F436559

General Info

Members Datasets Scaffolds Average Seq Length
407 246 814 234

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0021158|Ga0496126_0021158_724_1509
Length 261
Sequence VKERLGYRLIMDKVVASAGEAVADIPDGATLAVGGFGLCGIPTVAIQAVLAAGTKDLEVVSNNAGVDDWGLGLLLGAKRLRRVVASYVGENKEFARQYLAGELEVELTPQGTLAERMRAGGSGIAAFFTRTGVGTQVADGGMPWKYDSDGHVALASPPKQTQDFDGVTYVLERAIVADFGLVRAWKGDRHGNLVFRDAARNFNPLAAMCGKITIAEVEHLVDPGDINPNDVHTPGVFVQRVIPLTEDQAKDKRIEKRTVRG

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
241 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
242 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
243 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
244 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
245 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
246 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.49
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 2.95
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0021158 3300048929 Bacteria 6360
2 Ga0065714_10098615 3300005288 Bacteria 1701
3 Ga0065712_10000232 3300005290 Bacteria 32823
4 Ga0065715_10000187 3300005293 Bacteria 39980
5 Ga0065715_10022993 3300005293 Bacteria 2095
6 Ga0070683_100000029 3300005329 Bacteria 158913
7 Ga0070683_100292416 3300005329 Bacteria 1549
8 Ga0070670_100000056 3300005331 Bacteria 119039
9 Ga0070670_100034356 3300005331 Bacteria 4363
10 Ga0070670_100327422 3300005331 Bacteria 1343
11 Ga0070677_10018480 3300005333 Bacteria 2511
12 Ga0068869_100035961 3300005334 Bacteria 3514
13 Ga0068869_100048120 3300005334 Bacteria 3082
14 Ga0070666_10028311 3300005335 Bacteria 3676
15 Ga0070666_10098725 3300005335 Bacteria 2011
16 Ga0070680_100005328 3300005336 Bacteria 9731
17 Ga0070682_100000024 3300005337 Bacteria 199229
18 Ga0070682_100436901 3300005337 Bacteria 999
19 Ga0068868_100000713 3300005338 Bacteria 22398
20 Ga0068868_100001907 3300005338 Bacteria 14320
21 Ga0070689_100000773 3300005340 Bacteria 19599
22 Ga0070689_100041365 3300005340 Bacteria 3538
23 Ga0070689_100480897 3300005340 Bacteria 1061
24 Ga0070687_100001141 3300005343 Bacteria 9173
25 Ga0070661_100319688 3300005344 Bacteria 1212
26 Ga0070675_100000006 3300005354 Bacteria 280013
27 Ga0070675_100000257 3300005354 Bacteria 34796
28 Ga0070675_100001017 3300005354 Bacteria 20149
29 Ga0070675_100005304 3300005354 Bacteria 9846
30 Ga0070675_100010033 3300005354 Bacteria 7385
31 Ga0070671_100229700 3300005355 Bacteria 1574
32 Ga0070673_100005931 3300005364 Bacteria 7894
33 Ga0070673_100448236 3300005364 Bacteria 1161
34 Ga0070688_100030709 3300005365 Bacteria 3227
35 Ga0070688_100247042 3300005365 Bacteria 1269
36 Ga0070667_100007436 3300005367 Bacteria 9096
37 Ga0070714_100096978 3300005435 Bacteria 2591
38 Ga0070714_100287052 3300005435 Bacteria 1530
39 Ga0070713_100369278 3300005436 Bacteria 1335
40 Ga0070713_100570992 3300005436 Bacteria 1072
41 Ga0070710_10047219 3300005437 Bacteria 2401
42 Ga0070701_10000531 3300005438 Bacteria 13163
43 Ga0070711_100182890 3300005439 Bacteria 1606
44 Ga0070711_100348171 3300005439 Bacteria 1191
45 Ga0070700_100000029 3300005441 Bacteria 120127
46 Ga0070708_100001004 3300005445 Bacteria 21553
47 Ga0070708_100034242 3300005445 Bacteria 4417
48 Ga0070708_100498572 3300005445 Bacteria 1149
49 Ga0070681_10211334 3300005458 Bacteria 1856
50 Ga0068867_100244217 3300005459 Bacteria 1457
51 Ga0070685_10037535 3300005466 Bacteria 2744
52 Ga0070685_10063049 3300005466 Bacteria 2175
53 Ga0070706_100000884 3300005467 Bacteria 32815
54 Ga0070706_100031430 3300005467 Bacteria 4895
55 Ga0070706_100048775 3300005467 Bacteria 3908
56 Ga0070706_100077855 3300005467 Bacteria 3069
57 Ga0070706_100254335 3300005467 Bacteria 1640
58 Ga0070706_100310668 3300005467 Bacteria 1470
59 Ga0070707_100001342 3300005468 Bacteria 24199
60 Ga0070707_100018893 3300005468 Bacteria 6491
61 Ga0070698_100000729 3300005471 Bacteria 35340
62 Ga0070698_100027655 3300005471 Bacteria 5896
