F436600

General Info

Members Datasets Scaffolds Average Seq Length
407 229 814 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2795385470|2795787263
Length 181
Sequence ASESSDTARARSAHRASATGGSRELAKYQDPLEIQRVLNGAKTIAVVGLSNNELRASYFVGYYLKRHGYNVIPVNPRASEILGAKSYPSLLEVPEPVDIVNVFRAPDALPEIARQTVQIGAKALWCQFGVINLEGARIAEDGGVTVVMDRCIKVEHARYVGRMHWLGFNTQRITSVRSGLQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
52 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
53 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
54 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
226 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
227 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
228 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
229 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0.74
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 10.07
Rhizosphere 77.15
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000804 3300005329 Bacteria 23227
2 Ga0070683_100369184 3300005329 Bacteria 1367
3 Ga0070683_100506829 3300005329 Bacteria 1153
4 Ga0070670_101462838 3300005331 Bacteria 627
5 Ga0068869_100170219 3300005334 Bacteria 1701
6 Ga0068869_100877711 3300005334 Bacteria 775
7 Ga0070666_10104409 3300005335 Bacteria 1956
8 Ga0070680_101009713 3300005336 Bacteria 719
9 Ga0068868_100335486 3300005338 Bacteria 1291
10 Ga0070660_100327369 3300005339 Bacteria 1259
11 Ga0070668_100444931 3300005347 Bacteria 1113
12 Ga0070671_100497116 3300005355 Bacteria 1049
13 Ga0070667_100120720 3300005367 Bacteria 2280
14 Ga0070709_10014701 3300005434 Bacteria 4432
15 Ga0070709_10106292 3300005434 Bacteria 1879
16 Ga0070714_100009569 3300005435 Bacteria 7627
17 Ga0070714_100566804 3300005435 Bacteria 1088
18 Ga0070713_100045520 3300005436 Bacteria 3596
19 Ga0070713_100071184 3300005436 Bacteria 2938
20 Ga0070713_100098683 3300005436 Bacteria 2526
21 Ga0070713_100265908 3300005436 Bacteria 1569
22 Ga0070713_100587033 3300005436 Bacteria 1057
23 Ga0070710_10052528 3300005437 Bacteria 2292
24 Ga0070710_10122525 3300005437 Bacteria 1575
25 Ga0070711_100067362 3300005439 Bacteria 2511
26 Ga0070711_100119349 3300005439 Bacteria 1948
27 Ga0070711_100122766 3300005439 Bacteria 1923
28 Ga0070678_100248123 3300005456 Bacteria 1492
29 Ga0070706_100135155 3300005467 Bacteria 2302
30 Ga0070707_100031345 3300005468 Bacteria 5064
31 Ga0070707_100054945 3300005468 Bacteria 3818
32 Ga0070698_100062237 3300005471 Bacteria 3765
33 Ga0070698_100201370 3300005471 Bacteria 1927
34 Ga0070699_100087847 3300005518 Bacteria 2714
35 Ga0070684_100032607 3300005535 Bacteria 4441
36 Ga0070684_100235853 3300005535 Bacteria 1671
37 Ga0070695_100944709 3300005545 Bacteria 698
38 Ga0070665_100074406 3300005548 Bacteria 3403
39 Ga0068855_100266033 3300005563 Bacteria 1908
40 Ga0070664_100105462 3300005564 Bacteria 2455
41 Ga0070664_100407509 3300005564 Bacteria 1244
42 Ga0070664_100903382 3300005564 Bacteria 828
43 Ga0068857_100321657 3300005577 Bacteria 1429
44 Ga0068856_100947319 3300005614 Bacteria 879
45 Ga0068856_101397490 3300005614 Bacteria 714
46 Ga0068859_100514223 3300005617 Bacteria 1292
47 Ga0068861_100043215 3300005719 Bacteria 3381
48 Ga0068858_100717008 3300005842 Bacteria 974
49 Ga0068858_101618894 3300005842 Bacteria 639
50 Ga0081455_10013953 3300005937 Bacteria 7898
51 Ga0081455_10020314 3300005937 Bacteria 6260
52 Ga0070717_10123271 3300006028 Bacteria 2222
53 Ga0070717_10186554 3300006028 Bacteria 1810
54 Ga0070717_10331373 3300006028 Bacteria 1358
55 Ga0075365_10340574 3300006038 Bacteria 1057
56 Ga0075368_10024426 3300006042 Bacteria 2315
57 Ga0075364_10536832 3300006051 Bacteria 799
58 Ga0070715_10056107 3300006163 Bacteria 1712
59 Ga0070716_100610543 3300006173 Bacteria 822
60 Ga0070712_100094782 3300006175 Bacteria 2194
61 Ga0070712_100224147 3300006175 Bacteria 1490
