ga0495620_0000110 Ga0495620_0000110_8886_9767 287
51 3300046518 Ga0495631_0022920 Ga0495631_0022920_1888_2751 287
52 3300046518 Ga0495631_0024087 Ga0495631_0024087_881_1744 287
53 3300046519 Ga0495632_0007793 Ga0495632_0007793_4553_5416 287
54 3300046519 Ga0495632_0050733 Ga0495632_0050733_344_1207 287
55 3300046519 Ga0495632_0059143 Ga0495632_0059143_871_1734 287
56 3300046520 Ga0495637_0001570 Ga0495637_0001570_4532_5395 287
57 3300046522 Ga0495643_0056552 Ga0495643_0056552_971_1834 287
58 3300046523 Ga0495644_0046470 Ga0495644_0046470_588_1451 287
59 3300046524 Ga0495648_0001324 Ga0495648_0001324_18233_19096 287
60 3300046524 Ga0495648_0010438 Ga0495648_0010438_228_1109 287
61 3300046524 Ga0495648_0047480 Ga0495648_0047480_432_1295 287
62 3300046530 Ga0495654_0002972 Ga0495654_0002972_479_1342 287
63 3300046530 Ga0495654_0006577 Ga0495654_0006577_1160_2041 287
64 3300046530 Ga0495654_0037855 Ga0495654_0037855_603_1466 287
65 3300046538 Ga0495609_0000004 Ga0495609_0000004_198999_199880 287
66 3300046538 Ga0495609_0000188 Ga0495609_0000188_48889_49770 287
67 3300046542 Ga0495597_0001306 Ga0495597_0001306_9819_10700 287
68 3300046557 Ga0495622_0029251 Ga0495622_0029251_793_1656 287
69 3300046558 Ga0495633_0000020 Ga0495633_0000020_19562_20443 287
70 3300046558 Ga0495633_0017564 Ga0495633_0017564_1451_2314 287
71 3300046616 Ga0495668_0005036 Ga0495668_0005036_5329_6192 287
72 3300046616 Ga0495668_0007537 Ga0495668_0007537_2977_3840 287
73 3300046648 Ga0495611_0023398 Ga0495611_0023398_355_1236 287
74 3300046648 Ga0495611_0053370 Ga0495611_0053370_406_1269 287
75 3300046660 Ga0495625_0000004 Ga0495625_0000004_536339_537202 287
76 3300046665 Ga0495661_0000006 Ga0495661_0000006_289503_290366 287
77 3300046665 Ga0495661_0000009 Ga0495661_0000009_163501_164382 287
78 3300046665 Ga0495661_0056089 Ga0495661_0056089_629_1492 287
79 3300046692 Ga0495671_0004461 Ga0495671_0004461_4799_5662 287
80 3300046692 Ga0495671_0012420 Ga0495671_0012420_1311_2174 287
81 3300046794 Ga0495589_0001222 Ga0495589_0001222_6702_7583 287
82 3300046810 Ga0495660_0064400 Ga0495660_0064400_1009_1890 287
83 3300046810 Ga0495660_0074658 Ga0495660_0074658_111_974 287
84 3300047320 Ga0495672_0015413 Ga0495672_0015413_384_1247 287
85 3300047320 Ga0495672_0091746 Ga0495672_0091746_571_1434 287
86 3300047321 Ga0495676_0000493 Ga0495676_0000493_6124_6987 287
87 3300047323 Ga0495683_0000003 Ga0495683_0000003_18523_19404 287
88 3300047446 Ga0495679_000122 Ga0495679_000122_48216_49097 287
89 3300047469 Ga0495673_0002158 Ga0495673_0002158_667_1530 287
90 3300047469 Ga0495673_0007145 Ga0495673_0007145_1962_2843 287
91 3300047469 Ga0495673_0013562 Ga0495673_0013562_406_1269 287
92 3300047470 Ga0495681_0005337 Ga0495681_0005337_7556_8437 287
93 3300047470 Ga0495681_0009073 Ga0495681_0009073_3978_4841 287
94 3300048091 Ga0495626_0000201 Ga0495626_0000201_56171_57034 287
