F436538

General Info

Members Datasets Scaffolds Average Seq Length
407 209 814 232

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0069193|Ga0495652_0069193_1409_2218
Length 269
Sequence LLLTFNDFFSLSLGGLLSNGIGGHLGAAPALGNAIMQDKPRILVVDDEPQITRVLKASLGMHGYEIRTVNDGEAGLDAFDDWKPDLVITDLSMPKMTGIELCESIRNHSQVPIIVLSVRGEDNSKIAALDKGADDYVTKPFSINELLARIRANLRRASVGKEEESGEPIDIGDFHIDLQTRIVAIGERQVHLTPKEFDLLVYMARHPGKVISHRALLNAVWGGQSVQQPEYLRVFINQLRKKIEPGDPPRYILTDPWIGYRFQPAGNSL

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
81 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
82 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0069193 3300046529 Bacteria 2955
2 JGI25406J46586_10003411 3300003203 Bacteria 7477
3 Ga0058862_12879174 3300004803 Bacteria 1665
4 Ga0065712_10079463 3300005290 Bacteria 3214
5 Ga0070658_10008482 3300005327 Bacteria 8263
6 Ga0070683_101053243 3300005329 Bacteria 781
7 Ga0070670_100004658 3300005331 Bacteria 11508
8 Ga0068869_100013366 3300005334 Bacteria 5460
9 Ga0070680_100456563 3300005336 Bacteria 1091
10 Ga0070682_100330971 3300005337 Bacteria 1129
11 Ga0070660_100081889 3300005339 Bacteria 2534
12 Ga0070660_100223041 3300005339 Bacteria 1532
13 Ga0070660_100411699 3300005339 Bacteria 1119
14 Ga0070687_100149327 3300005343 Bacteria 1370
15 Ga0070661_100053994 3300005344 Viruses 2942
16 Ga0070671_100251968 3300005355 Bacteria 1500
17 Ga0070709_10000906 3300005434 Bacteria 16469
18 Ga0070709_10122619 3300005434 Bacteria 1764
19 Ga0070714_100001208 3300005435 Bacteria 18622
20 Ga0070713_100000389 3300005436 Bacteria 28173
21 Ga0070713_100010099 3300005436 Bacteria 6808
22 Ga0070713_100043723 3300005436 Bacteria 3664
23 Ga0070713_100062648 3300005436 Unclassified 3115
24 Ga0070713_100458771 3300005436 Bacteria 1198
25 Ga0070710_10001659 3300005437 Bacteria 10481
26 Ga0070710_10022068 3300005437 Bacteria 3326
27 Ga0070710_10078631 3300005437 Bacteria 1920
28 Ga0070710_10102030 3300005437 Bacteria 1710
29 Ga0070711_100103059 3300005439 Bacteria 2079
30 Ga0070711_100511637 3300005439 Bacteria 991
31 Ga0070711_100567307 3300005439 Bacteria 943
32 Ga0070708_100062039 3300005445 Unclassified 3341
33 Ga0070708_100075451 3300005445 Bacteria 3043
34 Ga0070708_100098706 3300005445 Bacteria 2671
35 Ga0070681_10044498 3300005458 Bacteria 4444
36 Ga0070681_10102444 3300005458 Bacteria 2808
37 Ga0070681_10187839 3300005458 Bacteria 1986
38 Ga0070681_10338788 3300005458 Bacteria 1413
39 Ga0070681_10502662 3300005458 Bacteria 1125
40 Ga0068867_100457204 3300005459 Bacteria 1089
41 Ga0070706_100029401 3300005467 Bacteria 5063
42 Ga0070706_100196984 3300005467 Bacteria 1882
43 Ga0070707_100226171 3300005468 Bacteria 1822
44 Ga0070707_100449131 3300005468 Bacteria 1250
45 Ga0070699_100157631 3300005518 Bacteria 2009
46 Ga0070699_100305476 3300005518 Bacteria 1428
47 Ga0070699_100327226 3300005518 Bacteria 1378
48 Ga0070699_100452132 3300005518 Bacteria 1165
49 Ga0070679_100322139 3300005530 Viruses 1495
50 Ga0070697_100038521 3300005536 Bacteria 3863
51 Ga0070697_100056705 3300005536 Bacteria 3187
52 Ga0070697_100117606 3300005536 Bacteria 2220
53 Ga0070697_100358666 3300005536 Bacteria 1260