62 Ga0070712_100399893 3300006175 Bacteria 1134
63 Ga0075367_10119482 3300006178 Bacteria 1623
64 Ga0075366_10056717 3300006195 Bacteria 2327
65 Ga0075370_10347771 3300006353 Bacteria 885
66 Ga0075429_100354899 3300006880 Bacteria 1284
67 Ga0097620_100514216 3300006931 Bacteria 1292
68 Ga0099794_10480106 3300007265 Bacteria 653
69 Ga0105240_10922061 3300009093 Bacteria 938
70 Ga0111539_11115948 3300009094 Bacteria 916
71 Ga0105245_10383971 3300009098 Bacteria 1399
72 Ga0105243_10207487 3300009148 Bacteria 1723
73 Ga0105237_10281416 3300009545 Bacteria 1666
74 Ga0105237_10800101 3300009545 Bacteria 949
75 Ga0105239_10397022 3300010375 Bacteria 1560
76 Ga0105239_11707489 3300010375 Bacteria 729
77 Ga0157344_1007609 3300012476 Bacteria 727
78 Ga0157343_1002349 3300012488 Bacteria 1025
79 Ga0157347_1004090 3300012502 Bacteria 1340
80 Ga0157342_1037616 3300012507 Bacteria 636
81 Ga0157369_10989879 3300013105 Bacteria 861
82 Ga0157369_11561150 3300013105 Bacteria 671
83 Ga0157374_10424286 3300013296 Bacteria 1329
84 Ga0157374_10838644 3300013296 Bacteria 936
85 Ga0157374_10885058 3300013296 Bacteria 910
86 Ga0157374_11299710 3300013296 Bacteria 749
87 Ga0157378_10236522 3300013297 Bacteria 1743
88 Ga0157378_10286409 3300013297 Bacteria 1590
89 Ga0157378_10756070 3300013297 Bacteria 995
90 Ga0157372_11034688 3300013307 Bacteria 951
91 Ga0157375_11079449 3300013308 Bacteria 939
92 Ga0163163_10956111 3300014325 Bacteria 920
93 Ga0157379_10961579 3300014968 Bacteria 813
94 Ga0157379_11244151 3300014968 Bacteria 717
95 Ga0157379_11464931 3300014968 Bacteria 663
96 Ga0157376_11531961 3300014969 Bacteria 700
97 Ga0182005_1159134 3300015265 Bacteria 661
98 Ga0163161_10679284 3300017792 Bacteria 856
99 Ga0213874_10134380 3300021377 Bacteria 852
100 Ga0213875_10012568 3300021388 Bacteria 4175
101 Ga0213875_10069642 3300021388 Bacteria 1642
102 Ga0224712_10005976 3300022467 Bacteria 3437
103 Ga0224712_10462864 3300022467 Bacteria 610
104 Ga0228598_1022016 3300024227 Bacteria 1255
105 Ga0207653_10005871 3300025885 Bacteria 3831
106 Ga0207699_10046367 3300025906 Bacteria 2542
107 Ga0207699_10208545 3300025906 Bacteria 1328
108 Ga0207684_10188845 3300025910 Bacteria 1777
109 Ga0207693_10337471 3300025915 Bacteria 1179
110 Ga0207693_10390358 3300025915 Bacteria 1088
111 Ga0207693_10460225 3300025915 Bacteria 994
112 Ga0207663_10011508 3300025916 Bacteria 4751
113 Ga0207663_10245482 3300025916 Bacteria 1315
114 Ga0207657_10095594 3300025919 Bacteria 2472
115 Ga0207649_10097572 3300025920 Bacteria 1938
116 Ga0207646_10027516 3300025922 Bacteria 5186
117 Ga0207687_10934332 3300025927 Bacteria 743
118 Ga0207700_10018571 3300025928 Bacteria 4677
119 Ga0207700_10170713 3300025928 Bacteria 1814
120 Ga0207700_10303225 3300025928 Bacteria 1380
121 Ga0207700_10345836 3300025928 Bacteria 1294
122 Ga0207700_10713786 3300025928 Bacteria 895
123 Ga0207700_10998135 3300025928 Bacteria 749
124 Ga0207700_11897987 3300025928 Bacteria 522
125 Ga0207664_10010545 3300025929 Bacteria 6528
126 Ga0207664_10013709 3300025929 Bacteria 5829
127 Ga0207664_10025391 3300025929 Bacteria 4463
128 Ga0207664_10054873 3300025929 Bacteria 3159
129 Ga0207664_10170853 3300025929 Bacteria 1860
130 Ga0207664_10703968 3300025929 Bacteria 908
131 Ga0207664_11501204 3300025929 Bacteria 595
132 Ga0207706_10923745 3300025933 Bacteria 736
133 Ga0207709_10884718 3300025935 Bacteria 725
134 Ga0207670_10479103 3300025936 Bacteria 1007
135 Ga0207669_10498468 3300025937 Bacteria 974
136 Ga0207704_11150170 3300025938 Bacteria 661
137 Ga0207665_10013309 3300025939 Bacteria 5408
138 Ga0207665_10033928 3300025939 Bacteria 3385
139 Ga0207689_10048376 3300025942 Bacteria 3507
140 Ga0207689_10853089 3300025942 Bacteria 769
141 Ga0207661_10001535 3300025944 Bacteria 15689
142 Ga0207661_10454907 3300025944 Bacteria 1166