95 3300048925 Ga0496122_0024500 Ga0496122_0024500_2842_3723 287
96 3300048926 Ga0496123_0143545 Ga0496123_0143545_259_1140 287
97 3300048927 Ga0496124_0000383 Ga0496124_0000383_53354_54220 287
98 3300049459 Ga0495678_000007 Ga0495678_000007_19296_20177 287
99 3300049459 Ga0495678_000394 Ga0495678_000394_30774_31637 287
100 3300049459 Ga0495678_030139 Ga0495678_030139_1108_1971 287
101 3300049568 Ga0501031_0174233 Ga0501031_0174233_29_895 287
102 3300049570 Ga0501033_0077031 Ga0501033_0077031_829_1695 287
103 3300049579 Ga0501043_0167156 Ga0501043_0167156_779_1645 287
104 3300049580 Ga0501046_0046415 Ga0501046_0046415_718_1584 287
105 3300049581 Ga0501047_0046890 Ga0501047_0046890_3105_3971 287
106 3300049822 Ga0501035_0127149 Ga0501035_0127149_764_1630 287
107 3300050512 nmdc:mga0n895_16777_c1 nmdc:mga0n895_16777_c1_2583_3449 287
108 3300050513 nmdc:mga0rr50_219769_c1 nmdc:mga0rr50_219769_c1_399_1265 287
109 iso_pu_bacteria 2510065045 2510246680 287
110 iso_pu_bacteria 2512047030 2512350361 287
111 iso_pu_bacteria 2513237087 2513591833 287
112 iso_pu_bacteria 2513237166 2514052294 287
113 iso_pu_bacteria 2718217991 2719644005 287
114 iso_pu_bacteria 2885270888 2885279377 287
115 iso_pu_bacteria 2919527303 2919528066 287
116 iso_pu_bacteria 8055266321 8055268695 287
117 iso_pu_bacteria 8055301274 8055304716 287
118 3300046458 Ga0495591_000055 Ga0495591_000055_115611_116480 288
119 3300046474 Ga0495605_0000688 Ga0495605_0000688_15980_16849 288
120 3300046520 Ga0495637_0001761 Ga0495637_0001761_6412_7281 288
121 3300046542 Ga0495597_0000467 Ga0495597_0000467_11322_12191 288
122 3300046810 Ga0495660_0000741 Ga0495660_0000741_20980_21849 288
123 3300047320 Ga0495672_0012099 Ga0495672_0012099_1080_1949 288
124 iso_pu_bacteria 2842324504 2842330854 288
125 iso_pu_bacteria 2842348783 2842355193 288
126 iso_pu_bacteria 2842454564 2842456132 288
127 iso_pu_bacteria 2900634093 2900640384 288
128 iso_pu_bacteria 642555113 642616974 288
129 3300003323 rootH1_10092349 rootH1_100923493 289
130 3300003794 Ga0055531_10001879 Ga0055531_100018795 289
131 3300005337 Ga0070682_100141430 Ga0070682_1001414302 289
132 3300005347 Ga0070668_100005343 Ga0070668_1000053434 289
133 3300005548 Ga0070665_100033990 Ga0070665_1000339904 289
134 3300005563 Ga0068855_100035884 Ga0068855_1000358846 289
135 3300005617 Ga0068859_100000776 Ga0068859_1000007768 289
136 3300005834 Ga0068851_10164929 Ga0068851_101649291 289
137 3300005842 Ga0068858_100056903 Ga0068858_1000569033 289
138 3300005843 Ga0068860_100135524 Ga0068860_1001355243 289
139 3300006931 Ga0097620_100000776 Ga0097620_1000007768 289
140 3300009101 Ga0105247_10073171 Ga0105247_100731712 289
141 3300009545 Ga0105237_10072104 Ga0105237_100721042 289
142 3300010375 Ga0105239_10302162 Ga0105239_103021621 289
143 3300014968 Ga0157379_10099917 Ga0157379_100999171 289
144 3300025250 Ga0209026_1008048 Ga0209026_10080482 289