54 Ga0070697_100517165 3300005536 Bacteria 1045
55 Ga0068853_100170073 3300005539 Bacteria 1971
56 Ga0070672_100342563 3300005543 Bacteria 1273
57 Ga0068855_100001865 3300005563 Bacteria 26200
58 Ga0068855_100026835 3300005563 Bacteria 6891
59 Ga0068855_100058429 3300005563 Bacteria 4517
60 Ga0068855_100186670 3300005563 Bacteria 2341
61 Ga0068855_100202563 3300005563 Unclassified 2234
62 Ga0068855_100221746 3300005563 Bacteria 2120
63 Ga0068855_100502855 3300005563 Bacteria 1317
64 Ga0068857_100107487 3300005577 Unclassified 2506
65 Ga0068857_100821579 3300005577 Bacteria 888
66 Ga0068854_100079376 3300005578 Bacteria 2419
67 Ga0068856_100008885 3300005614 Bacteria 9777
68 Ga0068856_100141720 3300005614 Bacteria 2411
69 Ga0068856_100183361 3300005614 Bacteria 2107
70 Ga0068856_100797716 3300005614 Bacteria 964
71 Ga0068856_101098148 3300005614 Bacteria 813
72 Ga0068852_100140840 3300005616 Unclassified 2232
73 Ga0068852_100265156 3300005616 Bacteria 1651
74 Ga0068852_100320097 3300005616 Unclassified 1506
75 Ga0068861_100561194 3300005719 Bacteria 1042
76 Ga0068851_10226226 3300005834 Bacteria 1053
77 Ga0068858_100101410 3300005842 Bacteria 2684
78 Ga0068860_100138925 3300005843 Bacteria 2334
79 Ga0081455_10226406 3300005937 Bacteria 1383
80 Ga0081540_1041782 3300005983 Bacteria 2373
81 Ga0081539_10000053 3300005985 Bacteria 264549
82 Ga0070717_10006718 3300006028 Bacteria 8483
83 Ga0070717_10040859 3300006028 Bacteria 3780
84 Ga0070717_10041817 3300006028 Bacteria 3737
85 Ga0070717_10043132 3300006028 Unclassified 3681
86 Ga0070717_10063811 3300006028 Unclassified 3059
87 Ga0070717_10174196 3300006028 Bacteria 1873
88 Ga0070717_10201163 3300006028 Bacteria 1745
89 Ga0070717_10213901 3300006028 Bacteria 1693
90 Ga0070717_10351191 3300006028 Bacteria 1318
91 Ga0070717_10428152 3300006028 Bacteria 1191
92 Ga0070717_10651358 3300006028 Bacteria 956
93 Ga0070715_10034792 3300006163 Unclassified 2068
94 Ga0070715_10171349 3300006163 Bacteria 1081
95 Ga0070716_100002778 3300006173 Bacteria 8133
96 Ga0070716_100064654 3300006173 Bacteria 2128
97 Ga0070712_100000206 3300006175 Bacteria 33238
98 Ga0070712_100010638 3300006175 Bacteria 5811
99 Ga0070712_100112795 3300006175 Bacteria 2032
100 Ga0075428_100043336 3300006844 Bacteria 4946
101 Ga0075428_100893800 3300006844 Bacteria 942
102 Ga0075430_100274422 3300006846 Bacteria 1395
103 Ga0075431_100056179 3300006847 Bacteria 4060
104 Ga0075431_100117061 3300006847 Bacteria 2750
105 Ga0075433_10000048 3300006852 Bacteria 50702
106 Ga0075433_10013283 3300006852 Bacteria 6691
107 Ga0075434_100000575 3300006871 Bacteria 28264
108 Ga0075434_100001629 3300006871 Bacteria 19106
109 Ga0075434_100749308 3300006871 Bacteria 994
110 Ga0075429_100350245 3300006880 Bacteria 1293
111 Ga0068865_100073518 3300006881 Bacteria 2431
112 Ga0075436_100041650 3300006914 Bacteria 3169
113 Ga0075435_100006929 3300007076 Bacteria 8043
114 Ga0075435_100021727 3300007076 Bacteria 4942
115 Ga0105240_10000532 3300009093 Bacteria 70311
116 Ga0105240_10001704 3300009093 Bacteria 37205
117 Ga0105240_10013422 3300009093 Bacteria 11250
118 Ga0105240_10081055 3300009093 Bacteria 3989
