F436598

General Info

Members Datasets Scaffolds Average Seq Length
407 263 815 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746763|2785345409
Length 247
Sequence SSDRAPSGRTPSTEAPSVRGAEVGRRIGVGLMYGLWKPRVLGAWKVPTTGPVILAVNHSHNIDGPMVMGVAPRPTHFLIKKEAFIGPLDPFLLGIGQVKVDRSTADRTAITQALAVLEHGGVLGIFPEGTRGEGDFASLRAGLSYFAVRSGAPIVPVAVLGSTERRGRLIKGLPPLRSRVDVVFGEPFDAGDGSGRRTRKALDEATVRIQKQLGAHLDHARRLTGRSSSDLPGDNPRTPGSQERRPG

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
55 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
61 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
62 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
65 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
191 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
192 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
193 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
194 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
195 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
196 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
197 2643221548 Streptomyces sp. Root55 Isolate Unclassified
198 2643221578 Streptomyces sp. Root63 Isolate Unclassified
199 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
200 2643221647 Streptomyces sp. Root369 Isolate Unclassified
201 2643221670 Streptomyces sp. Root431 Isolate Unclassified
202 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
203 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
204 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
205 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
206 2643221714 Streptomyces sp. Root264 Isolate Unclassified
207 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
208 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
209 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
210 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
211 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
212 2808606448 Streptomyces sp. 193411 Isolate Unclassified
213 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
214 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
215 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
216 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
217 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
218 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
219 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
220 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
221 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
222 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
223 2867428634 Streptomyces sp. RP5T Isolate Unclassified
224 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
225 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
226 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
227 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
228 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
229 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
230 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
231 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
232 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
233 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
234 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
235 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
236 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
237 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
238 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
239 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
240 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
241 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
242 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
243 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
244 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
245 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
246 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
247 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
248 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
249 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
250 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
251 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