63 Ga0070698_100289928 3300005471 Bacteria 1568
64 Ga0070698_100379807 3300005471 Bacteria 1345
65 Ga0070699_100098473 3300005518 Bacteria 2562
66 Ga0070699_100399837 3300005518 Bacteria 1242
67 Ga0070699_100478197 3300005518 Bacteria 1130
68 Ga0070679_100236257 3300005530 Bacteria 1786
69 Ga0070684_100000580 3300005535 Bacteria 25370
70 Ga0070684_100099510 3300005535 Bacteria 2595
71 Ga0070697_100028837 3300005536 Bacteria 4447
72 Ga0070697_100084550 3300005536 Bacteria 2617
73 Ga0070697_100120952 3300005536 Bacteria 2190
74 Ga0068853_100095207 3300005539 Bacteria 2625
75 Ga0070672_100000854 3300005543 Bacteria 18220
76 Ga0070672_100046014 3300005543 Bacteria 3379
77 Ga0070672_100143554 3300005543 Bacteria 1971
78 Ga0070686_100195185 3300005544 Bacteria 1447
79 Ga0070696_100257393 3300005546 Bacteria 1322
80 Ga0070665_100045058 3300005548 Bacteria 4428
81 Ga0070665_101028387 3300005548 Bacteria 836
82 Ga0070664_100051220 3300005564 Bacteria 3496
83 Ga0068857_100474587 3300005577 Bacteria 1172
84 Ga0068857_100826268 3300005577 Bacteria 886
85 Ga0068854_100034988 3300005578 Bacteria 3514
86 Ga0068854_100041828 3300005578 Bacteria 3240
87 Ga0070702_100222315 3300005615 Bacteria 1263
88 Ga0070702_100248252 3300005615 Bacteria 1205
89 Ga0070702_100401589 3300005615 Bacteria 981
90 Ga0068859_100000008 3300005617 Bacteria 383750
91 Ga0068859_100004355 3300005617 Bacteria 14445
92 Ga0068859_100056544 3300005617 Bacteria 3949
93 Ga0068859_100450690 3300005617 Bacteria 1383
94 Ga0068864_100000081 3300005618 Bacteria 101891
95 Ga0068864_100059167 3300005618 Bacteria 3315
96 Ga0068861_100132441 3300005719 Bacteria 2025
97 Ga0068870_10055825 3300005840 Bacteria 2106
98 Ga0068863_100000919 3300005841 Bacteria 29507
99 Ga0068863_100140274 3300005841 Bacteria 2310
100 Ga0068858_100001392 3300005842 Bacteria 24887
101 Ga0068858_100004426 3300005842 Bacteria 13781
102 Ga0068860_100001645 3300005843 Bacteria 23932
103 Ga0070717_10000080 3300006028 Bacteria 79214
104 Ga0070717_10067386 3300006028 Bacteria 2978
105 Ga0075365_10006920 3300006038 Bacteria 6297
106 Ga0075368_10003221 3300006042 Bacteria 5428
107 Ga0075363_100002405 3300006048 Bacteria 7638
108 Ga0070716_100057413 3300006173 Bacteria 2237
109 Ga0075362_10003092 3300006177 Bacteria 5737
110 Ga0075369_10128395 3300006186 Bacteria 1151
111 Ga0075366_10136681 3300006195 Bacteria 1480
112 Ga0097621_100005800 3300006237 Bacteria 8722
113 Ga0097621_100128961 3300006237 Bacteria 2151
114 Ga0068871_100070796 3300006358 Bacteria 2867
115 Ga0075428_100001089 3300006844 Bacteria 28925
116 Ga0075431_100005340 3300006847 Bacteria 12676
117 Ga0075434_100228779 3300006871 Bacteria 1879
118 Ga0075434_100722727 3300006871 Bacteria 1013
119 Ga0068865_100156405 3300006881 Bacteria 1734
120 Ga0075436_100055397 3300006914 Bacteria 2738
121 Ga0075436_100079010 3300006914 Bacteria 2279
122 Ga0097620_100000008 3300006931 Bacteria 383750
123 Ga0097620_100004355 3300006931 Bacteria 14445
124 Ga0097620_100056544 3300006931 Bacteria 3949
125 Ga0097620_100450660 3300006931 Bacteria 1383
126 Ga0075435_100000963 3300007076 Bacteria 18178
127 Ga0075435_100009426 3300007076 Bacteria 7068
128 Ga0105244_10021594 3300009036 Bacteria 3559
129 Ga0105240_10008371 3300009093 Bacteria 14801
130 Ga0111539_10000026 3300009094 Bacteria 185695
131 Ga0111539_10040252 3300009094 Bacteria 5627
132 Ga0111539_10744247 3300009094 Bacteria 1141
133 Ga0105245_10000004 3300009098 Bacteria 470684
134 Ga0105245_10001940 3300009098 Bacteria 18798
135 Ga0105245_10616994 3300009098 Bacteria 1112
136 Ga0105247_10113933 3300009101 Bacteria 1744
137 Ga0114129_11098496 3300009147 Bacteria 996
138 Ga0105243_10005918 3300009148 Bacteria 9473
139 Ga0105241_10455143 3300009174 Bacteria 1133
140 Ga0105242_10001451 3300009176 Bacteria 18665
141 Ga0105242_10230905 3300009176 Bacteria 1658
142 Ga0105242_10753626 3300009176 Bacteria 959
