F436568

General Info

Members Datasets Scaffolds Average Seq Length
407 113 814 254

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0418083|Ga0501039_0418083_225_1040
Length 271
Sequence MRTYLRVRGQRTEEITGEIVREQPLTIYVDGERFLTLLCTPVKLEALVLGYLWMEKVIAGPDDVTRLEVSPVDGRVDVSLTRPVTLPTERILTSGCGGGITFRIDHRLFPRISSAFRMGPAALADRMKDLFAAAVQYRTSRGIHGAALSDGERLLIVAEDVGRHNAVDKVKGEALMRGIPTEDRVLLSTGRISSEMLLKAARMGVPIVASRTSPTEMAVALAEQLGITVCGYVRPDGLNLYAGDGVLLTEATGAGVSEPAPTRLTRRSDGP

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0418083 3300049575 Bacteria 1053
2 Ga0068869_100110686 3300005334 Bacteria 2089
3 Ga0070680_100025635 3300005336 Bacteria 4714
4 Ga0070692_10043562 3300005345 Bacteria 2308
5 Ga0070711_100209148 3300005439 Bacteria 1510
6 Ga0070705_100068646 3300005440 Bacteria 2134
7 Ga0070705_100087889 3300005440 Bacteria 1928
8 Ga0070694_100000394 3300005444 Bacteria 23658
9 Ga0070708_100010316 3300005445 Bacteria 7564
10 Ga0070708_100103283 3300005445 Bacteria 2612
11 Ga0070708_100123663 3300005445 Bacteria 2389
12 Ga0070708_100125570 3300005445 Bacteria 2371
13 Ga0070708_100220463 3300005445 Bacteria 1779
14 Ga0070708_100729538 3300005445 Bacteria 932
15 Ga0070706_100025477 3300005467 Bacteria 5444
16 Ga0070706_100029371 3300005467 Bacteria 5066
17 Ga0070706_100030052 3300005467 Bacteria 5004
18 Ga0070706_100042519 3300005467 Bacteria 4199
19 Ga0070707_100001404 3300005468 Bacteria 23652
20 Ga0070707_100004373 3300005468 Bacteria 13235
21 Ga0070707_100006852 3300005468 Bacteria 10551
22 Ga0070707_100057546 3300005468 Bacteria 3729
23 Ga0070707_100085869 3300005468 Bacteria 3042
24 Ga0070707_100119209 3300005468 Bacteria 2561
25 Ga0070698_100005004 3300005471 Bacteria 14520
26 Ga0070698_100009682 3300005471 Bacteria 10306
27 Ga0070698_100017454 3300005471 Bacteria 7564
28 Ga0070698_100104862 3300005471 Bacteria 2797
29 Ga0070699_100003765 3300005518 Bacteria 13408
30 Ga0070699_100011034 3300005518 Bacteria 7813
31 Ga0070699_100017688 3300005518 Bacteria 6120
32 Ga0070699_100054989 3300005518 Bacteria 3447
33 Ga0070699_100236020 3300005518 Bacteria 1631
34 Ga0070699_100306222 3300005518 Bacteria 1426
35 Ga0070697_100003976 3300005536 Bacteria 11346
36 Ga0070697_100005487 3300005536 Bacteria 9777
37 Ga0070697_100007246 3300005536 Bacteria 8626
38 Ga0070697_100021161 3300005536 Bacteria 5152
39 Ga0070697_100080999 3300005536 Bacteria 2675
40 Ga0070695_100001072 3300005545 Bacteria 14949
41 Ga0070695_100067976 3300005545 Bacteria 2325
42 Ga0070695_100091348 3300005545 Bacteria 2033
43 Ga0070696_100021499 3300005546 Bacteria 4375
44 Ga0070696_100072528 3300005546 Bacteria 2425
45 Ga0070696_100123276 3300005546 Bacteria 1878
46 Ga0070696_100375974 3300005546 Bacteria 1106
47 Ga0070696_100455929 3300005546 Bacteria 1010
48 Ga0070704_100103120 3300005549 Bacteria 2154
49 Ga0070704_100148619 3300005549 Bacteria 1839
50 Ga0070704_100213611 3300005549 Unclassified 1564
51 Ga0070704_100459528 3300005549 Bacteria 1098
52 Ga0070704_100482704 3300005549 Unclassified 1073
53 Ga0068861_100275394 3300005719 Bacteria 1447
54 Ga0068863_100024677 3300005841 Bacteria 5734
55 Ga0068860_100108124 3300005843 Bacteria 2658
56 Ga0068860_100168693 3300005843 Bacteria 2114
57 Ga0068862_100019640 3300005844 Bacteria 5642
58 Ga0081540_1035376 3300005983 Bacteria 2679
59 Ga0070715_10030416 3300006163 Bacteria 2183
60 Ga0070716_100001430 3300006173 Bacteria 10617
61 Ga0070712_100058989 3300006175 Bacteria 2701
62 Ga0075428_100011840 3300006844 Bacteria 9707
63 Ga0075428_100015145 3300006844 Bacteria 8559
64 Ga0075428_100044311 3300006844 Bacteria 4889
65 Ga0075428_100082326 3300006844 Bacteria 3512
66 Ga0075428_100088484 3300006844 Bacteria 3378
67 Ga0075430_100000678 3300006846 Bacteria 26055
68 Ga0075430_100001838 3300006846 Bacteria 17378
69 Ga0075430_100215124 3300006846 Bacteria 1595
70 Ga0075431_100000452 3300006847 Bacteria 33772
71 Ga0075431_100000470 3300006847 Bacteria 33363