145 3300025256 Ga0209759_1001197 Ga0209759_100119715 289
146 3300025272 Ga0209455_1000218 Ga0209455_100021826 289
147 3300025273 Ga0209673_1023608 Ga0209673_10236082 289
148 3300025298 Ga0209050_1001205 Ga0209050_100120518 289
149 3300025299 Ga0209256_1000437 Ga0209256_100043725 289
150 3300025303 Ga0209051_1005117 Ga0209051_10051177 289
151 3300025304 Ga0209257_1000479 Ga0209257_10004797 289
152 3300025321 Ga0207656_10119618 Ga0207656_101196182 289
153 3300025972 Ga0207668_10006252 Ga0207668_100062523 289
154 3300025981 Ga0207640_10050497 Ga0207640_100504973 289
155 3300025986 Ga0207658_10251058 Ga0207658_102510582 289
156 3300026067 Ga0207678_10052904 Ga0207678_100529042 289
157 3300028381 Ga0268264_10012782 Ga0268264_100127825 289
158 3300037312 Ga0395899_0000018 Ga0395899_0000018_50696_51568 289
159 3300048927 Ga0496124_0269096 Ga0496124_0269096_24_896 289
160 3300049570 Ga0501033_0284111 Ga0501033_0284111_12_884 289
161 3300049822 Ga0501035_0024057 Ga0501035_0024057_1454_2326 289
162 3300049823 Ga0501044_0003627 Ga0501044_0003627_681_1553 289
163 iso_pu_bacteria 2508501125 2509127054 289
164 iso_pu_bacteria 2513237151 2513961085 289
165 iso_pu_bacteria 2738541296 2738822099 289
166 iso_pu_bacteria 2738541298 2738834581 289
167 iso_pu_bacteria 2738541306 2738875785 289
168 iso_pu_bacteria 2738543002 2739187737 289
169 iso_pu_bacteria 2738543008 2739222383 289
170 iso_pu_bacteria 2744054900 2746091144 289
171 iso_pu_bacteria 2744054901 2746097576 289
172 iso_pu_bacteria 2904615490 2904616740 289
173 iso_pu_bacteria 2945934425 2945938449 289
174 iso_pu_bacteria 2990703756 2990708451 289
175 iso_pu_bacteria 641736151 642423581 289
176 iso_pu_bacteria 642555112 642598206 289
177 3300005577 Ga0068857_100285735 Ga0068857_1002857352 290
178 3300044672 Ga0466982_0004950 Ga0466982_0004950_2033_2908 290
179 3300044693 Ga0466961_0004292 Ga0466961_0004292_7017_7892 290
180 3300044765 Ga0466970_0149260 Ga0466970_0149260_60_935 290
181 3300044901 Ga0466960_0008234 Ga0466960_0008234_2257_3132 290
182 3300045836 Ga0466958_0061920 Ga0466958_0061920_577_1452 290
183 3300048918 Ga0496115_0000544 Ga0496115_0000544_13035_13916 290
184 3300048922 Ga0496119_0002615 Ga0496119_0002615_14396_15271 290
185 3300048923 Ga0496120_0000015 Ga0496120_0000015_100559_101434 290
186 3300048929 Ga0496126_0019611 Ga0496126_0019611_3848_4723 290
187 3300049586 Ga0501070_0048584 Ga0501070_0048584_910_1785 290
188 3300049823 Ga0501044_0462303 Ga0501044_0462303_181_1056 290
189 iso_pu_bacteria 2818991450 2819620475 290
190 iso_pu_bacteria 2928108538 2928108923 290
191 iso_pu_bacteria 2928135762 2928136147 290
192 iso_pu_bacteria 2928503688 2928504072 290
193 3300003214 JGI25165J46597_1000492 JGI25165J46597_100049211 291
194 3300003756 Ga0055533_1000106 Ga0055533_100010635 291
195 3300003758 Ga0055532_1000003 Ga0055532_100000375 291
196 3300003760 Ga0055527_1000006 Ga0055527_1000006381 291