252 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
253 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
254 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
255 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
256 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
257 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
258 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
259 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
260 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
261 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
262 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
263 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.84
Metatranscriptomes 0.98
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.44
Nodule 0.49
Rhizoplane 1.23
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009709 3300002067 Bacteria 3083
2 rootH2_10012600 3300003320 Bacteria 5759
3 rootL2_10034430 3300003322 Bacteria 6571
4 rootL2_10176718 3300003322 Bacteria 1019
5 rootH1_10005216 3300003316 Bacteria 4528
6 rootH1_10005216 3300003323 Bacteria 5057
7 rootH1_10013364 3300003323 Bacteria 2495
8 JGI25160J50197_1036482 3300003354 Bacteria 1192
9 Ga0068855_100021450 3300005563 Bacteria 7745
10 Ga0068855_100523494 3300005563 Bacteria 1286
11 Ga0068856_100071522 3300005614 Bacteria 3434
12 Ga0081455_10338107 3300005937 Bacteria 1066
13 Ga0075363_100015739 3300006048 Bacteria 3723
14 Ga0075367_10009276 3300006178 Bacteria 5136
15 Ga0075370_10155486 3300006353 Bacteria 1341
16 Ga0099826_10058752 3300006948 Bacteria 2520
17 Ga0105250_10147205 3300009092 Bacteria 978
18 Ga0105240_10012487 3300009093 Bacteria 11721
19 Ga0105245_10445531 3300009098 Bacteria 1302
20 Ga0105243_10832284 3300009148 Bacteria 912
21 Ga0105241_10065691 3300009174 Bacteria 2804
22 Ga0105241_10427622 3300009174 Bacteria 1167
23 Ga0105237_10269127 3300009545 Bacteria 1707
24 Ga0105237_11052876 3300009545 Bacteria 820
25 Ga0105239_10275112 3300010375 Bacteria 1894
26 Ga0105246_10025367 3300011119 Bacteria 3863
27 Ga0105246_10240249 3300011119 Bacteria 1431
28 Ga0157369_10202173 3300013105 Bacteria 2085
29 Ga0157372_10414073 3300013307 Bacteria 1571
30 Ga0182008_10000679 3300014497 Bacteria 24589
31 Ga0182007_10003945 3300015262 Bacteria 6855
32 Ga0183367_1010 3300015688 Bacteria 416164
33 Ga0209758_1003336 3300025297 Bacteria 14759
34 Ga0207426_1004219 3300025302 Bacteria 7147
35 Ga0207647_10016631 3300025904 Bacteria 5017
36 Ga0207647_10245710 3300025904 Bacteria 1027
37 Ga0207657_10368156 3300025919 Bacteria 1132
38 Ga0207694_10794977 3300025924 Bacteria 799
39 Ga0207687_10281382 3300025927 Bacteria 1333
40 Ga0207667_10042091 3300025949 Bacteria 4857
41 Ga0207667_10058054 3300025949 Bacteria 4060
42 Ga0207702_10082383 3300026078 Bacteria 2797
43 Ga0307517_10023073 3300028786 Bacteria 7761
44 Ga0307515_10000544 3300028794 Bacteria 88859
45 Ga0307511_10000584 3300030521 Bacteria 39032
46 Ga0307511_10058196 3300030521 Bacteria 2991
47 Ga0307512_10001375 3300030522 Bacteria 34556
48 Ga0307512_10112471 3300030522 Bacteria 1787
49 Ga0307513_10011667 3300031456 Bacteria 10903
50 Ga0307513_10070795 3300031456 Bacteria 3643
51 Ga0307513_10076369 3300031456 Bacteria 3474
52 Ga0307513_10574109 3300031456 Bacteria 838
53 Ga0307509_10166530 3300031507 Bacteria 2091
54 Ga0307508_10019605 3300031616 Bacteria 6147
55 Ga0307508_10023767 3300031616 Bacteria 5564
56 Ga0307508_10177754 3300031616 Bacteria 1731
57 Ga0307508_10433017 3300031616 Bacteria 907
58 Ga0307514_10004054 3300031649 Bacteria 13621
59 Ga0307514_10042568 3300031649 Bacteria 3571
60 Ga0307514_10167906 3300031649 Bacteria 1439
61 Ga0307514_10244402 3300031649 Bacteria 1071
62 Ga0307514_10304593 3300031649 Bacteria 889
63 Ga0307516_10009612 3300031730 Bacteria 10765
64 Ga0307516_10019302 3300031730 Bacteria 7062
65 Ga0307518_10106300 3300031838 Bacteria 2003
66 Ga0307518_10121139 3300031838 Bacteria 1851
67 Ga0307410_10354025 3300031852 Bacteria 1174
68 Ga0307412_10653637 3300031911 Bacteria 897
69 Ga0307416_100213442 3300032002 Bacteria 1843
70 Ga0307507_10149979 3300033179 Bacteria 1757
71 Ga0307507_10187535 3300033179 Bacteria 1462
72 Ga0307510_10023661 3300033180 Bacteria 7117