72 Ga0075431_100001171 3300006847 Bacteria 23632
73 Ga0075431_100002638 3300006847 Bacteria 17346
74 Ga0075431_100010938 3300006847 Bacteria 9131
75 Ga0075431_100012448 3300006847 Bacteria 8586
76 Ga0075431_100156092 3300006847 Bacteria 2348
77 Ga0075431_100463911 3300006847 Bacteria 1261
78 Ga0075433_10000569 3300006852 Bacteria 24373
79 Ga0075433_10003817 3300006852 Bacteria 11660
80 Ga0075433_10008241 3300006852 Bacteria 8305
81 Ga0075433_10022975 3300006852 Bacteria 5243
82 Ga0075433_10034191 3300006852 Bacteria 4364
83 Ga0075433_10071099 3300006852 Bacteria 3059
84 Ga0075433_10284196 3300006852 Bacteria 1465
85 Ga0075434_100002260 3300006871 Bacteria 16853
86 Ga0075434_100012177 3300006871 Bacteria 8148
87 Ga0075434_100014732 3300006871 Bacteria 7481
88 Ga0075434_100020973 3300006871 Bacteria 6346
89 Ga0075434_100078574 3300006871 Bacteria 3295
90 Ga0075434_100088790 3300006871 Bacteria 3093
91 Ga0075434_100207447 3300006871 Bacteria 1980
92 Ga0075434_100273921 3300006871 Bacteria 1707
93 Ga0075434_100292265 3300006871 Bacteria 1650
94 Ga0075434_100372904 3300006871 Bacteria 1448
95 Ga0075434_100458504 3300006871 Bacteria 1296
96 Ga0075429_100020143 3300006880 Bacteria 5784
97 Ga0075429_100060329 3300006880 Bacteria 3304
98 Ga0075429_100234335 3300006880 Bacteria 1608
99 Ga0075436_100003311 3300006914 Bacteria 11021
100 Ga0075436_100015126 3300006914 Bacteria 5288
101 Ga0075436_100031997 3300006914 Bacteria 3625
102 Ga0075436_100042600 3300006914 Bacteria 3131
103 Ga0075436_100087422 3300006914 Bacteria 2165
104 Ga0075435_100000798 3300007076 Bacteria 19609
105 Ga0075435_100001899 3300007076 Bacteria 13598
106 Ga0075435_100008024 3300007076 Bacteria 7555
107 Ga0075435_100042156 3300007076 Bacteria 3650
108 Ga0075435_100120032 3300007076 Bacteria 2193
109 Ga0075435_100133311 3300007076 Bacteria 2080
110 Ga0099794_10047719 3300007265 Bacteria 2054
111 Ga0099794_10087623 3300007265 Bacteria 1542
112 Ga0099794_10245917 3300007265 Bacteria 922
113 Ga0111539_10000557 3300009094 Bacteria 47767
114 Ga0111539_10060620 3300009094 Bacteria 4484
115 Ga0111539_10525985 3300009094 Bacteria 1378
116 Ga0105245_10159260 3300009098 Bacteria 2141
117 Ga0105247_10303695 3300009101 Bacteria 1108
118 Ga0114129_10002578 3300009147 Bacteria 25189
119 Ga0114129_10005336 3300009147 Bacteria 18137
120 Ga0114129_10011627 3300009147 Bacteria 12531
121 Ga0114129_10018835 3300009147 Bacteria 9832
122 Ga0114129_10037056 3300009147 Bacteria 6886
123 Ga0114129_10037140 3300009147 Bacteria 6877
124 Ga0114129_10111685 3300009147 Bacteria 3771
125 Ga0114129_10180500 3300009147 Bacteria 2872
126 Ga0114129_10230055 3300009147 Bacteria 2497
127 Ga0114129_10294080 3300009147 Unclassified 2167
128 Ga0114129_10336533 3300009147 Bacteria 2003
129 Ga0114129_10868402 3300009147 Bacteria 1145
130 Ga0105243_10013327 3300009148 Bacteria 6217
131 Ga0105243_10434372 3300009148 Bacteria 1228
132 Ga0105242_10044202 3300009176 Bacteria 3606
133 Ga0105242_10159051 3300009176 Bacteria 1976
134 Ga0105248_10522988 3300009177 Bacteria 1338
135 Ga0157378_10174689 3300013297 Bacteria 2017
136 Ga0207653_10002684 3300025885 Bacteria 5651
137 Ga0207642_10118300 3300025899 Bacteria 1362
138 Ga0207684_10000242 3300025910 Bacteria 81735
139 Ga0207684_10009099 3300025910 Bacteria 8796
140 Ga0207684_10009125 3300025910 Bacteria 8784
141 Ga0207684_10024688 3300025910 Bacteria 5125
142 Ga0207684_10031222 3300025910 Bacteria 4532
143 Ga0207684_10147664 3300025910 Bacteria 2022
144 Ga0207684_10535889 3300025910 Bacteria 1002
145 Ga0207663_10220852 3300025916 Bacteria 1378
146 Ga0207662_10234372 3300025918 Bacteria 1200
147 Ga0207662_10363580 3300025918 Unclassified 974
148 Ga0207646_10000574 3300025922 Bacteria 48122
149 Ga0207646_10001059 3300025922 Bacteria 35029
150 Ga0207646_10001338 3300025922 Bacteria 30615
151 Ga0207646_10008510 3300025922 Bacteria 10266
152 Ga0207646_10025618 3300025922 Bacteria 5394
153 Ga0207646_10026833 3300025922 Bacteria 5253