143 Ga0105248_10000718 3300009177 Bacteria 37517
144 Ga0105248_10038707 3300009177 Bacteria 5338
145 Ga0105248_10094153 3300009177 Bacteria 3373
146 Ga0105248_10203272 3300009177 Bacteria 2232
147 Ga0105238_10000001 3300009551 Bacteria 2036163
148 Ga0105238_10770943 3300009551 Bacteria 976
149 Ga0105249_10441003 3300009553 Bacteria 1339
150 Ga0105239_10139710 3300010375 Bacteria 2699
151 Ga0105239_10250591 3300010375 Bacteria 1989
152 Ga0157369_10001254 3300013105 Bacteria 31570
153 Ga0157369_10297545 3300013105 Bacteria 1679
154 Ga0157369_10792415 3300013105 Bacteria 974
155 Ga0157374_10000005 3300013296 Bacteria 646767
156 Ga0157374_10000449 3300013296 Bacteria 37461
157 Ga0157374_10045509 3300013296 Bacteria 4062
158 Ga0157378_10000897 3300013297 Bacteria 27435
159 Ga0157378_10000900 3300013297 Bacteria 27390
160 Ga0157378_10014654 3300013297 Bacteria 6866
161 Ga0157378_10094007 3300013297 Bacteria 2730
162 Ga0163162_10009925 3300013306 Bacteria 9261
163 Ga0163162_10090203 3300013306 Bacteria 3146
164 Ga0163162_10247951 3300013306 Bacteria 1913
165 Ga0157375_10000002 3300013308 Bacteria 495826
166 Ga0157375_10000299 3300013308 Bacteria 44874
167 Ga0157375_10000892 3300013308 Bacteria 25914
168 Ga0157375_10004053 3300013308 Bacteria 12708
169 Ga0157375_11011933 3300013308 Bacteria 970
170 Ga0163163_10053914 3300014325 Bacteria 3971
171 Ga0163163_10457997 3300014325 Bacteria 1336
172 Ga0157380_10016502 3300014326 Bacteria 5447
173 Ga0157380_10062863 3300014326 Bacteria 2975
174 Ga0157377_10000001 3300014745 Bacteria 623098
175 Ga0157377_10005113 3300014745 Bacteria 6130
176 Ga0157377_10097762 3300014745 Bacteria 1744
177 Ga0157379_10000599 3300014968 Bacteria 29080
178 Ga0157376_10000056 3300014969 Bacteria 98069
179 Ga0157376_10032584 3300014969 Bacteria 4185
180 Ga0157376_10271138 3300014969 Bacteria 1594
181 Ga0206356_11660814 3300020070 Bacteria 1716
182 Ga0206354_10974830 3300020081 Bacteria 1603
183 Ga0213873_10000003 3300021358 Bacteria 973849
184 Ga0213873_10003884 3300021358 Bacteria 2739
185 Ga0213876_10000003 3300021384 Bacteria 973849
186 Ga0213876_10000040 3300021384 Bacteria 171137
187 Ga0213876_10004025 3300021384 Bacteria 8267
188 Ga0213876_10291905 3300021384 Bacteria 866
189 Ga0209566_100072 3300025225 Bacteria 167764
190 Ga0209257_1022594 3300025304 Bacteria 2238
191 Ga0207692_10111325 3300025898 Bacteria 1519
192 Ga0207692_10154380 3300025898 Bacteria 1317
193 Ga0207710_10085180 3300025900 Bacteria 1471
194 Ga0207680_10042605 3300025903 Bacteria 2657
195 Ga0207699_10043010 3300025906 Bacteria 2622
196 Ga0207645_10156845 3300025907 Bacteria 1487
197 Ga0207643_10063667 3300025908 Bacteria 2109
198 Ga0207705_10138442 3300025909 Bacteria 1816
199 Ga0207684_10002025 3300025910 Bacteria 20870
200 Ga0207684_10012820 3300025910 Bacteria 7263
201 Ga0207684_10047440 3300025910 Bacteria 3643
202 Ga0207684_10236797 3300025910 Bacteria 1575
203 Ga0207707_10101080 3300025912 Bacteria 2520
204 Ga0207695_10003790 3300025913 Bacteria 20981
205 Ga0207693_10150175 3300025915 Bacteria 1832
206 Ga0207660_10003065 3300025917 Bacteria 10927
207 Ga0207660_10095825 3300025917 Bacteria 2208
208 Ga0207646_10005683 3300025922 Bacteria 13080
209 Ga0207646_10064139 3300025922 Bacteria 3279
210 Ga0207646_10155191 3300025922 Bacteria 2064
211 Ga0207646_10199799 3300025922 Bacteria 1806
212 Ga0207681_10250055 3300025923 Bacteria 1384
213 Ga0207681_10493724 3300025923 Bacteria 1001
214 Ga0207694_10000001 3300025924 Bacteria 4078485
215 Ga0207650_10000049 3300025925 Bacteria 171240
216 Ga0207650_10016366 3300025925 Bacteria 5183
217 Ga0207650_10456205 3300025925 Bacteria 1064
218 Ga0207659_10000008 3300025926 Bacteria 321286
219 Ga0207659_10003427 3300025926 Bacteria 9507
220 Ga0207659_10004154 3300025926 Bacteria 8740
221 Ga0207659_10031569 3300025926 Bacteria 3628
222 Ga0207659_10091642 3300025926 Bacteria 2271
223 Ga0207687_10000003 3300025927 Bacteria 875159