197 3300003761 Ga0055535_1000003 Ga0055535_100000375 291
198 3300003762 Ga0055542_1000007 Ga0055542_100000775 291
199 3300003763 Ga0055529_1000003 Ga0055529_1000003381 291
200 3300009545 Ga0105237_10267452 Ga0105237_102674522 291
201 3300025226 Ga0209674_100025 Ga0209674_10002568 291
202 3300025228 Ga0209672_100002 Ga0209672_100002976 291
203 3300025229 Ga0209147_100003 Ga0209147_100003976 291
204 3300025230 Ga0209563_101327 Ga0209563_1013272 291
205 3300025231 Ga0207427_101885 Ga0207427_1018853 291
206 3300025242 Ga0209258_100005 Ga0209258_100005618 291
207 3300025253 Ga0209677_110705 Ga0209677_1107051 291
208 3300025254 Ga0209148_1000006 Ga0209148_1000006976 291
209 3300025256 Ga0209759_1000006 Ga0209759_100000626 291
210 3300025261 Ga0209233_1000018 Ga0209233_1000018376 291
211 3300025272 Ga0209455_1000003 Ga0209455_1000003976 291
212 3300025904 Ga0207647_10080740 Ga0207647_100807403 291
213 3300028800 Ga0265338_10000325 Ga0265338_1000032578 291
214 3300037471 Ga0395905_0000039 Ga0395905_0000039_152507_153382 291
215 3300046455 Ga0495603_0059289 Ga0495603_0059289_806_1681 291
216 3300046457 Ga0495590_0008566 Ga0495590_0008566_2371_3246 291
217 3300046458 Ga0495591_003404 Ga0495591_003404_7049_7924 291
218 3300046461 Ga0495641_0036108 Ga0495641_0036108_153_1028 291
219 3300046462 Ga0495651_0044167 Ga0495651_0044167_1891_2766 291
220 3300046472 Ga0495580_0167245 Ga0495580_0167245_79_954 291
221 3300046472 Ga0495580_0169535 Ga0495580_0169535_42_917 291
222 3300046473 Ga0495582_0101934 Ga0495582_0101934_179_1054 291
223 3300046473 Ga0495582_0179390 Ga0495582_0179390_288_1163 291
224 3300046500 Ga0495596_0008066 Ga0495596_0008066_883_1758 291
225 3300046500 Ga0495596_0050248 Ga0495596_0050248_129_1004 291
226 3300046507 Ga0495606_0015538 Ga0495606_0015538_2711_3586 291
227 3300046511 Ga0495608_0078871 Ga0495608_0078871_654_1529 291
228 3300046514 Ga0495618_0024415 Ga0495618_0024415_1907_2782 291
229 3300046514 Ga0495618_0082858 Ga0495618_0082858_639_1514 291
230 3300046516 Ga0495628_0122098 Ga0495628_0122098_452_1327 291
231 3300046516 Ga0495628_0130143 Ga0495628_0130143_696_1571 291
232 3300046517 Ga0495630_0003392 Ga0495630_0003392_5440_6315 291
233 3300046522 Ga0495643_0058648 Ga0495643_0058648_607_1482 291
234 3300046524 Ga0495648_0170105 Ga0495648_0170105_55_930 291
235 3300046526 Ga0495666_0004866 Ga0495666_0004866_128_1003 291
236 3300046526 Ga0495666_0009818 Ga0495666_0009818_3543_4418 291
237 3300046529 Ga0495652_0058891 Ga0495652_0058891_981_1856 291
238 3300046531 Ga0495665_0005375 Ga0495665_0005375_2964_3839 291
239 3300046531 Ga0495665_0037827 Ga0495665_0037827_1412_2287 291
240 3300046533 Ga0495640_0046287 Ga0495640_0046287_625_1500 291
241 3300046535 Ga0495586_0041496 Ga0495586_0041496_903_1778 291
242 3300046536 Ga0495587_0012657 Ga0495587_0012657_809_1684 291
243 3300046543 Ga0495645_0145529 Ga0495645_0145529_494_1369 291