154 Ga0207646_10129319 3300025922 Bacteria 2272
155 Ga0207686_10195220 3300025934 Bacteria 1446
156 Ga0207686_10485556 3300025934 Bacteria 956
157 Ga0207709_10306880 3300025935 Bacteria 1182
158 Ga0207665_10002619 3300025939 Bacteria 12106
159 Ga0207711_10323703 3300025941 Bacteria 1425
160 Ga0207689_10099879 3300025942 Bacteria 2384
161 Ga0207712_10068356 3300025961 Bacteria 2545
162 Ga0207712_10355243 3300025961 Bacteria 1219
163 Ga0207708_10014091 3300026075 Bacteria 5974
164 Ga0207641_10045066 3300026088 Bacteria 3712
165 Ga0207648_10038865 3300026089 Bacteria 4187
166 Ga0207648_10466451 3300026089 Bacteria 1152
167 Ga0209588_1014508 3300027671 Bacteria 2413
168 Ga0209588_1017514 3300027671 Bacteria 2222
169 Ga0207428_10000054 3300027907 Bacteria 175237
170 Ga0268264_10551794 3300028381 Bacteria 1130
171 Ga0307408_100206282 3300031548 Bacteria 1594
172 Ga0307408_100257875 3300031548 Bacteria 1441
173 Ga0307410_10004717 3300031852 Bacteria 7096
174 Ga0307407_10093616 3300031903 Bacteria 1848
175 Ga0307409_100357568 3300031995 Bacteria 1380
176 Ga0307416_100038673 3300032002 Bacteria 3683
177 Ga0307416_100292527 3300032002 Bacteria 1613
178 Ga0373949_0068717 3300035090 Bacteria 924
179 Ga0373939_0078554 3300035114 Bacteria 1091
180 Ga0395899_0114787 3300037312 Bacteria 1933
181 Ga0395900_0146852 3300037418 Bacteria 2411
182 Ga0395901_0001149 3300038443 Bacteria 28063
183 Ga0451853_4004034 3300041512 Bacteria 1571
184 Ga0451577_0010026 3300042876 Bacteria 9074
185 Ga0451577_0848994 3300042876 Bacteria 824
186 Ga0453683_0055858 3300044673 Bacteria 2470
187 Ga0453683_0428121 3300044673 Bacteria 855
188 Ga0453683_0444001 3300044673 Bacteria 839
189 Ga0453684_0202429 3300044712 Bacteria 2313
190 Ga0453684_0527197 3300044712 Bacteria 1304
191 Ga0453684_0804841 3300044712 Unclassified 1013
192 Ga0451576_0018184 3300045051 Bacteria 7709
193 Ga0451576_0024076 3300045051 Bacteria 6579
194 Ga0451576_0031407 3300045051 Bacteria 5662
195 Ga0451576_0182118 3300045051 Bacteria 2193
196 Ga0451576_0749095 3300045051 Bacteria 1026
197 Ga0496102_0146268 3300048905 Bacteria 2218
198 Ga0501031_0089204 3300049568 Bacteria 2010
199 Ga0501033_0002890 3300049570 Bacteria 14373
200 Ga0501036_0001779 3300049572 Bacteria 16725
201 Ga0501036_0067672 3300049572 Bacteria 3022
202 Ga0501038_0002922 3300049574 Bacteria 15929
203 Ga0501038_0090615 3300049574 Bacteria 2563
204 Ga0501039_0019522 3300049575 Bacteria 5197
205 Ga0501039_0071948 3300049575 Bacteria 2687
206 Ga0501039_0453603 3300049575 Bacteria 1007
207 Ga0501039_0619377 3300049575 Bacteria 848
208 Ga0501040_0002953 3300049576 Bacteria 11000
209 Ga0501040_0002971 3300049576 Bacteria 10974
210 Ga0501040_0012570 3300049576 Bacteria 5549
211 Ga0501040_0066384 3300049576 Bacteria 2486
212 Ga0501040_0115769 3300049576 Bacteria 1877
213 Ga0501040_0321501 3300049576 Bacteria 1107
214 Ga0501041_0000992 3300049577 Bacteria 15513
215 Ga0501041_0026798 3300049577 Bacteria 3470
216 Ga0501041_0057419 3300049577 Bacteria 2380
217 Ga0501041_0145712 3300049577 Bacteria 1477
218 Ga0501041_0317106 3300049577 Bacteria 983
219 Ga0501042_0000167 3300049578 Bacteria 30321
220 Ga0501042_0042706 3300049578 Bacteria 3228
221 Ga0501042_0071127 3300049578 Bacteria 2489
222 Ga0501043_0015020 3300049579 Bacteria 6064
223 Ga0501043_0084185 3300049579 Bacteria 2500
224 Ga0501046_0001144 3300049580 Bacteria 25813
225 Ga0501046_0052756 3300049580 Bacteria 3204
226 Ga0501046_0418368 3300049580 Bacteria 966
227 Ga0501046_0437856 3300049580 Bacteria 941
228 Ga0501048_0006004 3300049582 Bacteria 9247
229 Ga0501048_0253692 3300049582 Bacteria 1249
230 Ga0501048_0289396 3300049582 Bacteria 1165
231 Ga0501067_0036156 3300049583 Bacteria 2743
232 Ga0501068_0003481 3300049584 Bacteria 8484
233 Ga0501068_0028709 3300049584 Bacteria 3292
234 Ga0501068_0125548 3300049584 Bacteria 1602
235 Ga0501070_0125019 3300049586 Bacteria 2126
236 Ga0501070_0195163 3300049586 Bacteria 1663