224 Ga0207687_10001126 3300025927 Bacteria 18190
225 Ga0207687_10076070 3300025927 Bacteria 2410
226 Ga0207687_10624048 3300025927 Bacteria 910
227 Ga0207700_10028629 3300025928 Bacteria 3920
228 Ga0207700_10310043 3300025928 Bacteria 1365
229 Ga0207644_10069978 3300025931 Bacteria 2563
230 Ga0207644_10090440 3300025931 Bacteria 2281
231 Ga0207690_10295446 3300025932 Bacteria 1266
232 Ga0207706_10053788 3300025933 Bacteria 3553
233 Ga0207686_10001379 3300025934 Bacteria 13783
234 Ga0207709_10210280 3300025935 Bacteria 1396
235 Ga0207670_10022853 3300025936 Bacteria 3883
236 Ga0207704_10061711 3300025938 Bacteria 2327
237 Ga0207665_10077228 3300025939 Bacteria 2285
238 Ga0207665_10122466 3300025939 Bacteria 1839
239 Ga0207691_10003094 3300025940 Bacteria 16237
240 Ga0207691_10166755 3300025940 Bacteria 1930
241 Ga0207711_10003430 3300025941 Bacteria 13710
242 Ga0207711_10062922 3300025941 Bacteria 3202
243 Ga0207689_10007667 3300025942 Bacteria 9453
244 Ga0207689_10061078 3300025942 Bacteria 3099
245 Ga0207661_10000001 3300025944 Bacteria 937688
246 Ga0207679_10036124 3300025945 Bacteria 3502
247 Ga0207651_10001146 3300025960 Bacteria 11840
248 Ga0207712_10226120 3300025961 Bacteria 1499
249 Ga0207640_10000614 3300025981 Bacteria 21017
250 Ga0207640_10023139 3300025981 Bacteria 3731
251 Ga0207658_10094638 3300025986 Bacteria 2325
252 Ga0207677_10000005 3300026023 Bacteria 287656
253 Ga0207677_10000480 3300026023 Bacteria 26102
254 Ga0207703_10000165 3300026035 Bacteria 76881
255 Ga0207703_10005334 3300026035 Bacteria 10358
256 Ga0207703_10538092 3300026035 Bacteria 1100
257 Ga0207639_10000006 3300026041 Bacteria 544415
258 Ga0207708_10000013 3300026075 Bacteria 203802
259 Ga0207641_10000798 3300026088 Bacteria 33681
260 Ga0207641_10013115 3300026088 Bacteria 6796
261 Ga0207641_10127045 3300026088 Bacteria 2284
262 Ga0207641_10134830 3300026088 Bacteria 2221
263 Ga0207648_10006916 3300026089 Bacteria 11241
264 Ga0207648_10057100 3300026089 Bacteria 3406
265 Ga0207676_10000020 3300026095 Bacteria 301541
266 Ga0207676_10048936 3300026095 Bacteria 3285
267 Ga0207676_10161837 3300026095 Bacteria 1940
268 Ga0207674_10039153 3300026116 Bacteria 4916
269 Ga0207674_10074689 3300026116 Bacteria 3401
270 Ga0207674_10556136 3300026116 Bacteria 1108
271 Ga0207675_100045664 3300026118 Bacteria 4093
272 Ga0207675_100084907 3300026118 Bacteria 2971
273 Ga0207683_10099119 3300026121 Bacteria 2600
274 Ga0207683_10132434 3300026121 Bacteria 2243
275 Ga0207428_10000031 3300027907 Bacteria 235245
276 Ga0268266_10032253 3300028379 Bacteria 4452
277 Ga0268264_10002050 3300028381 Bacteria 17980
278 Ga0265337_1001073 3300028556 Bacteria 14098
279 Ga0265326_10004042 3300028558 Bacteria 4740
280 Ga0265319_1007215 3300028563 Bacteria 5031
281 Ga0265334_10000083 3300028573 Bacteria 67832
282 Ga0265318_10068816 3300028577 Bacteria 1313
283 Ga0265338_10000358 3300028800 Bacteria 82643
284 Ga0265338_10012580 3300028800 Bacteria 9640
285 Ga0265338_10349094 3300028800 Bacteria 1064
286 Ga0265324_10011352 3300029957 Bacteria 3395
287 Ga0307511_10000816 3300030521 Bacteria 33250
288 Ga0265330_10000006 3300031235 Bacteria 215296
289 Ga0265332_10000057 3300031238 Bacteria 102893
290 Ga0265332_10009924 3300031238 Bacteria 4241
291 Ga0265328_10021211 3300031239 Bacteria 2482
292 Ga0265320_10011121 3300031240 Bacteria 5312
293 Ga0265325_10008753 3300031241 Bacteria 5952
294 Ga0265325_10020018 3300031241 Bacteria 3693
295 Ga0265329_10005384 3300031242 Bacteria 5177
296 Ga0265340_10017035 3300031247 Bacteria 3758
297 Ga0265339_10065111 3300031249 Bacteria 1954
298 Ga0265327_10050816 3300031251 Bacteria 2167
299 Ga0265316_10000023 3300031344 Bacteria 172893
300 Ga0265316_10014377 3300031344 Bacteria 6970
301 Ga0265316_10229365 3300031344 Bacteria 1368
302 Ga0265316_10262261 3300031344 Bacteria 1267
303 Ga0307408_100770149 3300031548 Bacteria 871
304 Ga0265313_10005834 3300031595 Bacteria 8939