73 Ga0307510_10105515 3300033180 Bacteria 2585
74 Ga0395900_0046709 3300037418 Bacteria 4459
75 Ga0395898_0001065 3300037466 Bacteria 42693
76 Ga0395901_0020137 3300038443 Bacteria 6827
77 Ga0439436_0005042 3300041404 Bacteria 4045
78 Ga0439439_0000332 3300041406 Bacteria 7664
79 Ga0451802_1292437 3300041460 Bacteria 1397
80 Ga0451847_0991286 3300041503 Bacteria 1306
81 Ga0451853_1589574 3300041512 Bacteria 7326
82 Ga0451853_1794498 3300041512 Bacteria 1987
83 Ga0451853_2186542 3300041512 Bacteria 1540
84 Ga0451853_2840802 3300041512 Bacteria 985
85 Ga0439433_0008401 3300041999 Bacteria 2238
86 Ga0439442_004610 3300042002 Bacteria 2738
87 Ga0439449_0001561 3300042007 Bacteria 8972
88 Ga0439449_0024280 3300042007 Bacteria 2267
89 Ga0439449_0026926 3300042007 Bacteria 2145
90 Ga0439455_0012617 3300042012 Bacteria 1901
91 Ga0439457_000036 3300042014 Bacteria 28398
92 Ga0439457_000145 3300042014 Bacteria 18209
93 Ga0439457_008171 3300042014 Bacteria 2476
94 Ga0450894_000369 3300042131 Bacteria 7837
95 Ga0450898_001356 3300042134 Bacteria 3197
96 Ga0450899_003042 3300042135 Bacteria 1807
97 Ga0450900_035676 3300042136 Bacteria 733
98 Ga0450903_000734 3300042138 Bacteria 6484
99 Ga0450903_014103 3300042138 Bacteria 1266
100 Ga0450906_001190 3300042145 Bacteria 5759
101 Ga0439458_0000189 3300042157 Bacteria 14072
102 Ga0439458_0032987 3300042157 Bacteria 1239
103 Ga0450908_001237 3300042184 Bacteria 4954
104 Ga0450901_007551 3300042533 Bacteria 1119
105 Ga0450901_010221 3300042533 Bacteria 971
106 Ga0466969_0016102 3300044656 Bacteria 3917
107 Ga0466972_0001790 3300044658 Bacteria 10523
108 Ga0466972_0006620 3300044658 Bacteria 5817
109 Ga0466972_0036850 3300044658 Bacteria 2391
110 Ga0466965_0002912 3300044683 Bacteria 7398
111 Ga0466965_0107521 3300044683 Bacteria 1431
112 Ga0466966_0015145 3300044684 Bacteria 5101
113 Ga0466966_0027124 3300044684 Bacteria 3735
114 Ga0466966_0097152 3300044684 Bacteria 1824
115 Ga0466961_0012677 3300044693 Bacteria 5400
116 Ga0466961_0041935 3300044693 Bacteria 2934
117 Ga0466961_0261595 3300044693 Bacteria 1061
118 Ga0466963_0000252 3300044694 Bacteria 23516
119 Ga0466963_0049349 3300044694 Bacteria 2783
120 Ga0466964_0015412 3300044706 Bacteria 2909
121 Ga0466971_0006438 3300044719 Bacteria 5101
122 Ga0466971_0081139 3300044719 Bacteria 1479
123 Ga0466971_0113957 3300044719 Bacteria 1249
124 Ga0466970_0041308 3300044765 Bacteria 2450
125 Ga0466957_0001360 3300044842 Bacteria 12764
126 Ga0466960_0015389 3300044901 Bacteria 3296
127 Ga0466960_0057358 3300044901 Bacteria 1899
128 Ga0466960_0192685 3300044901 Bacteria 1110
129 Ga0466959_0001407 3300045049 Bacteria 14698
130 Ga0466959_0203065 3300045049 Bacteria 1379
131 Ga0466958_0001780 3300045836 Bacteria 10445
132 Ga0466958_0065303 3300045836 Bacteria 2221
133 Ga0466967_0006359 3300045976 Bacteria 8344
134 Ga0466967_0244430 3300045976 Bacteria 1712
135 Ga0495617_021056 3300046452 Bacteria 2203
136 Ga0495592_0008656 3300046454 Bacteria 7640
137 Ga0495592_0058609 3300046454 Bacteria 2839
138 Ga0495603_0001256 3300046455 Bacteria 14795
139 Ga0495603_0023090 3300046455 Bacteria 3765
140 Ga0495603_0032173 3300046455 Bacteria 3156
141 Ga0495629_0004026 3300046459 Bacteria 11045
142 Ga0495629_0007965 3300046459 Bacteria 7794
143 Ga0495629_0038141 3300046459 Bacteria 3385
144 Ga0495629_0047365 3300046459 Bacteria 3015
145 Ga0495629_0108865 3300046459 Bacteria 1932
146 Ga0495629_0169494 3300046459 Bacteria 1515
147 Ga0495638_0090412 3300046460 Bacteria 1845
148 Ga0495638_0206684 3300046460 Bacteria 1105
149 Ga0495641_0053971 3300046461 Bacteria 1827
150 Ga0495651_0035488 3300046462 Bacteria 3881
151 Ga0495653_0161325 3300046463 Bacteria 1556
152 Ga0495580_0137001 3300046472 Bacteria 1697
153 Ga0495605_0052499 3300046474 Bacteria 1980
154 Ga0495662_0002218 3300046476 Bacteria 9800
155 Ga0495662_0094427 3300046476 Bacteria 1460
156 Ga0495662_0136475 3300046476 Bacteria 1206
157 Ga0495662_0245257 3300046476 Bacteria 882
158 Ga0495664_0001717 3300046477 Bacteria 11642
159 Ga0495664_0334010 3300046477 Bacteria 913
160 Ga0495664_0348827 3300046477 Bacteria 891
161 Ga0495585_0019474 3300046492 Bacteria 3912
162 Ga0495594_0000252 3300046499 Bacteria 26076
163 Ga0495594_0077909 3300046499 Bacteria 1849