119 Ga0105240_10126776 3300009093 Bacteria 3066
120 Ga0105240_10383188 3300009093 Bacteria 1587
121 Ga0111539_10319609 3300009094 Bacteria 1807
122 Ga0105245_10000892 3300009098 Bacteria 27165
123 Ga0105245_10006772 3300009098 Bacteria 10047
124 Ga0105245_10007883 3300009098 Bacteria 9315
125 Ga0105245_10095726 3300009098 Bacteria 2739
126 Ga0114129_10160352 3300009147 Bacteria 3073
127 Ga0114129_10657056 3300009147 Bacteria 1352
128 Ga0105241_10147074 3300009174 Bacteria 1924
129 Ga0105241_10195567 3300009174 Bacteria 1686
130 Ga0105242_10157471 3300009176 Bacteria 1985
131 Ga0105242_10501616 3300009176 Bacteria 1154
132 Ga0105238_10011419 3300009551 Bacteria 8946
133 Ga0105238_10053009 3300009551 Bacteria 4077
134 Ga0105238_10109893 3300009551 Unclassified 2738
135 Ga0105238_10138275 3300009551 Bacteria 2413
136 Ga0105238_10324163 3300009551 Unclassified 1527
137 Ga0105249_10071492 3300009553 Bacteria 3205
138 Ga0105239_10233619 3300010375 Unclassified 2063
139 Ga0105246_10009793 3300011119 Bacteria 5909
140 Ga0157373_10077380 3300013100 Bacteria 2347
141 Ga0157373_10151213 3300013100 Bacteria 1633
142 Ga0157370_10003413 3300013104 Bacteria 18658
143 Ga0157370_10004899 3300013104 Bacteria 15174
144 Ga0157370_10052758 3300013104 Bacteria 3881
145 Ga0157370_10083233 3300013104 Bacteria 3009
146 Ga0157370_10443176 3300013104 Bacteria 1194
147 Ga0157369_10000876 3300013105 Bacteria 38431
148 Ga0157369_10019819 3300013105 Bacteria 7526
149 Ga0157369_10061704 3300013105 Bacteria 4040
150 Ga0157369_10076717 3300013105 Bacteria 3583
151 Ga0157369_10144026 3300013105 Bacteria 2520
152 Ga0157369_10184770 3300013105 Bacteria 2192
153 Ga0157374_10005838 3300013296 Bacteria 10400
154 Ga0157374_10007447 3300013296 Bacteria 9337
155 Ga0157374_10145197 3300013296 Viruses 2305
156 Ga0157374_10225751 3300013296 Bacteria 1839
157 Ga0157378_10002303 3300013297 Bacteria 16971
158 Ga0163162_10132724 3300013306 Bacteria 2599
159 Ga0163162_10267537 3300013306 Bacteria 1841
160 Ga0157372_10063905 3300013307 Bacteria 4129
161 Ga0157372_10302605 3300013307 Bacteria 1860
162 Ga0157372_10417308 3300013307 Bacteria 1564
163 Ga0157372_10584963 3300013307 Bacteria 1301
164 Ga0157375_10003270 3300013308 Bacteria 14058
165 Ga0163163_10069351 3300014325 Bacteria 3510
166 Ga0163163_10167630 3300014325 Bacteria 2243
167 Ga0157380_11134126 3300014326 Bacteria 822
168 Ga0157379_10570839 3300014968 Bacteria 1054
169 Ga0213873_10014508 3300021358 Bacteria 1747
170 Ga0213874_10008505 3300021377 Bacteria 2504
171 Ga0213876_10000017 3300021384 Bacteria 297728
172 Ga0213876_10000413 3300021384 Bacteria 35846
173 Ga0224712_10033578 3300022467 Unclassified 1879
174 Ga0224569_100001 3300022732 Bacteria 26447
175 Ga0224571_100001 3300022734 Bacteria 12516
176 Ga0228598_1000020 3300024227 Bacteria 22455
177 Ga0207692_10001123 3300025898 Bacteria 9851
178 Ga0207692_10047739 3300025898 Bacteria 2151
179 Ga0207692_10095694 3300025898 Bacteria 1620
180 Ga0207692_10206277 3300025898 Bacteria 1158
181 Ga0207685_10113752 3300025905 Bacteria 1177
182 Ga0207699_10008915 3300025906 Bacteria 4973
183 Ga0207699_10197250 3300025906 Bacteria 1362