305 Ga0265314_10000019 3300031711 Bacteria 326248
306 Ga0265342_10000010 3300031712 Bacteria 210877
307 Ga0265342_10005834 3300031712 Bacteria 9299
308 Ga0307410_10593868 3300031852 Bacteria 923
309 Ga0307414_10000382 3300032004 Bacteria 24148
310 Ga0373934_0055621 3300035086 Bacteria 1573
311 Ga0373932_0000259 3300035112 Bacteria 16073
312 Ga0373960_0047295 3300035121 Bacteria 1265
313 Ga0373955_0116803 3300035172 Bacteria 1547
314 Ga0373931_0128580 3300035691 Bacteria 1455
315 Ga0373925_0000004 3300037068 Bacteria 361597
316 Ga0395898_0025151 3300037466 Bacteria 6004
317 Ga0395905_0057140 3300037471 Bacteria 3650
318 Ga0436364_1113131 3300037853 Bacteria 1452
319 Ga0436365_1042279 3300039437 Bacteria 224225
320 Ga0436365_1148388 3300039437 Bacteria 1147
321 Ga0436365_1171278 3300039437 Bacteria 105378
322 Ga0436365_1342429 3300039437 Bacteria 13454
323 Ga0436362_0263779 3300039453 Bacteria 319094
324 Ga0436362_0477835 3300039453 Bacteria 6630
325 Ga0451577_0035899 3300042876 Bacteria 4464
326 Ga0451577_0046321 3300042876 Bacteria 3891
327 Ga0451577_0171354 3300042876 Bacteria 1956
328 Ga0453683_0053165 3300044673 Bacteria 2535
329 Ga0466963_0046957 3300044694 Bacteria 2849
330 Ga0453684_0001779 3300044712 Bacteria 57517
331 Ga0453684_0045025 3300044712 Bacteria 5891
332 Ga0453684_0705309 3300044712 Bacteria 1096
333 Ga0451576_0493840 3300045051 Bacteria 1286
334 Ga0451576_0681153 3300045051 Bacteria 1080
335 Ga0466967_0008843 3300045976 Bacteria 7424
336 Ga0495629_0058013 3300046459 Bacteria 2706
337 Ga0495641_0177687 3300046461 Bacteria 953
338 Ga0495580_0062701 3300046472 Bacteria 2607
339 Ga0495618_0047035 3300046514 Bacteria 2724
340 Ga0495620_0008225 3300046515 Bacteria 5610
341 Ga0495628_0020324 3300046516 Bacteria 5480
342 Ga0495628_0490823 3300046516 Bacteria 888
343 Ga0495586_0233852 3300046535 Bacteria 1046
344 Ga0495587_0338514 3300046536 Bacteria 839
345 Ga0495645_0196142 3300046543 Bacteria 1373
346 Ga0495635_0343633 3300046663 Bacteria 996
347 Ga0495646_0171632 3300046680 Bacteria 1195
348 Ga0495647_0039349 3300046681 Bacteria 1792
349 Ga0495658_0064704 3300046683 Bacteria 2107
350 Ga0495679_009184 3300047446 Bacteria 3975
351 Ga0496102_0189083 3300048905 Bacteria 1940
352 Ga0496104_0027229 3300048907 Bacteria 5290
353 Ga0496104_0078111 3300048907 Bacteria 3154
354 Ga0496105_0145127 3300048908 Bacteria 1952
355 Ga0496109_0006690 3300048912 Bacteria 9705
356 Ga0496109_0083161 3300048912 Bacteria 2952
357 Ga0496110_0087701 3300048913 Bacteria 2779
358 Ga0496110_0101936 3300048913 Bacteria 2573
359 Ga0496111_0062149 3300048914 Bacteria 2708
360 Ga0496112_0012852 3300048915 Bacteria 7707
361 Ga0496112_0477327 3300048915 Bacteria 1184
362 Ga0496113_0021550 3300048916 Bacteria 4547
363 Ga0496126_0177786 3300048929 Bacteria 1809
364 Ga0501033_0027628 3300049570 Bacteria 4266
365 Ga0501034_0026308 3300049571 Bacteria 5925
366 Ga0501034_0108722 3300049571 Bacteria 2764
367 Ga0501034_0211491 3300049571 Bacteria 1895
368 Ga0501038_0039542 3300049574 Bacteria 4125
369 Ga0501038_0149316 3300049574 Bacteria 1906
370 Ga0501039_0158309 3300049575 Bacteria 1780
371 Ga0501042_0127106 3300049578 Bacteria 1836
372 Ga0501069_0060570 3300049585 Bacteria 2113
373 Ga0501073_0012722 3300049589 Bacteria 6138
374 Ga0501079_0080664 3300049741 Bacteria 2516
375 Ga0501080_0058537 3300049742 Bacteria 3586
376 Ga0501035_0065507 3300049822 Bacteria 3226
377 Ga0501044_0013948 3300049823 Bacteria 8682
378 Ga0501044_0028208 3300049823 Bacteria 5925
379 nmdc:mga03683_1332_c1 3300050489 Bacteria 7311
380 nmdc:mga03n38_8009_c1 3300050490 Bacteria 3770
381 nmdc:mga00v17_7626_c1 3300050491 Bacteria 5786
382 nmdc:mga0yw44_10267_c1 3300050492 Bacteria 4776
383 nmdc:mga0k408_32769_c1 3300050493 Bacteria 2969
384 nmdc:mga06z11_16406_c1 3300050494 Bacteria 3336
385 nmdc:mga04h51_2254_c1 3300050495 Bacteria 4546
386 nmdc:mga05p37_827121_c1 3300050507 Bacteria 1009