143 Ga0207679_10081162 3300025945 Bacteria 2479
144 Ga0207679_11063332 3300025945 Bacteria 742
145 Ga0207667_10552153 3300025949 Bacteria 1165
146 Ga0207668_10727297 3300025972 Bacteria 874
147 Ga0207703_11477063 3300026035 Bacteria 654
148 Ga0207702_10926941 3300026078 Bacteria 863
149 Ga0207674_10106742 3300026116 Bacteria 2778
150 Ga0207675_100082554 3300026118 Bacteria 3014
151 Ga0209813_10101362 3300027866 Bacteria 980
152 Ga0268264_10823643 3300028381 Bacteria 928
153 Ga0307515_10006702 3300028794 Bacteria 22934
154 Ga0307515_10298860 3300028794 Bacteria 1297
155 Ga0307515_10722955 3300028794 Bacteria 613
156 Ga0265338_10079756 3300028800 Bacteria 2753
157 Ga0307512_10019581 3300030522 Bacteria 6153
158 Ga0307512_10027640 3300030522 Bacteria 4987
159 Ga0307512_10063617 3300030522 Bacteria 2818
160 Ga0265760_10124034 3300031090 Bacteria 831
161 Ga0307513_10030348 3300031456 Bacteria 6142
162 Ga0307513_10394790 3300031456 Bacteria 1119
163 Ga0307508_10005723 3300031616 Bacteria 11764
164 Ga0307508_10005798 3300031616 Bacteria 11671
165 Ga0307508_10194768 3300031616 Bacteria 1628
166 Ga0307508_10299131 3300031616 Bacteria 1202
167 Ga0307516_10216672 3300031730 Bacteria 1626
168 Ga0307413_10000299 3300031824 Bacteria 15325
169 Ga0307518_10440766 3300031838 Bacteria 703
170 Ga0307406_10775413 3300031901 Bacteria 807
171 Ga0307416_100343811 3300032002 Bacteria 1506
172 Ga0307415_100747904 3300032126 Bacteria 887
173 Ga0307507_10028126 3300033179 Bacteria 6000
174 Ga0307510_10092567 3300033180 Bacteria 2859
175 Ga0316214_1034279 3300033545 Bacteria 724
176 Ga0373926_0001382 3300035083 Bacteria 7341
177 Ga0373926_0005112 3300035083 Bacteria 4309
178 Ga0373934_0070253 3300035086 Bacteria 1400
179 Ga0373944_0001008 3300035089 Bacteria 6975
180 Ga0373944_0001192 3300035089 Bacteria 6499
181 Ga0373923_0005361 3300035111 Bacteria 4352
182 Ga0373936_0000585 3300035113 Bacteria 12566
183 Ga0373936_0056042 3300035113 Bacteria 1601
184 Ga0373936_0188710 3300035113 Bacteria 906
185 Ga0373945_0000090 3300035116 Bacteria 21258
186 Ga0373945_0151387 3300035116 Bacteria 940
187 Ga0373953_0279374 3300035117 Bacteria 727
188 Ga0373943_0000104 3300035170 Bacteria 30769
189 Ga0373943_0008043 3300035170 Bacteria 4729
190 Ga0373946_0002267 3300035171 Bacteria 6790
191 Ga0373946_0007994 3300035171 Bacteria 3885
192 Ga0373955_0030142 3300035172 Bacteria 2829
193 Ga0373955_0103520 3300035172 Bacteria 1637
194 Ga0373924_0013109 3300035410 Bacteria 3110
195 Ga0373931_0240234 3300035691 Bacteria 1098
196 Ga0373935_0009802 3300035692 Bacteria 5735
197 Ga0373935_0043310 3300035692 Bacteria 2832
198 Ga0373927_0046058 3300035695 Bacteria 2822
199 Ga0373927_0065136 3300035695 Bacteria 2357
200 Ga0373933_0083365 3300035724 Bacteria 1963
201 Ga0373933_0269199 3300035724 Bacteria 1099
202 Ga0373933_0283723 3300035724 Bacteria 1070
203 Ga0373947_0030889 3300035725 Bacteria 3149
204 Ga0373947_0150708 3300035725 Bacteria 1498
205 Ga0373937_0078124 3300036401 Bacteria 3059
206 Ga0373937_0196220 3300036401 Bacteria 1897
207 Ga0373937_0455217 3300036401 Bacteria 1215
208 Ga0373937_0602748 3300036401 Bacteria 1043
209 Ga0373925_0001409 3300037068 Bacteria 20883
210 Ga0373925_0082949 3300037068 Bacteria 2440
211 Ga0373925_0484591 3300037068 Bacteria 1014
212 Ga0436364_0186251 3300037853 Bacteria 6064
213 Ga0436364_0667538 3300037853 Bacteria 9506
214 Ga0436364_1274919 3300037853 Bacteria 5081
215 Ga0395901_0133392 3300038443 Bacteria 2610
216 Ga0436365_0250164 3300039437 Bacteria 1420
217 Ga0436363_0598631 3300039450 Bacteria 1079
218 Ga0436363_0754565 3300039450 Bacteria 879
219 Ga0436363_1132436 3300039450 Bacteria 576
220 Ga0436363_1199269 3300039450 Bacteria 647
221 Ga0436362_0047835 3300039453 Bacteria 957
222 Ga0436362_0201340 3300039453 Bacteria 710