164 Ga0495594_0079988 3300046499 Bacteria 1824
165 Ga0495594_0178569 3300046499 Bacteria 1208
166 Ga0495583_0029108 3300046506 Bacteria 2706
167 Ga0495608_0023378 3300046511 Bacteria 4236
168 Ga0495608_0286840 3300046511 Bacteria 1021
169 Ga0495616_0003593 3300046513 Bacteria 9911
170 Ga0495618_0048455 3300046514 Bacteria 2682
171 Ga0495618_0073793 3300046514 Bacteria 2172
172 Ga0495620_0007262 3300046515 Bacteria 6031
173 Ga0495628_0103984 3300046516 Bacteria 2189
174 Ga0495630_0047529 3300046517 Bacteria 3210
175 Ga0495631_0007272 3300046518 Bacteria 5640
176 Ga0495631_0052242 3300046518 Bacteria 1785
177 Ga0495637_0050796 3300046520 Bacteria 1738
178 Ga0495642_0072085 3300046528 Bacteria 1446
179 Ga0495652_0010007 3300046529 Bacteria 8595
180 Ga0495652_0058960 3300046529 Bacteria 3249
181 Ga0495640_0194358 3300046533 Bacteria 1288
182 Ga0495587_0005536 3300046536 Bacteria 8239
183 Ga0495587_0101823 3300046536 Bacteria 1654
184 Ga0495645_0014347 3300046543 Bacteria 5620
185 Ga0495645_0067486 3300046543 Bacteria 2583
186 Ga0495622_0029200 3300046557 Bacteria 2576
187 Ga0495622_0143880 3300046557 Bacteria 1081
188 Ga0495622_0155309 3300046557 Bacteria 1033
189 Ga0495633_0010555 3300046558 Bacteria 5034
190 Ga0495668_0057380 3300046616 Bacteria 2148
191 Ga0495634_0001367 3300046642 Bacteria 22125
192 Ga0495611_0007734 3300046648 Bacteria 4564
193 Ga0495611_0035265 3300046648 Bacteria 2215
194 Ga0495625_0022385 3300046660 Bacteria 4846
195 Ga0495625_0057374 3300046660 Bacteria 2769
196 Ga0495625_0224782 3300046660 Bacteria 1228
197 Ga0495635_0002384 3300046663 Bacteria 12796
198 Ga0495635_0045665 3300046663 Bacteria 3022
199 Ga0495635_0075599 3300046663 Bacteria 2307
200 Ga0495661_0061243 3300046665 Bacteria 2234
201 Ga0495588_0005867 3300046674 Bacteria 5499
202 Ga0495588_0083932 3300046674 Bacteria 1664
203 Ga0495588_0234352 3300046674 Bacteria 968
204 Ga0495657_0000840 3300046675 Bacteria 27169
205 Ga0495599_0061886 3300046678 Bacteria 2338
206 Ga0495623_0046849 3300046679 Bacteria 2744
207 Ga0495646_0000565 3300046680 Bacteria 20093
208 Ga0495646_0104326 3300046680 Bacteria 1621
209 Ga0495658_0086003 3300046683 Bacteria 1854
210 Ga0495613_0010349 3300046689 Bacteria 6928
211 Ga0495613_0066053 3300046689 Bacteria 2642
212 Ga0495613_0179990 3300046689 Bacteria 1497
213 Ga0495613_0247599 3300046689 Bacteria 1244
214 Ga0495613_0531911 3300046689 Bacteria 788
215 Ga0495624_0065857 3300046690 Bacteria 2262
216 Ga0495671_0049303 3300046692 Bacteria 2099
217 Ga0495671_0286140 3300046692 Bacteria 794
218 Ga0495649_0029366 3300046694 Bacteria 3041
219 Ga0495649_0085827 3300046694 Bacteria 1680
220 Ga0495649_0275413 3300046694 Bacteria 860
221 Ga0495589_0016913 3300046794 Bacteria 3744
222 Ga0495589_0033927 3300046794 Bacteria 2562
223 Ga0495600_0003631 3300046809 Bacteria 9098
224 Ga0495581_0031403 3300047315 Bacteria 3078
225 Ga0495581_0036826 3300047315 Bacteria 2830
226 Ga0495604_0001501 3300047317 Bacteria 19226
227 Ga0495604_0075273 3300047317 Bacteria 2542
228 Ga0495604_0099846 3300047317 Bacteria 2135
229 Ga0495636_0019319 3300047318 Bacteria 2738
230 Ga0495636_0021732 3300047318 Bacteria 2592
231 Ga0495636_0031443 3300047318 Bacteria 2175
232 Ga0495636_0073479 3300047318 Bacteria 1463
233 Ga0495636_0077536 3300047318 Bacteria 1426
234 Ga0495636_0319707 3300047318 Bacteria 728
235 Ga0495674_0057189 3300047319 Bacteria 3414
236 Ga0495672_0223887 3300047320 Bacteria 927
237 Ga0495676_0006825 3300047321 Bacteria 10495
238 Ga0495676_0011821 3300047321 Bacteria 7873
239 Ga0495676_0017953 3300047321 Bacteria 6242
240 Ga0495676_0156764 3300047321 Bacteria 1614
241 Ga0495680_0042421 3300047322 Bacteria 3609
242 Ga0495687_003185 3300047443 Bacteria 12198
243 Ga0495687_030123 3300047443 Bacteria 2501
244 Ga0495687_106565 3300047443 Bacteria 1039
245 Ga0495675_0029560 3300047444 Bacteria 3496
246 Ga0495675_0045586 3300047444 Bacteria 2792
247 Ga0495675_0090970 3300047444 Bacteria 1915
248 Ga0495677_0128888 3300047445 Bacteria 968
249 Ga0495679_034552 3300047446 Bacteria 1608
250 Ga0495685_004882 3300047447 Bacteria 4353
251 Ga0495685_006680 3300047447 Bacteria 3786
252 Ga0495685_017599 3300047447 Bacteria 2448
253 Ga0495681_0033325 3300047470 Bacteria 2581