244 3300046559 Ga0495667_0044559 Ga0495667_0044559_878_1753 291
245 3300046642 Ga0495634_0072434 Ga0495634_0072434_494_1369 291
246 3300046642 Ga0495634_0202454 Ga0495634_0202454_316_1191 291
247 3300046663 Ga0495635_0017117 Ga0495635_0017117_1089_1964 291
248 3300046663 Ga0495635_0043863 Ga0495635_0043863_791_1666 291
249 3300046665 Ga0495661_0003186 Ga0495661_0003186_1905_2780 291
250 3300046675 Ga0495657_0039157 Ga0495657_0039157_2301_3176 291
251 3300046675 Ga0495657_0163978 Ga0495657_0163978_397_1272 291
252 3300046679 Ga0495623_0007438 Ga0495623_0007438_5352_6227 291
253 3300046679 Ga0495623_0039453 Ga0495623_0039453_271_1146 291
254 3300046680 Ga0495646_0021475 Ga0495646_0021475_2912_3787 291
255 3300046680 Ga0495646_0082192 Ga0495646_0082192_183_1058 291
256 3300046692 Ga0495671_0051431 Ga0495671_0051431_139_1014 291
257 3300046694 Ga0495649_0041880 Ga0495649_0041880_378_1253 291
258 3300046794 Ga0495589_0007080 Ga0495589_0007080_4950_5825 291
259 3300046809 Ga0495600_0004853 Ga0495600_0004853_816_1691 291
260 3300047315 Ga0495581_0010402 Ga0495581_0010402_4218_5093 291
261 3300047315 Ga0495581_0056749 Ga0495581_0056749_289_1164 291
262 3300047321 Ga0495676_0081056 Ga0495676_0081056_888_1763 291
263 3300047322 Ga0495680_0130897 Ga0495680_0130897_310_1185 291
264 3300047323 Ga0495683_0001914 Ga0495683_0001914_8712_9587 291
265 3300047323 Ga0495683_0002324 Ga0495683_0002324_157_1032 291
266 3300047443 Ga0495687_023573 Ga0495687_023573_626_1501 291
267 3300047444 Ga0495675_0007759 Ga0495675_0007759_5058_5933 291
268 3300047444 Ga0495675_0043759 Ga0495675_0043759_615_1490 291
269 3300047446 Ga0495679_005235 Ga0495679_005235_3259_4134 291
270 3300047469 Ga0495673_0020783 Ga0495673_0020783_821_1696 291
271 3300047471 Ga0495684_0193621 Ga0495684_0193621_573_1448 291
272 3300047673 Ga0495593_0033702 Ga0495593_0033702_1833_2708 291
273 3300048089 Ga0495614_0010541 Ga0495614_0010541_41_916 291
274 3300048091 Ga0495626_0007475 Ga0495626_0007475_2160_3035 291
275 3300048905 Ga0496102_0115698 Ga0496102_0115698_728_1603 291
276 3300048920 Ga0496117_0005723 Ga0496117_0005723_7405_8280 291
277 3300048921 Ga0496118_0009927 Ga0496118_0009927_4637_5716 291
278 3300002705 JGI25156J39149_1000616 JGI25156J39149_10006167 292
279 3300005458 Ga0070681_10118628 Ga0070681_101186283 292
280 3300005563 Ga0068855_100098413 Ga0068855_1000984133 292
281 3300005614 Ga0068856_100337895 Ga0068856_1003378952 292
282 3300009093 Ga0105240_10015865 Ga0105240_1001586510 292
283 3300009093 Ga0105240_10061613 Ga0105240_100616132 292
284 3300009545 Ga0105237_10330397 Ga0105237_103303972 292
285 3300009551 Ga0105238_10087123 Ga0105238_100871233 292
286 3300013104 Ga0157370_10186441 Ga0157370_101864412 292
287 3300013105 Ga0157369_10005727 Ga0157369_1000572710 292
288 3300013105 Ga0157369_10163353 Ga0157369_101633532 292
289 3300013307 Ga0157372_10166761 Ga0157372_101667612 292