223 Ga0450914_024372 3300042118 Bacteria 694
224 Ga0466969_0005774 3300044656 Bacteria 6576
225 Ga0466961_0005895 3300044693 Bacteria 7765
226 Ga0466961_0147201 3300044693 Bacteria 1472
227 Ga0466959_0182824 3300045049 Bacteria 1466
228 Ga0466958_0440285 3300045836 Bacteria 843
229 Ga0466967_0042086 3300045976 Bacteria 3945
230 Ga0466967_0797342 3300045976 Bacteria 938
231 Ga0495592_0133721 3300046454 Bacteria 1732
232 Ga0495592_0221569 3300046454 Bacteria 1264
233 Ga0495592_0602884 3300046454 Bacteria 669
234 Ga0495592_0734472 3300046454 Bacteria 591
235 Ga0495603_0013850 3300046455 Bacteria 4881
236 Ga0495629_0007579 3300046459 Bacteria 7996
237 Ga0495641_0007256 3300046461 Bacteria 6964
238 Ga0495641_0062944 3300046461 Bacteria 1672
239 Ga0495651_0030177 3300046462 Bacteria 4227
240 Ga0495651_0134079 3300046462 Bacteria 1804
241 Ga0495651_0245128 3300046462 Bacteria 1227
242 Ga0495651_0489910 3300046462 Bacteria 788
243 Ga0495653_0000407 3300046463 Bacteria 34501
244 Ga0495653_0673058 3300046463 Bacteria 630
245 Ga0495580_0023623 3300046472 Bacteria 4511
246 Ga0495582_0006991 3300046473 Bacteria 6275
247 Ga0495582_0022024 3300046473 Bacteria 3486
248 Ga0495639_0002073 3300046475 Bacteria 8872
249 Ga0495662_0004407 3300046476 Bacteria 7069
250 Ga0495662_0013626 3300046476 Bacteria 3958
251 Ga0495664_0000070 3300046477 Bacteria 49408
252 Ga0495664_0052747 3300046477 Bacteria 2417
253 Ga0495594_0003845 3300046499 Bacteria 7714
254 Ga0495608_0065890 3300046511 Bacteria 2372
255 Ga0495618_0011548 3300046514 Bacteria 5358
256 Ga0495618_0040775 3300046514 Bacteria 2923
257 Ga0495628_0100099 3300046516 Bacteria 2238
258 Ga0495628_0245650 3300046516 Bacteria 1337
259 Ga0495630_0032489 3300046517 Bacteria 3889
260 Ga0495630_0090573 3300046517 Bacteria 2310
261 Ga0495630_0233931 3300046517 Bacteria 1404
262 Ga0495666_0037298 3300046526 Bacteria 2364
263 Ga0495652_0014814 3300046529 Bacteria 6990
264 Ga0495652_0135512 3300046529 Bacteria 1943
265 Ga0495652_0662856 3300046529 Bacteria 705
266 Ga0495665_0003759 3300046531 Bacteria 8216
267 Ga0495665_0007128 3300046531 Bacteria 6034
268 Ga0495640_0015950 3300046533 Bacteria 5636
269 Ga0495640_0136862 3300046533 Bacteria 1581
270 Ga0495586_0007625 3300046535 Bacteria 5774
271 Ga0495587_0014118 3300046536 Bacteria 5015
272 Ga0495587_0018231 3300046536 Bacteria 4354
273 Ga0495587_0155207 3300046536 Bacteria 1304
274 Ga0495587_0681834 3300046536 Bacteria 564
275 Ga0495645_0066109 3300046543 Bacteria 2614
276 Ga0495645_0094219 3300046543 Bacteria 2136
277 Ga0495645_0162147 3300046543 Bacteria 1545
278 Ga0495622_0117917 3300046557 Bacteria 1213
279 Ga0495667_0005979 3300046559 Bacteria 8229
280 Ga0495667_0036038 3300046559 Bacteria 3304
281 Ga0495667_0041054 3300046559 Bacteria 3069
282 Ga0495667_0222999 3300046559 Bacteria 1203
283 Ga0495634_0006657 3300046642 Bacteria 8766
284 Ga0495634_0031928 3300046642 Bacteria 3624
285 Ga0495634_0307858 3300046642 Bacteria 956
286 Ga0495635_0000481 3300046663 Bacteria 25143
287 Ga0495635_0194535 3300046663 Bacteria 1376
288 Ga0495657_0003012 3300046675 Bacteria 13932
289 Ga0495657_0100751 3300046675 Bacteria 1841
290 Ga0495657_0134530 3300046675 Bacteria 1546
291 Ga0495657_0134964 3300046675 Bacteria 1542
292 Ga0495599_0007250 3300046678 Bacteria 6718
293 Ga0495599_0231306 3300046678 Bacteria 1128
294 Ga0495599_0412265 3300046678 Bacteria 803
295 Ga0495599_0592410 3300046678 Bacteria 646
296 Ga0495623_0037736 3300046679 Bacteria 3090
297 Ga0495623_0065874 3300046679 Bacteria 2264
298 Ga0495646_0050428 3300046680 Bacteria 2523
299 Ga0495647_0004092 3300046681 Bacteria 4712
300 Ga0495658_0002586 3300046683 Bacteria 9101
301 Ga0495613_0326453 3300046689 Bacteria 1058
302 Ga0495624_0000293 3300046690 Bacteria 39469
303 Ga0495624_0006924 3300046690 Bacteria 7996