237 Ga0501071_0000960 3300049587 Bacteria 15709
238 Ga0501071_0010627 3300049587 Bacteria 6174
239 Ga0501071_0077338 3300049587 Bacteria 2431
240 Ga0501071_0387706 3300049587 Bacteria 1066
241 Ga0501072_0001040 3300049588 Bacteria 20539
242 Ga0501072_0003574 3300049588 Bacteria 11696
243 Ga0501072_0010535 3300049588 Bacteria 7038
244 Ga0501072_0020145 3300049588 Bacteria 5164
245 Ga0501072_0071905 3300049588 Bacteria 2733
246 Ga0501072_0084361 3300049588 Bacteria 2519
247 Ga0501072_0087640 3300049588 Bacteria 2470
248 Ga0501074_0007791 3300049590 Bacteria 7754
249 Ga0501074_0113181 3300049590 Bacteria 1942
250 Ga0501074_0317318 3300049590 Bacteria 1107
251 Ga0501075_0000066 3300049591 Bacteria 45649
252 Ga0501075_0000904 3300049591 Bacteria 18763
253 Ga0501075_0030331 3300049591 Bacteria 4005
254 Ga0501075_0037636 3300049591 Bacteria 3615
255 Ga0501075_0060368 3300049591 Bacteria 2857
256 Ga0501075_0101618 3300049591 Bacteria 2184
257 Ga0501075_0113500 3300049591 Bacteria 2060
258 Ga0501075_0120586 3300049591 Bacteria 1996
259 Ga0501075_0167572 3300049591 Bacteria 1676
260 Ga0501075_0356904 3300049591 Bacteria 1114
261 Ga0501076_0001536 3300049592 Bacteria 15457
262 Ga0501076_0002672 3300049592 Bacteria 12304
263 Ga0501076_0031045 3300049592 Bacteria 4164
264 Ga0501076_0046285 3300049592 Bacteria 3437
265 Ga0501076_0053307 3300049592 Bacteria 3205
266 Ga0501076_0095695 3300049592 Bacteria 2392
267 Ga0501076_0134830 3300049592 Bacteria 2004
268 Ga0501077_0000537 3300049593 Bacteria 22994
269 Ga0501077_0002608 3300049593 Bacteria 10797
270 Ga0501077_0070481 3300049593 Bacteria 2215
271 Ga0501077_0138915 3300049593 Bacteria 1541
272 Ga0501077_0148788 3300049593 Bacteria 1486
273 Ga0501079_0000198 3300049741 Bacteria 34763
274 Ga0501079_0010353 3300049741 Bacteria 7087
275 Ga0501079_0011400 3300049741 Bacteria 6785
276 Ga0501079_0014103 3300049741 Bacteria 6092
277 Ga0501079_0053260 3300049741 Bacteria 3122
278 Ga0501079_0128254 3300049741 Bacteria 1974
279 Ga0501079_0139655 3300049741 Bacteria 1887
280 Ga0501079_0179970 3300049741 Bacteria 1650
281 Ga0501079_0251006 3300049741 Bacteria 1383
282 Ga0501079_0277534 3300049741 Bacteria 1310
283 Ga0501079_0315449 3300049741 Bacteria 1224
284 Ga0501080_0000373 3300049742 Bacteria 34505
285 Ga0501080_0032327 3300049742 Bacteria 4880
286 Ga0501080_0258553 3300049742 Bacteria 1587
287 Ga0501080_0377079 3300049742 Bacteria 1278
288 Ga0501080_0397462 3300049742 Bacteria 1240
289 Ga0501081_0000011 3300049743 Bacteria 67455
290 Ga0501081_0002426 3300049743 Bacteria 11762
291 Ga0501081_0020763 3300049743 Bacteria 4380
292 Ga0501081_0022969 3300049743 Bacteria 4176
293 Ga0501081_0029926 3300049743 Bacteria 3682
294 Ga0501081_0043835 3300049743 Bacteria 3070
295 Ga0501081_0092241 3300049743 Bacteria 2131
296 Ga0501081_0123876 3300049743 Bacteria 1843
297 Ga0501081_0129802 3300049743 Bacteria 1800
298 Ga0501081_0146511 3300049743 Bacteria 1695
299 Ga0501081_0167590 3300049743 Bacteria 1585
300 Ga0501081_0172132 3300049743 Bacteria 1564
301 Ga0501081_0250800 3300049743 Bacteria 1292
302 Ga0501081_0375772 3300049743 Bacteria 1050
303 Ga0501035_0007234 3300049822 Bacteria 10385
304 Ga0501035_0291457 3300049822 Bacteria 1377
305 Ga0501045_0000024 3300049824 Bacteria 63402
306 Ga0501045_0006418 3300049824 Bacteria 8145
307 Ga0501045_0032310 3300049824 Bacteria 3793
308 Ga0501045_0207194 3300049824 Bacteria 1461
309 Ga0501045_0326856 3300049824 Bacteria 1141
310 nmdc:mga05p37_111730_c1 3300050507 Bacteria 3360
311 nmdc:mga05p37_12882_c1 3300050507 Bacteria 10000
312 nmdc:mga05p37_14241_c1 3300050507 Bacteria 9551
313 nmdc:mga05p37_150783_c1 3300050507 Bacteria 2844
314 nmdc:mga05p37_155589_c1 3300050507 Bacteria 2794
315 nmdc:mga05p37_190047_c1 3300050507 Bacteria 2494
316 nmdc:mga05p37_203335_c1 3300050507 Unclassified 2397
317 nmdc:mga05p37_242135_c1 3300050507 Unclassified 2168
318 nmdc:mga05p37_27885_c1 3300050507 Bacteria 6880