290 3300013307 Ga0157372_10947722 Ga0157372_109477221 292
291 3300025256 Ga0209759_1000086 Ga0209759_1000086139 292
292 3300025912 Ga0207707_10020449 Ga0207707_100204494 292
293 3300025913 Ga0207695_10064613 Ga0207695_100646132 292
294 3300025914 Ga0207671_10287320 Ga0207671_102873202 292
295 3300025917 Ga0207660_10103853 Ga0207660_101038531 292
296 3300025949 Ga0207667_10025316 Ga0207667_100253165 292
297 3300025949 Ga0207667_10107629 Ga0207667_101076292 292
298 3300028017 Ga0265356_1000148 Ga0265356_10001482 292
299 3300031548 Ga0307408_100028018 Ga0307408_1000280182 292
300 3300031731 Ga0307405_10066283 Ga0307405_100662833 292
301 3300032005 Ga0307411_10076605 Ga0307411_100766053 292
302 3300038443 Ga0395901_0326264 Ga0395901_0326264_135_1016 292
303 3300046472 Ga0495580_0000310 Ga0495580_0000310_29559_30443 292
304 3300046516 Ga0495628_0002024 Ga0495628_0002024_12102_12983 292
305 3300046794 Ga0495589_0016648 Ga0495589_0016648_2648_3529 292
306 3300047472 Ga0495686_0000099 Ga0495686_0000099_44415_45296 292
307 3300003203 JGI25406J46586_10021803 JGI25406J46586_100218033 293
308 3300005985 Ga0081539_10008055 Ga0081539_100080553 293
309 3300006881 Ga0068865_100002909 Ga0068865_1000029094 293
310 3300014969 Ga0157376_10210893 Ga0157376_102108932 293
311 3300025904 Ga0207647_10027253 Ga0207647_100272533 293
312 3300025938 Ga0207704_10158521 Ga0207704_101585212 293
313 3300031090 Ga0265760_10015115 Ga0265760_100151152 293
314 3300031911 Ga0307412_10000002 Ga0307412_10000002474 293
315 3300042010 Ga0439452_025335 Ga0439452_025335_325_1209 293
316 3300046454 Ga0495592_0027540 Ga0495592_0027540_1960_2841 293
317 3300046454 Ga0495592_0092645 Ga0495592_0092645_324_1310 293
318 3300046455 Ga0495603_0001966 Ga0495603_0001966_10399_11280 293
319 3300046459 Ga0495629_0000031 Ga0495629_0000031_54388_55269 293
320 3300046459 Ga0495629_0005434 Ga0495629_0005434_2066_2947 293
321 3300046459 Ga0495629_0022984 Ga0495629_0022984_1943_2920 293
322 3300046460 Ga0495638_0032420 Ga0495638_0032420_2052_2933 293
323 3300046463 Ga0495653_0002304 Ga0495653_0002304_3684_4565 293
324 3300046463 Ga0495653_0005627 Ga0495653_0005627_3339_4220 293
325 3300046463 Ga0495653_0102515 Ga0495653_0102515_809_1795 293
326 3300046472 Ga0495580_0000442 Ga0495580_0000442_32037_32918 293
327 3300046472 Ga0495580_0006600 Ga0495580_0006600_4686_5567 293
328 3300046472 Ga0495580_0039771 Ga0495580_0039771_1374_2255 293
329 3300046473 Ga0495582_0008041 Ga0495582_0008041_3079_3960 293
330 3300046474 Ga0495605_0004538 Ga0495605_0004538_5763_6644 293
331 3300046477 Ga0495664_0010897 Ga0495664_0010897_162_1043 293
332 3300046507 Ga0495606_0027096 Ga0495606_0027096_3106_3987 293
333 3300046512 Ga0495610_0009281 Ga0495610_0009281_3136_4029 293
334 3300046514 Ga0495618_0004949 Ga0495618_0004949_3829_4710 293
335 3300046514 Ga0495618_0077070 Ga0495618_0077070_756_1637 293
336 3300046515 Ga0495620_0004123 Ga0495620_0004123_5743_6624 293