304 Ga0495600_0010520 3300046809 Bacteria 5746
305 Ga0495581_0025399 3300047315 Bacteria 3434
306 Ga0495581_0056616 3300047315 Bacteria 2263
307 Ga0495604_0039903 3300047317 Bacteria 3688
308 Ga0495604_0057890 3300047317 Bacteria 2978
309 Ga0495604_0208118 3300047317 Bacteria 1353
310 Ga0495674_0000077 3300047319 Bacteria 66642
311 Ga0495674_0007780 3300047319 Bacteria 10230
312 Ga0495674_0071424 3300047319 Bacteria 2996
313 Ga0495674_0112033 3300047319 Bacteria 2312
314 Ga0495676_0004113 3300047321 Bacteria 13263
315 Ga0495676_0013863 3300047321 Bacteria 7228
316 Ga0495680_0014478 3300047322 Bacteria 6829
317 Ga0495680_0023912 3300047322 Bacteria 5076
318 Ga0495680_0053834 3300047322 Bacteria 3129
319 Ga0495680_0145350 3300047322 Bacteria 1732
320 Ga0495680_0272895 3300047322 Bacteria 1194
321 Ga0495675_0085198 3300047444 Bacteria 1987
322 Ga0495675_0095334 3300047444 Bacteria 1865
323 Ga0495684_0001680 3300047471 Bacteria 17791
324 Ga0495684_0027276 3300047471 Bacteria 4385
325 Ga0495684_0084185 3300047471 Bacteria 2413
326 Ga0495684_0091811 3300047471 Bacteria 2300
327 Ga0495593_0105832 3300047673 Bacteria 1439
328 Ga0495593_0147953 3300047673 Bacteria 1188
329 Ga0495602_0047374 3300048088 Bacteria 3874
330 Ga0495602_0420473 3300048088 Bacteria 949
331 Ga0495602_0726718 3300048088 Bacteria 672
332 Ga0495614_0080789 3300048089 Bacteria 1408
333 Ga0496100_0023016 3300048903 Bacteria 3778
334 Ga0496100_0231011 3300048903 Bacteria 1361
335 Ga0496100_0403323 3300048903 Bacteria 1042
336 Ga0496100_0619126 3300048903 Bacteria 842
337 Ga0496101_0040618 3300048904 Bacteria 3313
338 Ga0496101_0107030 3300048904 Bacteria 2100
339 Ga0496101_0749733 3300048904 Bacteria 770
340 Ga0496101_0880889 3300048904 Bacteria 705
341 Ga0496102_0003842 3300048905 Bacteria 12715
342 Ga0496102_0652397 3300048905 Bacteria 975
343 Ga0496103_0015893 3300048906 Bacteria 4487
344 Ga0496103_0435269 3300048906 Bacteria 842
345 Ga0496104_0012832 3300048907 Bacteria 7545
346 Ga0496104_0045391 3300048907 Bacteria 4132
347 Ga0496104_0197378 3300048907 Bacteria 1924
348 Ga0496104_0504611 3300048907 Bacteria 1121
349 Ga0496104_0770155 3300048907 Bacteria 869
350 Ga0496104_1181586 3300048907 Bacteria 668
351 Ga0496105_0000625 3300048908 Bacteria 23668
352 Ga0496105_1221290 3300048908 Bacteria 552
353 Ga0496106_0045724 3300048909 Bacteria 3289
354 Ga0496106_0182989 3300048909 Bacteria 1664
355 Ga0496106_0289824 3300048909 Bacteria 1312
356 Ga0496106_0651406 3300048909 Bacteria 841
357 Ga0496107_0017928 3300048910 Bacteria 4983
358 Ga0496107_0361815 3300048910 Bacteria 1079
359 Ga0496107_0372025 3300048910 Bacteria 1063
360 Ga0496108_0017475 3300048911 Bacteria 5869
361 Ga0496109_0005983 3300048912 Bacteria 10218
362 Ga0496109_0020322 3300048912 Bacteria 5865
363 Ga0496109_0086643 3300048912 Bacteria 2892
364 Ga0496111_0167509 3300048914 Bacteria 1632
365 Ga0496111_0382829 3300048914 Bacteria 1040
366 Ga0496112_0403249 3300048915 Bacteria 1307
367 Ga0496112_1161005 3300048915 Bacteria 689
368 Ga0496113_0078993 3300048916 Bacteria 2518
369 Ga0496114_0010895 3300048917 Bacteria 7244
370 Ga0496114_0011983 3300048917 Bacteria 6935
371 Ga0496114_1211810 3300048917 Bacteria 641
372 Ga0496115_0001765 3300048918 Bacteria 15483
373 Ga0496115_0411407 3300048918 Bacteria 1096
374 Ga0496124_0065485 3300048927 Bacteria 3030
375 Ga0501044_0137006 3300049823 Bacteria 2439
376 nmdc:mga00v17_228671_c1 3300050491 Bacteria 1205
377 nmdc:mga00v17_23166_c1 3300050491 Bacteria 3196
378 nmdc:mga0yw44_117708_c1 3300050492 Bacteria 1709
379 nmdc:mga0yw44_459520_c1 3300050492 Bacteria 863
380 nmdc:mga0k408_13987_c2 3300050493 Bacteria 1190
381 nmdc:mga06z11_200573_c1 3300050494 Bacteria 1159
382 nmdc:mga04h51_129020_c1 3300050495 Bacteria 949
383 nmdc:mga07m45_279318_c1 3300050496 Bacteria 971