319 nmdc:mga05p37_30215_c1 3300050507 Bacteria 6610
320 nmdc:mga05p37_508371_c1 3300050507 Bacteria 1381
321 nmdc:mga05p37_6182_c1 3300050507 Bacteria 14094
322 nmdc:mga05p37_6204_c1 3300050507 Bacteria 14081
323 nmdc:mga05p37_653931_c1 3300050507 Bacteria 1176
324 nmdc:mga05p37_733_c1 3300050507 Bacteria 36361
325 nmdc:mga05p37_863970_c1 3300050507 Bacteria 980
326 nmdc:mga09592_17334_c1 3300050508 Bacteria 5900
327 nmdc:mga09592_18763_c1 3300050508 Bacteria 5674
328 nmdc:mga09592_55292_c1 3300050508 Bacteria 3354
329 nmdc:mga0qj67_107028_c1 3300050509 Bacteria 2256
330 nmdc:mga0qj67_2028_c1 3300050509 Bacteria 14447
331 nmdc:mga0qj67_236835_c1 3300050509 Bacteria 1481
332 nmdc:mga0qj67_27698_c1 3300050509 Bacteria 4394
333 nmdc:mga0qj67_314106_c1 3300050509 Bacteria 1269
334 nmdc:mga0qj67_65103_c1 3300050509 Bacteria 2901
335 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
336 nmdc:mga06r32_14952_c1 3300050510 Bacteria 7044
337 nmdc:mga06r32_152578_c1 3300050510 Bacteria 2289
338 nmdc:mga06r32_31611_c1 3300050510 Bacteria 4973
339 nmdc:mga06r32_32576_c1 3300050510 Bacteria 4904
340 nmdc:mga06r32_408350_c1 3300050510 Bacteria 1340
341 nmdc:mga06r32_428_c1 3300050510 Bacteria 35405
342 nmdc:mga06r32_464445_c1 3300050510 Unclassified 1245
343 nmdc:mga06r32_499134_c1 3300050510 Bacteria 1194
344 nmdc:mga06r32_5981_c1 3300050510 Bacteria 10949
345 nmdc:mga08y16_3397_c1 3300050511 Bacteria 16517
346 nmdc:mga0n895_133672_c1 3300050512 Bacteria 2507
347 nmdc:mga0n895_189906_c1 3300050512 Bacteria 2085
348 nmdc:mga0n895_191_c1 3300050512 Bacteria 38035
349 nmdc:mga0n895_25423_c1 3300050512 Bacteria 5594
350 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
351 nmdc:mga0n895_280324_c1 3300050512 Bacteria 1690
352 nmdc:mga0n895_47068_c1 3300050512 Bacteria 4216
353 nmdc:mga0n895_47867_c1 3300050512 Bacteria 4182
354 nmdc:mga0n895_61671_c1 3300050512 Bacteria 3703
355 nmdc:mga0n895_82250_c1 3300050512 Bacteria 3210
356 nmdc:mga0rr50_158411_c1 3300050513 Bacteria 1836
357 nmdc:mga0rr50_213800_c1 3300050513 Bacteria 1590
358 nmdc:mga0rr50_4055_c1 3300050513 Bacteria 8550
359 nmdc:mga0rr50_4332_c1 3300050513 Bacteria 8323
360 nmdc:mga0rr50_5520_c1 3300050513 Bacteria 7557
361 nmdc:mga08x19_23533_c1 3300050514 Bacteria 3821
362 nmdc:mga08x19_3113_c1 3300050514 Bacteria 9971
363 nmdc:mga08x19_395691_c1 3300050514 Bacteria 969
364 nmdc:mga08x19_78336_c1 3300050514 Bacteria 2166
365 nmdc:mga08x19_828_c1 3300050514 Bacteria 19629
366 nmdc:mga0a205_12594_c1 3300050515 Bacteria 7827
367 nmdc:mga0a205_1641_c1 3300050515 Bacteria 19216
368 nmdc:mga0a205_3171_c1 3300050515 Bacteria 14605
369 nmdc:mga0a205_329_c1 3300050515 Bacteria 35516
370 nmdc:mga0a205_3827_c1 3300050515 Bacteria 13481
371 nmdc:mga0a205_4666_c1 3300050515 Bacteria 12290
372 nmdc:mga0a205_51807_c1 3300050515 Unclassified 2005
373 nmdc:mga0a205_70230_c1 3300050515 Bacteria 3381
374 nmdc:mga0a205_77524_c1 3300050515 Bacteria 3211
375 nmdc:mga0a205_89802_c1 3300050515 Bacteria 2970
376 Ga0501084_0001718 3300054114 Bacteria 17396
377 Ga0501084_0009961 3300054114 Bacteria 7858
378 Ga0501084_0014602 3300054114 Bacteria 6510
379 Ga0501084_0032020 3300054114 Bacteria 4398
380 Ga0501084_0066782 3300054114 Bacteria 3009
381 Ga0501084_0107705 3300054114 Bacteria 2341
382 Ga0501084_0119337 3300054114 Bacteria 2217
383 Ga0501084_0151080 3300054114 Bacteria 1958
384 Ga0501084_0291119 3300054114 Bacteria 1379
385 Ga0501084_0301767 3300054114 Bacteria 1353
386 Ga0501084_0362237 3300054114 Bacteria 1225
387 Ga0501084_0747188 3300054114 Bacteria 824
388 Ga0590075_018882 3300059424 Bacteria 1708
389 Ga0590077_021261 3300059426 Bacteria 1380
390 Ga0501082_0014955 3300060353 Bacteria 6688
391 Ga0501082_0021624 3300060353 Bacteria 5547
392 Ga0501082_0048893 3300060353 Bacteria 3646
393 Ga0501082_0103937 3300060353 Bacteria 2457
394 Ga0501082_0126237 3300060353 Bacteria 2219
395 Ga0501082_0168965 3300060353 Bacteria 1901