337 3300046516 Ga0495628_0010253 Ga0495628_0010253_4377_5258 293
338 3300046516 Ga0495628_0358751 Ga0495628_0358751_133_1014 293
339 3300046517 Ga0495630_0002742 Ga0495630_0002742_8321_9202 293
340 3300046517 Ga0495630_0017212 Ga0495630_0017212_270_1151 293
341 3300046517 Ga0495630_0220926 Ga0495630_0220926_241_1221 293
342 3300046519 Ga0495632_0075924 Ga0495632_0075924_314_1195 293
343 3300046524 Ga0495648_0016068 Ga0495648_0016068_3184_4065 293
344 3300046526 Ga0495666_0007264 Ga0495666_0007264_4045_4926 293
345 3300046526 Ga0495666_0124634 Ga0495666_0124634_240_1121 293
346 3300046529 Ga0495652_0006700 Ga0495652_0006700_3917_4798 293
347 3300046529 Ga0495652_0040343 Ga0495652_0040343_285_1265 293
348 3300046535 Ga0495586_0005006 Ga0495586_0005006_162_1043 293
349 3300046538 Ga0495609_0015847 Ga0495609_0015847_698_1579 293
350 3300046543 Ga0495645_0001666 Ga0495645_0001666_7657_8538 293
351 3300046642 Ga0495634_0005210 Ga0495634_0005210_3309_4190 293
352 3300046648 Ga0495611_0135742 Ga0495611_0135742_216_1097 293
353 3300046674 Ga0495588_0008274 Ga0495588_0008274_832_1713 293
354 3300046678 Ga0495599_0022450 Ga0495599_0022450_2672_3553 293
355 3300046678 Ga0495599_0025052 Ga0495599_0025052_1232_2212 293
356 3300046678 Ga0495599_0056764 Ga0495599_0056764_458_1339 293
357 3300046679 Ga0495623_0006463 Ga0495623_0006463_4584_5465 293
358 3300046679 Ga0495623_0009674 Ga0495623_0009674_3564_4445 293
359 3300046680 Ga0495646_0000947 Ga0495646_0000947_3563_4444 293
360 3300046680 Ga0495646_0004463 Ga0495646_0004463_6289_7170 293
361 3300046680 Ga0495646_0007123 Ga0495646_0007123_568_1554 293
362 3300046680 Ga0495646_0023659 Ga0495646_0023659_1383_2363 293
363 3300046690 Ga0495624_0003069 Ga0495624_0003069_11256_12137 293
364 3300046690 Ga0495624_0004592 Ga0495624_0004592_1235_2215 293
365 3300046690 Ga0495624_0004820 Ga0495624_0004820_2921_3802 293
366 3300046794 Ga0495589_0137730 Ga0495589_0137730_126_1007 293
367 3300047315 Ga0495581_0003818 Ga0495581_0003818_3867_4748 293
368 3300047317 Ga0495604_0000745 Ga0495604_0000745_12773_13654 293
369 3300047317 Ga0495604_0011048 Ga0495604_0011048_4921_5901 293
370 3300047317 Ga0495604_0017087 Ga0495604_0017087_2296_3177 293
371 3300047319 Ga0495674_0016136 Ga0495674_0016136_4098_4979 293
372 3300047319 Ga0495674_0050541 Ga0495674_0050541_2504_3385 293
373 3300047319 Ga0495674_0077968 Ga0495674_0077968_966_1847 293
374 3300047320 Ga0495672_0012358 Ga0495672_0012358_1225_2106 293
375 3300047321 Ga0495676_0016267 Ga0495676_0016267_4007_4888 293
376 3300047321 Ga0495676_0086242 Ga0495676_0086242_1301_2182 293
377 3300047322 Ga0495680_0003122 Ga0495680_0003122_3342_4223 293
378 3300047444 Ga0495675_0089568 Ga0495675_0089568_610_1491 293
379 3300047444 Ga0495675_0209331 Ga0495675_0209331_113_994 293
380 3300047446 Ga0495679_000006 Ga0495679_000006_167701_168582 293