384 nmdc:mga05p37_1201210_c1 3300050507 Bacteria 783
385 nmdc:mga09592_234783_c1 3300050508 Bacteria 1589
386 nmdc:mga0qj67_157857_c1 3300050509 Bacteria 1841
387 nmdc:mga08y16_62648_c1 3300050511 Bacteria 3884
388 nmdc:mga0n895_1244176_c1 3300050512 Bacteria 717
389 Ga0495601_0025242 3300053077 Bacteria 3663
390 Ga0495601_0139905 3300053077 Bacteria 1578
391 Ga0495601_0707158 3300053077 Unclassified 643
392 Ga0495612_0001488 3300053078 Bacteria 9655
393 Ga0495595_0001958 3300053084 Bacteria 7998
394 Ga0495595_0090697 3300053084 Bacteria 1466
395 Ga0495619_0161228 3300053085 Bacteria 1549
396 Ga0495619_0199191 3300053085 Bacteria 1386
397 Ga0500644_0022299 3300053088 Bacteria 1908
398 Ga0500651_0115105 3300053093 Bacteria 1638
399 Ga0500650_0421696 3300053098 Bacteria 575
400 Ga0500652_067617 3300053131 Bacteria 1477
401 Ga0500577_0203965 3300053142 Bacteria 853
402 Ga0500588_0010585 3300053146 Bacteria 2233
403 2795787263 2795385470 Bacteria 8317180
404 2791910295 2791354901 Bacteria 8322202
405 2837269926 2837268691 Bacteria 7850704
406 2895434758 2895427314 Bacteria 13147766
407 8055067780 8055066027 Bacteria 9479577
408 Ga0070683_100000804
409 Ga0070683_100369184
410 Ga0070683_100506829
411 Ga0070670_101462838
412 Ga0068869_100170219
413 Ga0068869_100877711
414 Ga0070666_10104409
415 Ga0070680_101009713
416 Ga0068868_100335486
417 Ga0070660_100327369
418 Ga0070668_100444931
419 Ga0070671_100497116
420 Ga0070667_100120720
421 Ga0070709_10014701
422 Ga0070709_10106292
423 Ga0070714_100009569
424 Ga0070714_100566804
425 Ga0070713_100045520
426 Ga0070713_100071184
427 Ga0070713_100098683
428 Ga0070713_100265908
429 Ga0070713_100587033
430 Ga0070710_10052528
431 Ga0070710_10122525
432 Ga0070711_100067362
433 Ga0070711_100119349
434 Ga0070711_100122766
435 Ga0070678_100248123
436 Ga0070706_100135155
437 Ga0070707_100031345
438 Ga0070707_100054945
439 Ga0070698_100062237
440 Ga0070698_100201370
441 Ga0070699_100087847
442 Ga0070684_100032607
443 Ga0070684_100235853
444 Ga0070695_100944709
445 Ga0070665_100074406
446 Ga0068855_100266033
447 Ga0070664_100105462
448 Ga0070664_100407509
449 Ga0070664_100903382
450 Ga0068857_100321657
451 Ga0068856_100947319
452 Ga0068856_101397490
453 Ga0068859_100514223
454 Ga0068861_100043215
455 Ga0068858_100717008
456 Ga0068858_101618894
457 Ga0081455_10013953
458 Ga0081455_10020314
459 Ga0070717_10123271
460 Ga0070717_10186554
461 Ga0070717_10331373
462 Ga0075365_10340574
463 Ga0075368_10024426
464 Ga0075364_10536832
465 Ga0070715_10056107
466 Ga0070716_100610543
467 Ga0070712_100094782
468 Ga0070712_100224147
469 Ga0070712_100399893
470 Ga0075367_10119482
471 Ga0075366_10056717
472 Ga0075370_10347771
473 Ga0075429_100354899
474 Ga0097620_100514216
475 Ga0099794_10480106
476 Ga0105240_10922061
477 Ga0111539_11115948
478 Ga0105245_10383971
479 Ga0105243_10207487
480 Ga0105237_10281416
481 Ga0105237_10800101
482 Ga0105239_10397022
483 Ga0105239_11707489
484 Ga0157344_1007609
485 Ga0157343_1002349
486 Ga0157347_1004090
487 Ga0157342_1037616
488 Ga0157369_10989879
489 Ga0157369_11561150
490 Ga0157374_10424286
491 Ga0157374_10838644
492 Ga0157374_10885058
493 Ga0157374_11299710
494 Ga0157378_10236522
495 Ga0157378_10286409
496 Ga0157378_10756070
497 Ga0157372_11034688
498 Ga0157375_11079449
499 Ga0163163_10956111
500 Ga0157379_10961579
501 Ga0157379_11244151
502 Ga0157379_11464931
503 Ga0157376_11531961
504 Ga0182005_1159134
505 Ga0163161_10679284
506 Ga0213874_10134380
507 Ga0213875_10012568
508 Ga0213875_10069642
509 Ga0224712_10005976
510 Ga0224712_10462864
511 Ga0228598_1022016
512 Ga0207653_10005871
513 Ga0207699_10046367
514 Ga0207699_10208545
515 Ga0207684_10188845
516 Ga0207693_10337471
517 Ga0207693_10390358
518 Ga0207693_10460225
519 Ga0207663_10011508
520 Ga0207663_10245482
521 Ga0207657_10095594
522 Ga0207649_10097572