387 nmdc:mga06r32_30355_c1 3300050510 Bacteria 5071
388 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
389 nmdc:mga08y16_63984_c1 3300050511 Bacteria 3841
390 nmdc:mga0n895_89420_c1 3300050512 Bacteria 3080
391 nmdc:mga0rr50_1705_c1 3300050513 Bacteria 12126
392 nmdc:mga0rr50_47876_c1 3300050513 Bacteria 3157
393 nmdc:mga0rr50_548_c1 3300050513 Bacteria 20160
394 nmdc:mga08x19_166583_c1 3300050514 Bacteria 1499
395 nmdc:mga08x19_22025_c1 3300050514 Bacteria 3942
396 nmdc:mga08x19_464_c1 3300050514 Bacteria 27378
397 Ga0495601_0090870 3300053077 Bacteria 1965
398 Ga0495612_0260656 3300053078 Bacteria 772
399 Ga0495655_0000319 3300053083 Bacteria 8521
400 Ga0500643_000592 3300053087 Bacteria 24859
401 2804849578 2802429296 Bacteria 7227771
402 2904557613 2904555929 Bacteria 5218588
403 2954721122 2954711539 Bacteria 10867210
404 2954730672 2954721474 Bacteria 10456478
405 2954731365 2954731030 Bacteria 10243860
406 2954749379 2954740390 Bacteria 10229294
407 2954750079 2954749733 Bacteria 10366972
408 Ga0496126_0021158
409 Ga0065714_10098615
410 Ga0065712_10000232
411 Ga0065715_10000187
412 Ga0065715_10022993
413 Ga0070683_100000029
414 Ga0070683_100292416
415 Ga0070670_100000056
416 Ga0070670_100034356
417 Ga0070670_100327422
418 Ga0070677_10018480
419 Ga0068869_100035961
420 Ga0068869_100048120
421 Ga0070666_10028311
422 Ga0070666_10098725
423 Ga0070680_100005328
424 Ga0070682_100000024
425 Ga0070682_100436901
426 Ga0068868_100000713
427 Ga0068868_100001907
428 Ga0070689_100000773
429 Ga0070689_100041365
430 Ga0070689_100480897
431 Ga0070687_100001141
432 Ga0070661_100319688
433 Ga0070675_100000006
434 Ga0070675_100000257
435 Ga0070675_100001017
436 Ga0070675_100005304
437 Ga0070675_100010033
438 Ga0070671_100229700
439 Ga0070673_100005931
440 Ga0070673_100448236
441 Ga0070688_100030709
442 Ga0070688_100247042
443 Ga0070667_100007436
444 Ga0070714_100096978
445 Ga0070714_100287052
446 Ga0070713_100369278
447 Ga0070713_100570992
448 Ga0070710_10047219
449 Ga0070701_10000531
450 Ga0070711_100182890
451 Ga0070711_100348171
452 Ga0070700_100000029
453 Ga0070708_100001004
454 Ga0070708_100034242
455 Ga0070708_100498572
456 Ga0070681_10211334
457 Ga0068867_100244217
458 Ga0070685_10037535
459 Ga0070685_10063049
460 Ga0070706_100000884
461 Ga0070706_100031430
462 Ga0070706_100048775
463 Ga0070706_100077855
464 Ga0070706_100254335
465 Ga0070706_100310668
466 Ga0070707_100001342
467 Ga0070707_100018893
468 Ga0070698_100000729
469 Ga0070698_100027655
470 Ga0070698_100289928
471 Ga0070698_100379807
472 Ga0070699_100098473
473 Ga0070699_100399837
474 Ga0070699_100478197
475 Ga0070679_100236257
476 Ga0070684_100000580
477 Ga0070684_100099510
478 Ga0070697_100028837
479 Ga0070697_100084550
480 Ga0070697_100120952
481 Ga0068853_100095207
482 Ga0070672_100000854
483 Ga0070672_100046014
484 Ga0070672_100143554
485 Ga0070686_100195185
486 Ga0070696_100257393
487 Ga0070665_100045058
488 Ga0070665_101028387
489 Ga0070664_100051220
490 Ga0068857_100474587
491 Ga0068857_100826268
492 Ga0068854_100034988
493 Ga0068854_100041828
494 Ga0070702_100222315
495 Ga0070702_100248252
496 Ga0070702_100401589
497 Ga0068859_100000008
498 Ga0068859_100004355
499 Ga0068859_100056544
500 Ga0068859_100450690
501 Ga0068864_100000081
502 Ga0068864_100059167
503 Ga0068861_100132441
504 Ga0068870_10055825
505 Ga0068863_100000919
506 Ga0068863_100140274
507 Ga0068858_100001392
508 Ga0068858_100004426
509 Ga0068860_100001645
510 Ga0070717_10000080
511 Ga0070717_10067386
512 Ga0075365_10006920
513 Ga0075368_10003221
514 Ga0075363_100002405
515 Ga0070716_100057413
516 Ga0075362_10003092
517 Ga0075369_10128395
518 Ga0075366_10136681
519 Ga0097621_100005800
520 Ga0097621_100128961
521 Ga0068871_100070796
522 Ga0075428_100001089
523 Ga0075431_100005340
524 Ga0075434_100228779
525 Ga0075434_100722727
526 Ga0068865_100156405
527 Ga0075436_100055397
528 Ga0075436_100079010
529 Ga0097620_100000008