254 Ga0495681_0035245 3300047470 Bacteria 2486
255 Ga0495684_0150341 3300047471 Bacteria 1741
256 Ga0495686_0017024 3300047472 Bacteria 4909
257 Ga0495686_0028310 3300047472 Bacteria 3649
258 Ga0495686_0182692 3300047472 Bacteria 1214
259 Ga0495593_0001348 3300047673 Bacteria 14352
260 Ga0495593_0102893 3300047673 Bacteria 1463
261 Ga0495593_0174156 3300047673 Bacteria 1084
262 Ga0495602_0025956 3300048088 Bacteria 5660
263 Ga0495602_0572215 3300048088 Bacteria 780
264 Ga0495614_0000258 3300048089 Bacteria 20650
265 Ga0495614_0004099 3300048089 Bacteria 6558
266 Ga0495614_0232879 3300048089 Bacteria 839
267 Ga0495614_0354138 3300048089 Bacteria 684
268 Ga0495626_0028681 3300048091 Bacteria 2696
269 Ga0496101_0275885 3300048904 Bacteria 1313
270 Ga0496105_0127520 3300048908 Bacteria 2098
271 Ga0496108_0094677 3300048911 Bacteria 2542
272 Ga0496109_0038226 3300048912 Bacteria 4339
273 Ga0501306_000525 3300049127 Bacteria 3001
274 Ga0501309_022859 3300049129 Bacteria 886
275 Ga0501310_005065 3300049130 Bacteria 1344
276 Ga0495678_049856 3300049459 Bacteria 1625
277 Ga0495682_0014396 3300049460 Bacteria 3000
278 Ga0501318_007600 3300049534 Bacteria 1138
279 Ga0501032_0029753 3300049569 Bacteria 3746
280 Ga0501033_0004159 3300049570 Bacteria 11652
281 Ga0501033_0004556 3300049570 Bacteria 11095
282 Ga0501033_0088789 3300049570 Bacteria 2261
283 Ga0501033_0331759 3300049570 Bacteria 1067
284 Ga0501034_0001038 3300049571 Bacteria 39681
285 Ga0501034_0006556 3300049571 Bacteria 12502
286 Ga0501034_0090873 3300049571 Bacteria 3050
287 Ga0501036_0004606 3300049572 Bacteria 11141
288 Ga0501036_0004830 3300049572 Bacteria 10893
289 Ga0501036_0074142 3300049572 Bacteria 2878
290 Ga0501037_0179505 3300049573 Bacteria 1502
291 Ga0501038_0003349 3300049574 Bacteria 14946
292 Ga0501038_0015435 3300049574 Bacteria 6943
293 Ga0501038_0065848 3300049574 Bacteria 3087
294 Ga0501039_0008597 3300049575 Bacteria 7786
295 Ga0501039_0054265 3300049575 Bacteria 3102
296 Ga0501039_0125618 3300049575 Bacteria 2012
297 Ga0501040_0575920 3300049576 Bacteria 813
298 Ga0501042_0050474 3300049578 Bacteria 2967
299 Ga0501042_0181224 3300049578 Bacteria 1520
300 Ga0501043_0001201 3300049579 Bacteria 22793
301 Ga0501043_0008838 3300049579 Bacteria 7927
302 Ga0501043_0032769 3300049579 Bacteria 4086
303 Ga0501046_0014805 3300049580 Bacteria 6566
304 Ga0501046_0248975 3300049580 Bacteria 1308
305 Ga0501047_0050793 3300049581 Bacteria 4004
306 Ga0501047_0202013 3300049581 Bacteria 1848
307 Ga0501047_0458575 3300049581 Bacteria 1103
308 Ga0501048_0100160 3300049582 Bacteria 2044
309 Ga0501070_0000421 3300049586 Bacteria 38478
310 Ga0501070_0107902 3300049586 Bacteria 2301
311 Ga0501070_0198856 3300049586 Bacteria 1646
312 Ga0501074_0004585 3300049590 Bacteria 9897
313 Ga0501074_0213642 3300049590 Bacteria 1374
314 Ga0501035_0004480 3300049822 Bacteria 13256
315 Ga0501035_0031200 3300049822 Bacteria 4853
316 Ga0501035_0220073 3300049822 Bacteria 1621
317 Ga0501044_0005898 3300049823 Bacteria 13567
318 Ga0501044_0009258 3300049823 Bacteria 10759
319 Ga0501044_0016794 3300049823 Bacteria 7855
320 Ga0501044_0031111 3300049823 Bacteria 5619
321 Ga0501044_0058690 3300049823 Bacteria 3945
322 Ga0501044_0065398 3300049823 Bacteria 3708
323 Ga0501045_0066452 3300049824 Bacteria 2648
324 nmdc:mga03n38_6251_c1 3300050490 Bacteria 4123
325 nmdc:mga0yw44_43106_c1 3300050492 Bacteria 2692
326 nmdc:mga07m45_109873_c1 3300050496 Bacteria 1587
327 nmdc:mga07m45_48168_c1 3300050496 Bacteria 2396
328 Ga0495655_0047684 3300053083 Bacteria 1122
329 Ga0495619_0165946 3300053085 Bacteria 1526
330 Ga0500644_0010396 3300053088 Bacteria 2519
331 Ga0500640_004325 3300053095 Bacteria 5143
332 Ga0500572_008966 3300053111 Bacteria 2353
333 Ga0500573_0028665 3300053140 Bacteria 3208
334 Ga0466962_0000087 3300061719 Bacteria 37548
335 2785345409 2784746763 Bacteria 9783172
336 2547406800 2547132111 Bacteria 8013147
337 2554259289 2554235005 Bacteria 6457341
338 2585303897 2582581313 Bacteria 10042643
339 2585315423 2582581314 Bacteria 11452267
340 2616695961 2616644814 Bacteria 11555299
341 2616900504 2616644941 Bacteria 8510691
342 2643759895 2643221548 Bacteria 8053412
343 2643904770 2643221578 Bacteria 9213798