523 Ga0207646_10027516
524 Ga0207687_10934332
525 Ga0207700_10018571
526 Ga0207700_10170713
527 Ga0207700_10303225
528 Ga0207700_10345836
529 Ga0207700_10713786
530 Ga0207700_10998135
531 Ga0207700_11897987
532 Ga0207664_10010545
533 Ga0207664_10013709
534 Ga0207664_10025391
535 Ga0207664_10054873
536 Ga0207664_10170853
537 Ga0207664_10703968
538 Ga0207664_11501204
539 Ga0207706_10923745
540 Ga0207709_10884718
541 Ga0207670_10479103
542 Ga0207669_10498468
543 Ga0207704_11150170
544 Ga0207665_10013309
545 Ga0207665_10033928
546 Ga0207689_10048376
547 Ga0207689_10853089
548 Ga0207661_10001535
549 Ga0207661_10454907
550 Ga0207679_10081162
551 Ga0207679_11063332
552 Ga0207667_10552153
553 Ga0207668_10727297
554 Ga0207703_11477063
555 Ga0207702_10926941
556 Ga0207674_10106742
557 Ga0207675_100082554
558 Ga0209813_10101362
559 Ga0268264_10823643
560 Ga0307515_10006702
561 Ga0307515_10298860
562 Ga0307515_10722955
563 Ga0265338_10079756
564 Ga0307512_10019581
565 Ga0307512_10027640
566 Ga0307512_10063617
567 Ga0265760_10124034
568 Ga0307513_10030348
569 Ga0307513_10394790
570 Ga0307508_10005723
571 Ga0307508_10005798
572 Ga0307508_10194768
573 Ga0307508_10299131
574 Ga0307516_10216672
575 Ga0307413_10000299
576 Ga0307518_10440766
577 Ga0307406_10775413
578 Ga0307416_100343811
579 Ga0307415_100747904
580 Ga0307507_10028126
581 Ga0307510_10092567
582 Ga0316214_1034279
583 Ga0373926_0001382
584 Ga0373926_0005112
585 Ga0373934_0070253
586 Ga0373944_0001008
587 Ga0373944_0001192
588 Ga0373923_0005361
589 Ga0373936_0000585
590 Ga0373936_0056042
591 Ga0373936_0188710
592 Ga0373945_0000090
593 Ga0373945_0151387
594 Ga0373953_0279374
595 Ga0373943_0000104
596 Ga0373943_0008043
597 Ga0373946_0002267
598 Ga0373946_0007994
599 Ga0373955_0030142
600 Ga0373955_0103520
601 Ga0373924_0013109
602 Ga0373931_0240234
603 Ga0373935_0009802
604 Ga0373935_0043310
605 Ga0373927_0046058
606 Ga0373927_0065136
607 Ga0373933_0083365
608 Ga0373933_0269199
609 Ga0373933_0283723
610 Ga0373947_0030889
611 Ga0373947_0150708
612 Ga0373937_0078124
613 Ga0373937_0196220
614 Ga0373937_0455217
615 Ga0373937_0602748
616 Ga0373925_0001409
617 Ga0373925_0082949
618 Ga0373925_0484591
619 Ga0436364_0186251
620 Ga0436364_0667538
621 Ga0436364_1274919
622 Ga0395901_0133392
623 Ga0436365_0250164
624 Ga0436363_0598631
625 Ga0436363_0754565
626 Ga0436363_1132436
627 Ga0436363_1199269
628 Ga0436362_0047835
629 Ga0436362_0201340
630 Ga0450914_024372
631 Ga0466969_0005774
632 Ga0466961_0005895
633 Ga0466961_0147201
634 Ga0466959_0182824
635 Ga0466958_0440285
636 Ga0466967_0042086
637 Ga0466967_0797342
638 Ga0495592_0133721
639 Ga0495592_0221569
640 Ga0495592_0602884
641 Ga0495592_0734472
642 Ga0495603_0013850
643 Ga0495629_0007579
644 Ga0495641_0007256
645 Ga0495641_0062944
646 Ga0495651_0030177
647 Ga0495651_0134079
648 Ga0495651_0245128
649 Ga0495651_0489910
650 Ga0495653_0000407
651 Ga0495653_0673058
652 Ga0495580_0023623
653 Ga0495582_0006991
654 Ga0495582_0022024
655 Ga0495639_0002073
656 Ga0495662_0004407
657 Ga0495662_0013626
658 Ga0495664_0000070
659 Ga0495664_0052747
660 Ga0495594_0003845
661 Ga0495608_0065890
662 Ga0495618_0011548
663 Ga0495618_0040775
664 Ga0495628_0100099
665 Ga0495628_0245650
666 Ga0495630_0032489
667 Ga0495630_0090573
668 Ga0495630_0233931
669 Ga0495666_0037298
670 Ga0495652_0014814
671 Ga0495652_0135512
672 Ga0495652_0662856
673 Ga0495665_0003759
674 Ga0495665_0007128
675 Ga0495640_0015950
676 Ga0495640_0136862
677 Ga0495586_0007625
678 Ga0495587_0014118
679 Ga0495587_0018231
680 Ga0495587_0155207
681 Ga0495587_0681834
682 Ga0495645_0066109
683 Ga0495645_0094219
684 Ga0495645_0162147
685 Ga0495622_0117917
686 Ga0495667_0005979
687 Ga0495667_0036038
688 Ga0495667_0041054
689 Ga0495667_0222999
690 Ga0495634_0006657
691 Ga0495634_0031928
692 Ga0495634_0307858
693 Ga0495635_0000481