396 Ga0501082_0243889 3300060353 Bacteria 1564
397 Ga0530510_0000034 3300061734 Bacteria 62610
398 Ga0530510_0007417 3300061734 Bacteria 7634
399 Ga0530510_0007831 3300061734 Bacteria 7450
400 Ga0530510_0008889 3300061734 Bacteria 7032
401 Ga0530510_0012428 3300061734 Bacteria 5981
402 Ga0530510_0026793 3300061734 Bacteria 4128
403 Ga0530510_0034204 3300061734 Bacteria 3660
404 Ga0530510_0084738 3300061734 Bacteria 2309
405 Ga0530510_0113455 3300061734 Bacteria 1986
406 Ga0530510_0230795 3300061734 Bacteria 1377
407 Ga0530510_0591124 3300061734 Bacteria 844
408 Ga0501039_0418083
409 Ga0068869_100110686
410 Ga0070680_100025635
411 Ga0070692_10043562
412 Ga0070711_100209148
413 Ga0070705_100068646
414 Ga0070705_100087889
415 Ga0070694_100000394
416 Ga0070708_100010316
417 Ga0070708_100103283
418 Ga0070708_100123663
419 Ga0070708_100125570
420 Ga0070708_100220463
421 Ga0070708_100729538
422 Ga0070706_100025477
423 Ga0070706_100029371
424 Ga0070706_100030052
425 Ga0070706_100042519
426 Ga0070707_100001404
427 Ga0070707_100004373
428 Ga0070707_100006852
429 Ga0070707_100057546
430 Ga0070707_100085869
431 Ga0070707_100119209
432 Ga0070698_100005004
433 Ga0070698_100009682
434 Ga0070698_100017454
435 Ga0070698_100104862
436 Ga0070699_100003765
437 Ga0070699_100011034
438 Ga0070699_100017688
439 Ga0070699_100054989
440 Ga0070699_100236020
441 Ga0070699_100306222
442 Ga0070697_100003976
443 Ga0070697_100005487
444 Ga0070697_100007246
445 Ga0070697_100021161
446 Ga0070697_100080999
447 Ga0070695_100001072
448 Ga0070695_100067976
449 Ga0070695_100091348
450 Ga0070696_100021499
451 Ga0070696_100072528
452 Ga0070696_100123276
453 Ga0070696_100375974
454 Ga0070696_100455929
455 Ga0070704_100103120
456 Ga0070704_100148619
457 Ga0070704_100213611
458 Ga0070704_100459528
459 Ga0070704_100482704
460 Ga0068861_100275394
461 Ga0068863_100024677
462 Ga0068860_100108124
463 Ga0068860_100168693
464 Ga0068862_100019640
465 Ga0081540_1035376
466 Ga0070715_10030416
467 Ga0070716_100001430
468 Ga0070712_100058989
469 Ga0075428_100011840
470 Ga0075428_100015145
471 Ga0075428_100044311
472 Ga0075428_100082326
473 Ga0075428_100088484
474 Ga0075430_100000678
475 Ga0075430_100001838
476 Ga0075430_100215124
477 Ga0075431_100000452
478 Ga0075431_100000470
479 Ga0075431_100001171
480 Ga0075431_100002638
481 Ga0075431_100010938
482 Ga0075431_100012448
483 Ga0075431_100156092
484 Ga0075431_100463911
485 Ga0075433_10000569
486 Ga0075433_10003817
487 Ga0075433_10008241
488 Ga0075433_10022975
489 Ga0075433_10034191
490 Ga0075433_10071099
491 Ga0075433_10284196
492 Ga0075434_100002260
493 Ga0075434_100012177
494 Ga0075434_100014732
495 Ga0075434_100020973
496 Ga0075434_100078574
497 Ga0075434_100088790
498 Ga0075434_100207447
499 Ga0075434_100273921
500 Ga0075434_100292265
501 Ga0075434_100372904
502 Ga0075434_100458504
503 Ga0075429_100020143
504 Ga0075429_100060329
505 Ga0075429_100234335
506 Ga0075436_100003311
507 Ga0075436_100015126
508 Ga0075436_100031997
509 Ga0075436_100042600
510 Ga0075436_100087422
511 Ga0075435_100000798
512 Ga0075435_100001899
513 Ga0075435_100008024
514 Ga0075435_100042156
515 Ga0075435_100120032
516 Ga0075435_100133311
517 Ga0099794_10047719
518 Ga0099794_10087623
519 Ga0099794_10245917
520 Ga0111539_10000557
521 Ga0111539_10060620
522 Ga0111539_10525985
523 Ga0105245_10159260
524 Ga0105247_10303695
525 Ga0114129_10002578
526 Ga0114129_10005336
527 Ga0114129_10011627
528 Ga0114129_10018835
529 Ga0114129_10037056
530 Ga0114129_10037140
531 Ga0114129_10111685
532 Ga0114129_10180500
533 Ga0114129_10230055
534 Ga0114129_10294080
535 Ga0114129_10336533
536 Ga0114129_10868402
537 Ga0105243_10013327
538 Ga0105243_10434372
539 Ga0105242_10044202
540 Ga0105242_10159051
541 Ga0105248_10522988
542 Ga0157378_10174689
543 Ga0207653_10002684
544 Ga0207642_10118300
545 Ga0207684_10000242
546 Ga0207684_10009099
547 Ga0207684_10009125
548 Ga0207684_10024688
549 Ga0207684_10031222
550 Ga0207684_10147664