344 2643944147 2643221587 Bacteria 7586415
345 2644268373 2643221647 Bacteria 10741251
346 2644389406 2643221670 Bacteria 6497041
347 2644405964 2643221673 Bacteria 9196637
348 2644430995 2643221677 Bacteria 7584031
349 2644438394 2643221678 Bacteria 9540101
350 2644460409 2643221682 Bacteria 6743283
351 2644629316 2643221714 Bacteria 9015452
352 2785367476 2784746768 Bacteria 10036182
353 2786668536 2786546132 Bacteria 10419719
354 2804844075 2802429296 Bacteria 7227771
355 2808847967 2808606359 Bacteria 9866990
356 2808918724 2808606375 Bacteria 9466072
357 2809230571 2808606448 Bacteria 8656184
358 2811847245 2808606982 Bacteria 7791042
359 2812360021 2811994879 Bacteria 9313447
360 2812482093 2811994917 Bacteria 7761064
361 2819696700 2818991463 Bacteria 7948711
362 2852638001 2852635781 Bacteria 8251373
363 2862180394 2862178590 Bacteria 8583590
364 2862289318 2862281513 Bacteria 9621493
365 2862294115 2862290372 Bacteria 7471434
366 2862513019 2862507626 Bacteria 9425308
367 2863406671 2863404153 Bacteria 9672205
368 2867434585 2867428634 Bacteria 9590268
369 2875392958 2875391855 Bacteria 7600475
370 2912722070 2912715099 Bacteria 9460473
371 2912725837 2912723979 Bacteria 8557534
372 2918502822 2918501144 Bacteria 8668083
373 2919473601 2919468124 Bacteria 9133025
374 2935396396 2935390628 Bacteria 7043367
375 2946051735 2946045630 Bacteria 8527308
376 2946065872 2946064051 Bacteria 8957905
377 2946074198 2946072368 Bacteria 8999607
378 2947231532 2947224130 Bacteria 9938529
379 2954010743 2954002825 Bacteria 9173742
380 2954388290 2954380949 Bacteria 10050426
381 2954674812 2954673503 Bacteria 9685905
382 2954689321 2954682443 Bacteria 9862841
383 2954699094 2954691527 Bacteria 10720516
384 2954703125 2954701450 Bacteria 10834262
385 2954718048 2954711539 Bacteria 10867210
386 2954728016 2954721474 Bacteria 10456478
387 2954733789 2954731030 Bacteria 10243860
388 2954746912 2954740390 Bacteria 10229294
389 2954752674 2954749733 Bacteria 10366972
390 2954766026 2954759201 Bacteria 9358192
391 2966604101 2966598605 Bacteria 7676064
392 2990047098 2990044586 Bacteria 6603797
393 2997454040 2997451912 Bacteria 8492419
394 2997601940 2997600082 Bacteria 9896405
395 3006430470 3006425503 Bacteria 6491253
396 3006487810 3006486233 Bacteria 8157040
397 3006495321 3006493962 Bacteria 8825450
398 8008561637 8008558824 Bacteria 10610750
399 8008580472 8008574985 Bacteria 7815457
400 8023624633 8023623736 Bacteria 8593882
401 8025416467 8025413630 Bacteria 7014048
402 8025479326 8025478263 Bacteria 8209203
403 8033688785 8033684223 Bacteria 6906479
404 8048412019 8048406513 Bacteria 8936924
405 8054167190 8054160619 Bacteria 7783213
406 8056450910 8056447290 Bacteria 7680491
407 8056673276 8056667051 Bacteria 6953971
408 8056835402 8056829672 Bacteria 9045328
409 JGI24735J21928_10009709
410 rootH2_10012600
411 rootL2_10034430
412 rootL2_10176718
413 rootH1_10005216
414 rootH1_10013364
415 JGI25160J50197_1036482
416 Ga0068855_100021450
417 Ga0068855_100523494
418 Ga0068856_100071522
419 Ga0081455_10338107
420 Ga0075363_100015739
421 Ga0075367_10009276
422 Ga0075370_10155486
423 Ga0099826_10058752
424 Ga0105250_10147205
425 Ga0105240_10012487
426 Ga0105245_10445531
427 Ga0105243_10832284
428 Ga0105241_10065691
429 Ga0105241_10427622
430 Ga0105237_10269127
431 Ga0105237_11052876
432 Ga0105239_10275112
433 Ga0105246_10025367
434 Ga0105246_10240249
435 Ga0157369_10202173
436 Ga0157372_10414073
437 Ga0182008_10000679
438 Ga0182007_10003945
439 Ga0183367_1010
440 Ga0209758_1003336
441 Ga0207426_1004219
442 Ga0207647_10016631
443 Ga0207647_10245710
444 Ga0207657_10368156
445 Ga0207694_10794977
446 Ga0207687_10281382
447 Ga0207667_10042091
448 Ga0207667_10058054
449 Ga0207702_10082383
450 Ga0307517_10023073
451 Ga0307515_10000544
452 Ga0307511_10000584
453 Ga0307511_10058196
454 Ga0307512_10001375
455 Ga0307512_10112471
456 Ga0307513_10011667
457 Ga0307513_10070795
458 Ga0307513_10076369
459 Ga0307513_10574109
460 Ga0307509_10166530
461 Ga0307508_10019605
462 Ga0307508_10023767
463 Ga0307508_10177754
464 Ga0307508_10433017
465 Ga0307514_10004054
466 Ga0307514_10042568
467 Ga0307514_10167906
468 Ga0307514_10244402
469 Ga0307514_10304593
470 Ga0307516_10009612
471 Ga0307516_10019302