694 Ga0495635_0194535
695 Ga0495657_0003012
696 Ga0495657_0100751
697 Ga0495657_0134530
698 Ga0495657_0134964
699 Ga0495599_0007250
700 Ga0495599_0231306
701 Ga0495599_0412265
702 Ga0495599_0592410
703 Ga0495623_0037736
704 Ga0495623_0065874
705 Ga0495646_0050428
706 Ga0495647_0004092
707 Ga0495658_0002586
708 Ga0495613_0326453
709 Ga0495624_0000293
710 Ga0495624_0006924
711 Ga0495600_0010520
712 Ga0495581_0025399
713 Ga0495581_0056616
714 Ga0495604_0039903
715 Ga0495604_0057890
716 Ga0495604_0208118
717 Ga0495674_0000077
718 Ga0495674_0007780
719 Ga0495674_0071424
720 Ga0495674_0112033
721 Ga0495676_0004113
722 Ga0495676_0013863
723 Ga0495680_0014478
724 Ga0495680_0023912
725 Ga0495680_0053834
726 Ga0495680_0145350
727 Ga0495680_0272895
728 Ga0495675_0085198
729 Ga0495675_0095334
730 Ga0495684_0001680
731 Ga0495684_0027276
732 Ga0495684_0084185
733 Ga0495684_0091811
734 Ga0495593_0105832
735 Ga0495593_0147953
736 Ga0495602_0047374
737 Ga0495602_0420473
738 Ga0495602_0726718
739 Ga0495614_0080789
740 Ga0496100_0023016
741 Ga0496100_0231011
742 Ga0496100_0403323
743 Ga0496100_0619126
744 Ga0496101_0040618
745 Ga0496101_0107030
746 Ga0496101_0749733
747 Ga0496101_0880889
748 Ga0496102_0003842
749 Ga0496102_0652397
750 Ga0496103_0015893
751 Ga0496103_0435269
752 Ga0496104_0012832
753 Ga0496104_0045391
754 Ga0496104_0197378
755 Ga0496104_0504611
756 Ga0496104_0770155
757 Ga0496104_1181586
758 Ga0496105_0000625
759 Ga0496105_1221290
760 Ga0496106_0045724
761 Ga0496106_0182989
762 Ga0496106_0289824
763 Ga0496106_0651406
764 Ga0496107_0017928
765 Ga0496107_0361815
766 Ga0496107_0372025
767 Ga0496108_0017475
768 Ga0496109_0005983
769 Ga0496109_0020322
770 Ga0496109_0086643
771 Ga0496111_0167509
772 Ga0496111_0382829
773 Ga0496112_0403249
774 Ga0496112_1161005
775 Ga0496113_0078993
776 Ga0496114_0010895
777 Ga0496114_0011983
778 Ga0496114_1211810
779 Ga0496115_0001765
780 Ga0496115_0411407
781 Ga0496124_0065485
782 Ga0501044_0137006
783 nmdc:mga00v17_228671_c1
784 nmdc:mga00v17_23166_c1
785 nmdc:mga0yw44_117708_c1
786 nmdc:mga0yw44_459520_c1
787 nmdc:mga0k408_13987_c2
788 nmdc:mga06z11_200573_c1
789 nmdc:mga04h51_129020_c1
790 nmdc:mga07m45_279318_c1
791 nmdc:mga05p37_1201210_c1
792 nmdc:mga09592_234783_c1
793 nmdc:mga0qj67_157857_c1
794 nmdc:mga08y16_62648_c1
795 nmdc:mga0n895_1244176_c1
796 Ga0495601_0025242
797 Ga0495601_0139905
798 Ga0495601_0707158
799 Ga0495612_0001488
800 Ga0495595_0001958
801 Ga0495595_0090697
802 Ga0495619_0161228
803 Ga0495619_0199191
804 Ga0500644_0022299
805 Ga0500651_0115105
806 Ga0500650_0421696
807 Ga0500652_067617
808 Ga0500577_0203965
809 Ga0500588_0010585
810 2795787263
811 2791910295
812 2837269926
813 2895434758
814 8055067780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

42

157

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9757 9 140
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9704 9 140
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9643 9 140
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9623 9 140
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9589 9 140
ID Description Score Start End Superfamily
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9623 9 140 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 8 138 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9234 21 131 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 8 138 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9003 9 140 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2M8E160-F1-model_v4 CoA-binding protein 0.9957 19 137
AF-D1C5K7-F1-model_v4 CoA-binding domain protein 0.9944 2 140
AF-A0A536KMD7-F1-model_v4 CoA-binding protein 0.9913 13 137
AF-A0A2V8P3Q6-F1-model_v4 CoA-binding protein 0.9908 13 138
AF-A0A6J4NEJ6-F1-model_v4 CoA-binding domain protein 0.9906 12 134

Map