551 Ga0207684_10535889
552 Ga0207663_10220852
553 Ga0207662_10234372
554 Ga0207662_10363580
555 Ga0207646_10000574
556 Ga0207646_10001059
557 Ga0207646_10001338
558 Ga0207646_10008510
559 Ga0207646_10025618
560 Ga0207646_10026833
561 Ga0207646_10129319
562 Ga0207686_10195220
563 Ga0207686_10485556
564 Ga0207709_10306880
565 Ga0207665_10002619
566 Ga0207711_10323703
567 Ga0207689_10099879
568 Ga0207712_10068356
569 Ga0207712_10355243
570 Ga0207708_10014091
571 Ga0207641_10045066
572 Ga0207648_10038865
573 Ga0207648_10466451
574 Ga0209588_1014508
575 Ga0209588_1017514
576 Ga0207428_10000054
577 Ga0268264_10551794
578 Ga0307408_100206282
579 Ga0307408_100257875
580 Ga0307410_10004717
581 Ga0307407_10093616
582 Ga0307409_100357568
583 Ga0307416_100038673
584 Ga0307416_100292527
585 Ga0373949_0068717
586 Ga0373939_0078554
587 Ga0395899_0114787
588 Ga0395900_0146852
589 Ga0395901_0001149
590 Ga0451853_4004034
591 Ga0451577_0010026
592 Ga0451577_0848994
593 Ga0453683_0055858
594 Ga0453683_0428121
595 Ga0453683_0444001
596 Ga0453684_0202429
597 Ga0453684_0527197
598 Ga0453684_0804841
599 Ga0451576_0018184
600 Ga0451576_0024076
601 Ga0451576_0031407
602 Ga0451576_0182118
603 Ga0451576_0749095
604 Ga0496102_0146268
605 Ga0501031_0089204
606 Ga0501033_0002890
607 Ga0501036_0001779
608 Ga0501036_0067672
609 Ga0501038_0002922
610 Ga0501038_0090615
611 Ga0501039_0019522
612 Ga0501039_0071948
613 Ga0501039_0453603
614 Ga0501039_0619377
615 Ga0501040_0002953
616 Ga0501040_0002971
617 Ga0501040_0012570
618 Ga0501040_0066384
619 Ga0501040_0115769
620 Ga0501040_0321501
621 Ga0501041_0000992
622 Ga0501041_0026798
623 Ga0501041_0057419
624 Ga0501041_0145712
625 Ga0501041_0317106
626 Ga0501042_0000167
627 Ga0501042_0042706
628 Ga0501042_0071127
629 Ga0501043_0015020
630 Ga0501043_0084185
631 Ga0501046_0001144
632 Ga0501046_0052756
633 Ga0501046_0418368
634 Ga0501046_0437856
635 Ga0501048_0006004
636 Ga0501048_0253692
637 Ga0501048_0289396
638 Ga0501067_0036156
639 Ga0501068_0003481
640 Ga0501068_0028709
641 Ga0501068_0125548
642 Ga0501070_0125019
643 Ga0501070_0195163
644 Ga0501071_0000960
645 Ga0501071_0010627
646 Ga0501071_0077338
647 Ga0501071_0387706
648 Ga0501072_0001040
649 Ga0501072_0003574
650 Ga0501072_0010535
651 Ga0501072_0020145
652 Ga0501072_0071905
653 Ga0501072_0084361
654 Ga0501072_0087640
655 Ga0501074_0007791
656 Ga0501074_0113181
657 Ga0501074_0317318
658 Ga0501075_0000066
659 Ga0501075_0000904
660 Ga0501075_0030331
661 Ga0501075_0037636
662 Ga0501075_0060368
663 Ga0501075_0101618
664 Ga0501075_0113500
665 Ga0501075_0120586
666 Ga0501075_0167572
667 Ga0501075_0356904
668 Ga0501076_0001536
669 Ga0501076_0002672
670 Ga0501076_0031045
671 Ga0501076_0046285
672 Ga0501076_0053307
673 Ga0501076_0095695
674 Ga0501076_0134830
675 Ga0501077_0000537
676 Ga0501077_0002608
677 Ga0501077_0070481
678 Ga0501077_0138915
679 Ga0501077_0148788
680 Ga0501079_0000198
681 Ga0501079_0010353
682 Ga0501079_0011400
683 Ga0501079_0014103
684 Ga0501079_0053260
685 Ga0501079_0128254
686 Ga0501079_0139655
687 Ga0501079_0179970
688 Ga0501079_0251006
689 Ga0501079_0277534
690 Ga0501079_0315449
691 Ga0501080_0000373
692 Ga0501080_0032327
693 Ga0501080_0258553
694 Ga0501080_0377079
695 Ga0501080_0397462
696 Ga0501081_0000011
697 Ga0501081_0002426
698 Ga0501081_0020763
699 Ga0501081_0022969
700 Ga0501081_0029926
701 Ga0501081_0043835
702 Ga0501081_0092241
703 Ga0501081_0123876
704 Ga0501081_0129802
705 Ga0501081_0146511
706 Ga0501081_0167590
707 Ga0501081_0172132
708 Ga0501081_0250800
709 Ga0501081_0375772
710 Ga0501035_0007234
711 Ga0501035_0291457
712 Ga0501045_0000024
713 Ga0501045_0006418
714 Ga0501045_0032310
715 Ga0501045_0207194
716 Ga0501045_0326856
717 nmdc:mga05p37_111730_c1
718 nmdc:mga05p37_12882_c1
719 nmdc:mga05p37_14241_c1
720 nmdc:mga05p37_150783_c1
721 nmdc:mga05p37_155589_c1
722 nmdc:mga05p37_190047_c1
723 nmdc:mga05p37_203335_c1
724 nmdc:mga05p37_242135_c1
725 nmdc:mga05p37_27885_c1