472 Ga0307518_10106300
473 Ga0307518_10121139
474 Ga0307410_10354025
475 Ga0307412_10653637
476 Ga0307416_100213442
477 Ga0307507_10149979
478 Ga0307507_10187535
479 Ga0307510_10023661
480 Ga0307510_10105515
481 Ga0395900_0046709
482 Ga0395898_0001065
483 Ga0395901_0020137
484 Ga0439436_0005042
485 Ga0439439_0000332
486 Ga0451802_1292437
487 Ga0451847_0991286
488 Ga0451853_1589574
489 Ga0451853_1794498
490 Ga0451853_2186542
491 Ga0451853_2840802
492 Ga0439433_0008401
493 Ga0439442_004610
494 Ga0439449_0001561
495 Ga0439449_0024280
496 Ga0439449_0026926
497 Ga0439455_0012617
498 Ga0439457_000036
499 Ga0439457_000145
500 Ga0439457_008171
501 Ga0450894_000369
502 Ga0450898_001356
503 Ga0450899_003042
504 Ga0450900_035676
505 Ga0450903_000734
506 Ga0450903_014103
507 Ga0450906_001190
508 Ga0439458_0000189
509 Ga0439458_0032987
510 Ga0450908_001237
511 Ga0450901_007551
512 Ga0450901_010221
513 Ga0466969_0016102
514 Ga0466972_0001790
515 Ga0466972_0006620
516 Ga0466972_0036850
517 Ga0466965_0002912
518 Ga0466965_0107521
519 Ga0466966_0015145
520 Ga0466966_0027124
521 Ga0466966_0097152
522 Ga0466961_0012677
523 Ga0466961_0041935
524 Ga0466961_0261595
525 Ga0466963_0000252
526 Ga0466963_0049349
527 Ga0466964_0015412
528 Ga0466971_0006438
529 Ga0466971_0081139
530 Ga0466971_0113957
531 Ga0466970_0041308
532 Ga0466957_0001360
533 Ga0466960_0015389
534 Ga0466960_0057358
535 Ga0466960_0192685
536 Ga0466959_0001407
537 Ga0466959_0203065
538 Ga0466958_0001780
539 Ga0466958_0065303
540 Ga0466967_0006359
541 Ga0466967_0244430
542 Ga0495617_021056
543 Ga0495592_0008656
544 Ga0495592_0058609
545 Ga0495603_0001256
546 Ga0495603_0023090
547 Ga0495603_0032173
548 Ga0495629_0004026
549 Ga0495629_0007965
550 Ga0495629_0038141
551 Ga0495629_0047365
552 Ga0495629_0108865
553 Ga0495629_0169494
554 Ga0495638_0090412
555 Ga0495638_0206684
556 Ga0495641_0053971
557 Ga0495651_0035488
558 Ga0495653_0161325
559 Ga0495580_0137001
560 Ga0495605_0052499
561 Ga0495662_0002218
562 Ga0495662_0094427
563 Ga0495662_0136475
564 Ga0495662_0245257
565 Ga0495664_0001717
566 Ga0495664_0334010
567 Ga0495664_0348827
568 Ga0495585_0019474
569 Ga0495594_0000252
570 Ga0495594_0077909
571 Ga0495594_0079988
572 Ga0495594_0178569
573 Ga0495583_0029108
574 Ga0495608_0023378
575 Ga0495608_0286840
576 Ga0495616_0003593
577 Ga0495618_0048455
578 Ga0495618_0073793
579 Ga0495620_0007262
580 Ga0495628_0103984
581 Ga0495630_0047529
582 Ga0495631_0007272
583 Ga0495631_0052242
584 Ga0495637_0050796
585 Ga0495642_0072085
586 Ga0495652_0010007
587 Ga0495652_0058960
588 Ga0495640_0194358
589 Ga0495587_0005536
590 Ga0495587_0101823
591 Ga0495645_0014347
592 Ga0495645_0067486
593 Ga0495622_0029200
594 Ga0495622_0143880
595 Ga0495622_0155309
596 Ga0495633_0010555
597 Ga0495668_0057380
598 Ga0495634_0001367
599 Ga0495611_0007734
600 Ga0495611_0035265
601 Ga0495625_0022385
602 Ga0495625_0057374
603 Ga0495625_0224782
604 Ga0495635_0002384
605 Ga0495635_0045665
606 Ga0495635_0075599
607 Ga0495661_0061243
608 Ga0495588_0005867
609 Ga0495588_0083932
610 Ga0495588_0234352
611 Ga0495657_0000840
612 Ga0495599_0061886
613 Ga0495623_0046849
614 Ga0495646_0000565
615 Ga0495646_0104326
616 Ga0495658_0086003
617 Ga0495613_0010349
618 Ga0495613_0066053
619 Ga0495613_0179990
620 Ga0495613_0247599
621 Ga0495613_0531911
622 Ga0495624_0065857
623 Ga0495671_0049303
624 Ga0495671_0286140
625 Ga0495649_0029366
626 Ga0495649_0085827
627 Ga0495649_0275413
628 Ga0495589_0016913
629 Ga0495589_0033927
630 Ga0495600_0003631
631 Ga0495581_0031403
632 Ga0495581_0036826
633 Ga0495604_0001501
634 Ga0495604_0075273
635 Ga0495604_0099846
636 Ga0495636_0019319
637 Ga0495636_0021732
638 Ga0495636_0031443
639 Ga0495636_0073479
640 Ga0495636_0077536
641 Ga0495636_0319707
642 Ga0495674_0057189
643 Ga0495672_0223887
644 Ga0495676_0006825
645 Ga0495676_0011821
646 Ga0495676_0017953
647 Ga0495676_0156764
648 Ga0495680_0042421
649 Ga0495687_003185
650 Ga0495687_030123
651 Ga0495687_106565
652 Ga0495675_0029560
653 Ga0495675_0045586
654 Ga0495675_0090970
655 Ga0495677_0128888
656 Ga0495679_034552
657 Ga0495685_004882
658 Ga0495685_006680
659 Ga0495685_017599
660 Ga0495681_0033325
661 Ga0495681_0035245
662 Ga0495684_0150341
663 Ga0495686_0017024