381 3300047446 Ga0495679_000599 Ga0495679_000599_12617_13498 293
382 3300047471 Ga0495684_0017524 Ga0495684_0017524_3543_4424 293
383 3300047472 Ga0495686_0116331 Ga0495686_0116331_392_1273 293
384 3300047673 Ga0495593_0002281 Ga0495593_0002281_7284_8165 293
385 3300047673 Ga0495593_0025920 Ga0495593_0025920_937_1818 293
386 3300048088 Ga0495602_0025980 Ga0495602_0025980_4133_5014 293
387 3300048088 Ga0495602_0026203 Ga0495602_0026203_4045_4926 293
388 3300048088 Ga0495602_0329631 Ga0495602_0329631_163_1044 293
389 3300048089 Ga0495614_0000386 Ga0495614_0000386_4805_5686 293
390 3300048907 Ga0496104_0000016 Ga0496104_0000016_176178_177140 293
391 3300048908 Ga0496105_0000010 Ga0496105_0000010_34489_35451 293
392 3300048920 Ga0496117_0012367 Ga0496117_0012367_4700_5593 293
393 3300048921 Ga0496118_0010169 Ga0496118_0010169_3287_4180 293
394 3300048921 Ga0496118_0017426 Ga0496118_0017426_5556_6437 293
395 3300048924 Ga0496121_0013089 Ga0496121_0013089_4712_5593 293
396 3300048929 Ga0496126_0000102 Ga0496126_0000102_27204_28184 293
397 3300049459 Ga0495678_012135 Ga0495678_012135_1863_2744 293
398 3300049460 Ga0495682_0018900 Ga0495682_0018900_1080_1961 293
399 3300001989 JGI24739J22299_10010377 JGI24739J22299_100103773 294
400 3300003756 Ga0055533_1002867 Ga0055533_10028672 294
401 3300005367 Ga0070667_100129409 Ga0070667_1001294092 294
402 3300015262 Ga0182007_10000313 Ga0182007_1000031328 294
403 3300025735 Ga0207713_1001596 Ga0207713_10015963 294
404 3300025904 Ga0207647_10082072 Ga0207647_100820722 294
405 3300026078 Ga0207702_10002786 Ga0207702_1000278612 294
406 3300044693 Ga0466961_0166134 Ga0466961_0166134_38_928 294
407 3300048919 Ga0496116_0010692 Ga0496116_0010692_3728_4717 294
408 3300048921 Ga0496118_0002759 Ga0496118_0002759_12854_13843 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

22

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8885 6 284
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.878 10 286
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.8584 9 287
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8497 6 284
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.8482 10 288
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9575 13 289 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9442 13 289 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9151 18 292 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8819 18 289 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8791 9 290 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9645 66 268
AF-A0A2V7AYD1-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9604 117 288 GO:0016491
AF-A0A2U0UWB7-F1-model_v4 deleted 0.96 10 287
AF-A0A529NSE1-F1-model_v4 Oxidoreductase 0.9598 66 268
AF-A0A0C2MEU3-F1-model_v4 Putative oxidoreductase YdbC 0.9583 105 217

Feature Viewer

pLDDT pTM Quality
86.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map