530 Ga0097620_100004355
531 Ga0097620_100056544
532 Ga0097620_100450660
533 Ga0075435_100000963
534 Ga0075435_100009426
535 Ga0105244_10021594
536 Ga0105240_10008371
537 Ga0111539_10000026
538 Ga0111539_10040252
539 Ga0111539_10744247
540 Ga0105245_10000004
541 Ga0105245_10001940
542 Ga0105245_10616994
543 Ga0105247_10113933
544 Ga0114129_11098496
545 Ga0105243_10005918
546 Ga0105241_10455143
547 Ga0105242_10001451
548 Ga0105242_10230905
549 Ga0105242_10753626
550 Ga0105248_10000718
551 Ga0105248_10038707
552 Ga0105248_10094153
553 Ga0105248_10203272
554 Ga0105238_10000001
555 Ga0105238_10770943
556 Ga0105249_10441003
557 Ga0105239_10139710
558 Ga0105239_10250591
559 Ga0157369_10001254
560 Ga0157369_10297545
561 Ga0157369_10792415
562 Ga0157374_10000005
563 Ga0157374_10000449
564 Ga0157374_10045509
565 Ga0157378_10000897
566 Ga0157378_10000900
567 Ga0157378_10014654
568 Ga0157378_10094007
569 Ga0163162_10009925
570 Ga0163162_10090203
571 Ga0163162_10247951
572 Ga0157375_10000002
573 Ga0157375_10000299
574 Ga0157375_10000892
575 Ga0157375_10004053
576 Ga0157375_11011933
577 Ga0163163_10053914
578 Ga0163163_10457997
579 Ga0157380_10016502
580 Ga0157380_10062863
581 Ga0157377_10000001
582 Ga0157377_10005113
583 Ga0157377_10097762
584 Ga0157379_10000599
585 Ga0157376_10000056
586 Ga0157376_10032584
587 Ga0157376_10271138
588 Ga0206356_11660814
589 Ga0206354_10974830
590 Ga0213873_10000003
591 Ga0213873_10003884
592 Ga0213876_10000003
593 Ga0213876_10000040
594 Ga0213876_10004025
595 Ga0213876_10291905
596 Ga0209566_100072
597 Ga0209257_1022594
598 Ga0207692_10111325
599 Ga0207692_10154380
600 Ga0207710_10085180
601 Ga0207680_10042605
602 Ga0207699_10043010
603 Ga0207645_10156845
604 Ga0207643_10063667
605 Ga0207705_10138442
606 Ga0207684_10002025
607 Ga0207684_10012820
608 Ga0207684_10047440
609 Ga0207684_10236797
610 Ga0207707_10101080
611 Ga0207695_10003790
612 Ga0207693_10150175
613 Ga0207660_10003065
614 Ga0207660_10095825
615 Ga0207646_10005683
616 Ga0207646_10064139
617 Ga0207646_10155191
618 Ga0207646_10199799
619 Ga0207681_10250055
620 Ga0207681_10493724
621 Ga0207694_10000001
622 Ga0207650_10000049
623 Ga0207650_10016366
624 Ga0207650_10456205
625 Ga0207659_10000008
626 Ga0207659_10003427
627 Ga0207659_10004154
628 Ga0207659_10031569
629 Ga0207659_10091642
630 Ga0207687_10000003
631 Ga0207687_10001126
632 Ga0207687_10076070
633 Ga0207687_10624048
634 Ga0207700_10028629
635 Ga0207700_10310043
636 Ga0207644_10069978
637 Ga0207644_10090440
638 Ga0207690_10295446
639 Ga0207706_10053788
640 Ga0207686_10001379
641 Ga0207709_10210280
642 Ga0207670_10022853
643 Ga0207704_10061711
644 Ga0207665_10077228
645 Ga0207665_10122466
646 Ga0207691_10003094
647 Ga0207691_10166755
648 Ga0207711_10003430
649 Ga0207711_10062922
650 Ga0207689_10007667
651 Ga0207689_10061078
652 Ga0207661_10000001
653 Ga0207679_10036124
654 Ga0207651_10001146
655 Ga0207712_10226120
656 Ga0207640_10000614
657 Ga0207640_10023139
658 Ga0207658_10094638
659 Ga0207677_10000005
660 Ga0207677_10000480
661 Ga0207703_10000165
662 Ga0207703_10005334
663 Ga0207703_10538092
664 Ga0207639_10000006
665 Ga0207708_10000013
666 Ga0207641_10000798
667 Ga0207641_10013115
668 Ga0207641_10127045
669 Ga0207641_10134830
670 Ga0207648_10006916
671 Ga0207648_10057100
672 Ga0207676_10000020
673 Ga0207676_10048936
674 Ga0207676_10161837
675 Ga0207674_10039153
676 Ga0207674_10074689
677 Ga0207674_10556136
678 Ga0207675_100045664
679 Ga0207675_100084907
680 Ga0207683_10099119
681 Ga0207683_10132434
682 Ga0207428_10000031
683 Ga0268266_10032253
684 Ga0268264_10002050
685 Ga0265337_1001073
686 Ga0265326_10004042
687 Ga0265319_1007215
688 Ga0265334_10000083
689 Ga0265318_10068816
690 Ga0265338_10000358
691 Ga0265338_10012580
692 Ga0265338_10349094
693 Ga0265324_10011352
694 Ga0307511_10000816
695 Ga0265330_10000006
696 Ga0265332_10000057
697 Ga0265332_10009924
698 Ga0265328_10021211
699 Ga0265320_10011121