664 Ga0495686_0028310
665 Ga0495686_0182692
666 Ga0495593_0001348
667 Ga0495593_0102893
668 Ga0495593_0174156
669 Ga0495602_0025956
670 Ga0495602_0572215
671 Ga0495614_0000258
672 Ga0495614_0004099
673 Ga0495614_0232879
674 Ga0495614_0354138
675 Ga0495626_0028681
676 Ga0496101_0275885
677 Ga0496105_0127520
678 Ga0496108_0094677
679 Ga0496109_0038226
680 Ga0501306_000525
681 Ga0501309_022859
682 Ga0501310_005065
683 Ga0495678_049856
684 Ga0495682_0014396
685 Ga0501318_007600
686 Ga0501032_0029753
687 Ga0501033_0004159
688 Ga0501033_0004556
689 Ga0501033_0088789
690 Ga0501033_0331759
691 Ga0501034_0001038
692 Ga0501034_0006556
693 Ga0501034_0090873
694 Ga0501036_0004606
695 Ga0501036_0004830
696 Ga0501036_0074142
697 Ga0501037_0179505
698 Ga0501038_0003349
699 Ga0501038_0015435
700 Ga0501038_0065848
701 Ga0501039_0008597
702 Ga0501039_0054265
703 Ga0501039_0125618
704 Ga0501040_0575920
705 Ga0501042_0050474
706 Ga0501042_0181224
707 Ga0501043_0001201
708 Ga0501043_0008838
709 Ga0501043_0032769
710 Ga0501046_0014805
711 Ga0501046_0248975
712 Ga0501047_0050793
713 Ga0501047_0202013
714 Ga0501047_0458575
715 Ga0501048_0100160
716 Ga0501070_0000421
717 Ga0501070_0107902
718 Ga0501070_0198856
719 Ga0501074_0004585
720 Ga0501074_0213642
721 Ga0501035_0004480
722 Ga0501035_0031200
723 Ga0501035_0220073
724 Ga0501044_0005898
725 Ga0501044_0009258
726 Ga0501044_0016794
727 Ga0501044_0031111
728 Ga0501044_0058690
729 Ga0501044_0065398
730 Ga0501045_0066452
731 nmdc:mga03n38_6251_c1
732 nmdc:mga0yw44_43106_c1
733 nmdc:mga07m45_109873_c1
734 nmdc:mga07m45_48168_c1
735 Ga0495655_0047684
736 Ga0495619_0165946
737 Ga0500644_0010396
738 Ga0500640_004325
739 Ga0500572_008966
740 Ga0500573_0028665
741 Ga0466962_0000087
742 2785345409
743 2547406800
744 2554259289
745 2585303897
746 2585315423
747 2616695961
748 2616900504
749 2643759895
750 2643904770
751 2643944147
752 2644268373
753 2644389406
754 2644405964
755 2644430995
756 2644438394
757 2644460409
758 2644629316
759 2785367476
760 2786668536
761 2804844075
762 2808847967
763 2808918724
764 2809230571
765 2811847245
766 2812360021
767 2812482093
768 2819696700
769 2852638001
770 2862180394
771 2862289318
772 2862294115
773 2862513019
774 2863406671
775 2867434585
776 2875392958
777 2912722070
778 2912725837
779 2918502822
780 2919473601
781 2935396396
782 2946051735
783 2946065872
784 2946074198
785 2947231532
786 2954010743
787 2954388290
788 2954674812
789 2954689321
790 2954699094
791 2954703125
792 2954718048
793 2954728016
794 2954733789
795 2954746912
796 2954752674
797 2954766026
798 2966604101
799 2990047098
800 2997454040
801 2997601940
802 3006430470
803 3006487810
804 3006495321
805 8008561637
806 8008580472
807 8023624633
808 8025416467
809 8025479326
810 8033688785
811 8048412019
812 8054167190
813 8056450910
814 8056673276
815 8056835402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

37

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.743 12 208
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7423 12 209
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.697 14 179
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6618 12 209
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6411 12 208
ID Description Score Start End Superfamily
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8933 29 149 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8834 33 149 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8819 33 150 3.40.50.2000
af_Q4DRS8_153_366_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.865 32 145 3.40.50.2000
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8616 33 149 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7W8BU18-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9645 5 217 GO:0003841
GO:0005886
GO:0006654
AF-A0A7W4ZWU6-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9633 5 217 GO:0003841
GO:0005886
GO:0006654
AF-A0A7K2JTK8-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9616 1 217 GO:0003841
GO:0005886
GO:0006654
AF-A0A346BXN9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.961 2 217 GO:0003841
GO:0005886
GO:0006654
AF-F3NLQ8-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase 0.9576 1 217 GO:0003841
GO:0005886
GO:0006654

Map