726 nmdc:mga05p37_30215_c1
727 nmdc:mga05p37_508371_c1
728 nmdc:mga05p37_6182_c1
729 nmdc:mga05p37_6204_c1
730 nmdc:mga05p37_653931_c1
731 nmdc:mga05p37_733_c1
732 nmdc:mga05p37_863970_c1
733 nmdc:mga09592_17334_c1
734 nmdc:mga09592_18763_c1
735 nmdc:mga09592_55292_c1
736 nmdc:mga0qj67_107028_c1
737 nmdc:mga0qj67_2028_c1
738 nmdc:mga0qj67_236835_c1
739 nmdc:mga0qj67_27698_c1
740 nmdc:mga0qj67_314106_c1
741 nmdc:mga0qj67_65103_c1
742 nmdc:mga06r32_132_c1
743 nmdc:mga06r32_14952_c1
744 nmdc:mga06r32_152578_c1
745 nmdc:mga06r32_31611_c1
746 nmdc:mga06r32_32576_c1
747 nmdc:mga06r32_408350_c1
748 nmdc:mga06r32_428_c1
749 nmdc:mga06r32_464445_c1
750 nmdc:mga06r32_499134_c1
751 nmdc:mga06r32_5981_c1
752 nmdc:mga08y16_3397_c1
753 nmdc:mga0n895_133672_c1
754 nmdc:mga0n895_189906_c1
755 nmdc:mga0n895_191_c1
756 nmdc:mga0n895_25423_c1
757 nmdc:mga0n895_26_c1
758 nmdc:mga0n895_280324_c1
759 nmdc:mga0n895_47068_c1
760 nmdc:mga0n895_47867_c1
761 nmdc:mga0n895_61671_c1
762 nmdc:mga0n895_82250_c1
763 nmdc:mga0rr50_158411_c1
764 nmdc:mga0rr50_213800_c1
765 nmdc:mga0rr50_4055_c1
766 nmdc:mga0rr50_4332_c1
767 nmdc:mga0rr50_5520_c1
768 nmdc:mga08x19_23533_c1
769 nmdc:mga08x19_3113_c1
770 nmdc:mga08x19_395691_c1
771 nmdc:mga08x19_78336_c1
772 nmdc:mga08x19_828_c1
773 nmdc:mga0a205_12594_c1
774 nmdc:mga0a205_1641_c1
775 nmdc:mga0a205_3171_c1
776 nmdc:mga0a205_329_c1
777 nmdc:mga0a205_3827_c1
778 nmdc:mga0a205_4666_c1
779 nmdc:mga0a205_51807_c1
780 nmdc:mga0a205_70230_c1
781 nmdc:mga0a205_77524_c1
782 nmdc:mga0a205_89802_c1
783 Ga0501084_0001718
784 Ga0501084_0009961
785 Ga0501084_0014602
786 Ga0501084_0032020
787 Ga0501084_0066782
788 Ga0501084_0107705
789 Ga0501084_0119337
790 Ga0501084_0151080
791 Ga0501084_0291119
792 Ga0501084_0301767
793 Ga0501084_0362237
794 Ga0501084_0747188
795 Ga0590075_018882
796 Ga0590077_021261
797 Ga0501082_0014955
798 Ga0501082_0021624
799 Ga0501082_0048893
800 Ga0501082_0103937
801 Ga0501082_0126237
802 Ga0501082_0168965
803 Ga0501082_0243889
804 Ga0530510_0000034
805 Ga0530510_0007417
806 Ga0530510_0007831
807 Ga0530510_0008889
808 Ga0530510_0012428
809 Ga0530510_0026793
810 Ga0530510_0034204
811 Ga0530510_0084738
812 Ga0530510_0113455
813 Ga0530510_0230795
814 Ga0530510_0591124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02634

FdhD-NarQ

FdhD/NarQ family

20

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sff-assembly1.cif.gz_A cct g beta 5 complex closed state 0 0.943 204 233
1gn1-assembly3.cif.gz_F crystal structure of the mouse cct gamma apical domain (monoclinic) 0.9177 205 234
1gn1-assembly4.cif.gz_H crystal structure of the mouse cct gamma apical domain (monoclinic) 0.9163 205 234
7yly-assembly1.cif.gz_a yeast tric-plp2 complex at s5 closed tric state 0.9083 204 232
2pw9-assembly1.cif.gz_A crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila 0.8926 2 247
ID Description Score Start End Superfamily
af_Q2FVX3_117_265_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9403 105 247 3.40.140.10
af_O96220_219_360_3.50.7.10 Alpha Beta;3-Layer(bba) Sandwich;GroEL;GroEL 0.9399 200 231 3.50.7.10
af_P32177_133_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9333 109 247 3.40.140.10
2pw9C02 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9312 22 79 3.10.20.10
af_Q803P2_7_535_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.9308 204 233 1.10.560.10
ID Description Score Start End GO Terms
AF-A0A1G1GLE2-F1-model_v4 Formate dehydrogenase family accessory protein FdhD 0.9792 116 247 GO:0005737
GO:0006777
GO:0016783
AF-A0A1I7G9P9-F1-model_v4 deleted 0.974 155 244
AF-D8GNS6-F1-model_v4 Predicted formate dehydrogenase, subunit FdhD 0.9659 109 247 GO:0005737
GO:0006777
GO:0016783
AF-A0A1G1GLE2-F1-model_v4 Formate dehydrogenase family accessory protein FdhD 0.9649 116 247 GO:0005737
GO:0006777
GO:0016783
AF-A0A1V5J339-F1-model_v4 Formate dehydrogenase accessory protein 0.9633 128 244 GO:0005737
GO:0006777
GO:0016783

Map