700 Ga0265325_10008753
701 Ga0265325_10020018
702 Ga0265329_10005384
703 Ga0265340_10017035
704 Ga0265339_10065111
705 Ga0265327_10050816
706 Ga0265316_10000023
707 Ga0265316_10014377
708 Ga0265316_10229365
709 Ga0265316_10262261
710 Ga0307408_100770149
711 Ga0265313_10005834
712 Ga0265314_10000019
713 Ga0265342_10000010
714 Ga0265342_10005834
715 Ga0307410_10593868
716 Ga0307414_10000382
717 Ga0373934_0055621
718 Ga0373932_0000259
719 Ga0373960_0047295
720 Ga0373955_0116803
721 Ga0373931_0128580
722 Ga0373925_0000004
723 Ga0395898_0025151
724 Ga0395905_0057140
725 Ga0436364_1113131
726 Ga0436365_1042279
727 Ga0436365_1148388
728 Ga0436365_1171278
729 Ga0436365_1342429
730 Ga0436362_0263779
731 Ga0436362_0477835
732 Ga0451577_0035899
733 Ga0451577_0046321
734 Ga0451577_0171354
735 Ga0453683_0053165
736 Ga0466963_0046957
737 Ga0453684_0001779
738 Ga0453684_0045025
739 Ga0453684_0705309
740 Ga0451576_0493840
741 Ga0451576_0681153
742 Ga0466967_0008843
743 Ga0495629_0058013
744 Ga0495641_0177687
745 Ga0495580_0062701
746 Ga0495618_0047035
747 Ga0495620_0008225
748 Ga0495628_0020324
749 Ga0495628_0490823
750 Ga0495586_0233852
751 Ga0495587_0338514
752 Ga0495645_0196142
753 Ga0495635_0343633
754 Ga0495646_0171632
755 Ga0495647_0039349
756 Ga0495658_0064704
757 Ga0495679_009184
758 Ga0496102_0189083
759 Ga0496104_0027229
760 Ga0496104_0078111
761 Ga0496105_0145127
762 Ga0496109_0006690
763 Ga0496109_0083161
764 Ga0496110_0087701
765 Ga0496110_0101936
766 Ga0496111_0062149
767 Ga0496112_0012852
768 Ga0496112_0477327
769 Ga0496113_0021550
770 Ga0496126_0177786
771 Ga0501033_0027628
772 Ga0501034_0026308
773 Ga0501034_0108722
774 Ga0501034_0211491
775 Ga0501038_0039542
776 Ga0501038_0149316
777 Ga0501039_0158309
778 Ga0501042_0127106
779 Ga0501069_0060570
780 Ga0501073_0012722
781 Ga0501079_0080664
782 Ga0501080_0058537
783 Ga0501035_0065507
784 Ga0501044_0013948
785 Ga0501044_0028208
786 nmdc:mga03683_1332_c1
787 nmdc:mga03n38_8009_c1
788 nmdc:mga00v17_7626_c1
789 nmdc:mga0yw44_10267_c1
790 nmdc:mga0k408_32769_c1
791 nmdc:mga06z11_16406_c1
792 nmdc:mga04h51_2254_c1
793 nmdc:mga05p37_827121_c1
794 nmdc:mga06r32_30355_c1
795 nmdc:mga08y16_22_c1
796 nmdc:mga08y16_63984_c1
797 nmdc:mga0n895_89420_c1
798 nmdc:mga0rr50_1705_c1
799 nmdc:mga0rr50_47876_c1
800 nmdc:mga0rr50_548_c1
801 nmdc:mga08x19_166583_c1
802 nmdc:mga08x19_22025_c1
803 nmdc:mga08x19_464_c1
804 Ga0495601_0090870
805 Ga0495612_0260656
806 Ga0495655_0000319
807 Ga0500643_000592
808 2804849578
809 2904557613
810 2954721122
811 2954730672
812 2954731365
813 2954749379
814 2954750079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

15

244

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.9768 3 214
3dlx-assembly2.cif.gz_C crystal structure of human 3-oxoacid coa transferase 1 0.975 3 224
3oxo-assembly1.cif.gz_A succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9746 3 224
3oxo-assembly4.cif.gz_G succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9744 3 224
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9744 3 224
ID Description Score Start End Superfamily
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9737 1 214 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9694 3 216 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9605 1 214 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9486 1 229 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9452 4 230 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A8B4MR91-F1-model_v4 deleted 0.9919 144 216
AF-A0A090QIH1-F1-model_v4 Butyrate-acetoacetate CoA-transferase subunit A (EC 2.8.3.9) 0.9888 147 217 GO:0047371
AF-A0A660QQS8-F1-model_v4 Branched-chain amino acid dehydrogenase 0.9854 147 218 GO:0008410
AF-H3G7V1-F1-model_v4 Succinyl-CoA:3-ketoacid-coenzyme A transferase 0.9834 70 212 GO:0008410
AF-A0A448MT98-F1-model_v4 Acetate CoA-transferase subunit alpha (EC 2.8.3.8) 0.9833 20 217 GO:0008775

Map