184 Ga0207699_10335989 3300025906 Bacteria 1063
185 Ga0207705_10051577 3300025909 Bacteria 2961
186 Ga0207684_10010618 3300025910 Bacteria 8093
187 Ga0207684_10137003 3300025910 Bacteria 2102
188 Ga0207654_10156134 3300025911 Bacteria 1469
189 Ga0207654_10256570 3300025911 Bacteria 1174
190 Ga0207707_10220679 3300025912 Bacteria 1650
191 Ga0207707_10237606 3300025912 Bacteria 1585
192 Ga0207695_10002273 3300025913 Bacteria 28785
193 Ga0207695_10056306 3300025913 Bacteria 4092
194 Ga0207695_10072199 3300025913 Bacteria 3523
195 Ga0207695_10654071 3300025913 Bacteria 932
196 Ga0207693_10000284 3300025915 Bacteria 47232
197 Ga0207693_10004946 3300025915 Bacteria 11199
198 Ga0207693_10029720 3300025915 Bacteria 4313
199 Ga0207693_10030569 3300025915 Bacteria 4255
200 Ga0207663_10062262 3300025916 Bacteria 2371
201 Ga0207663_10240137 3300025916 Bacteria 1328
202 Ga0207663_10432261 3300025916 Bacteria 1012
203 Ga0207663_10440907 3300025916 Bacteria 1003
204 Ga0207660_10074900 3300025917 Bacteria 2471
205 Ga0207660_10441850 3300025917 Bacteria 1051
206 Ga0207662_10310399 3300025918 Bacteria 1051
207 Ga0207657_10046275 3300025919 Bacteria 3812
208 Ga0207657_10073125 3300025919 Unclassified 2898
209 Ga0207657_10173386 3300025919 Bacteria 1747
210 Ga0207649_10205979 3300025920 Bacteria 1392
211 Ga0207652_10351818 3300025921 Bacteria 1330
212 Ga0207646_10049499 3300025922 Bacteria 3764
213 Ga0207646_10251179 3300025922 Bacteria 1598
214 Ga0207646_10298173 3300025922 Bacteria 1456
215 Ga0207646_10375999 3300025922 Bacteria 1283
216 Ga0207646_10396735 3300025922 Bacteria 1246
217 Ga0207646_10633467 3300025922 Bacteria 958
218 Ga0207694_10019710 3300025924 Bacteria 5102
219 Ga0207694_10043779 3300025924 Bacteria 3455
220 Ga0207694_10133275 3300025924 Unclassified 1993
221 Ga0207694_10181666 3300025924 Bacteria 1706
222 Ga0207687_10001759 3300025927 Bacteria 14886
223 Ga0207687_10057809 3300025927 Bacteria 2726
224 Ga0207700_10001574 3300025928 Bacteria 12949
225 Ga0207700_10020929 3300025928 Bacteria 4454
226 Ga0207700_10043401 3300025928 Bacteria 3302
227 Ga0207700_10464981 3300025928 Bacteria 1116
228 Ga0207664_10014550 3300025929 Bacteria 5686
229 Ga0207664_10186892 3300025929 Bacteria 1782
230 Ga0207690_10127523 3300025932 Unclassified 1857
231 Ga0207709_10495575 3300025935 Bacteria 952
232 Ga0207709_10639530 3300025935 Bacteria 846
233 Ga0207704_10115819 3300025938 Bacteria 1822
234 Ga0207665_10003905 3300025939 Bacteria 9977
235 Ga0207665_10007152 3300025939 Bacteria 7386
236 Ga0207665_10029147 3300025939 Bacteria 3650
237 Ga0207711_10005162 3300025941 Bacteria 11064
238 Ga0207711_10676360 3300025941 Bacteria 963
239 Ga0207689_10018227 3300025942 Bacteria 5926
240 Ga0207667_10010223 3300025949 Bacteria 10987
241 Ga0207667_10037042 3300025949 Bacteria 5218
242 Ga0207667_10072449 3300025949 Bacteria 3581
243 Ga0207667_10146508 3300025949 Viruses 2430
244 Ga0207667_10244687 3300025949 Bacteria 1835
245 Ga0207667_10260787 3300025949 Bacteria 1772
246 Ga0207667_10341215 3300025949 Bacteria 1529
247 Ga0207712_10067581 3300025961 Bacteria 2558
248 Ga0207712_10161676 3300025961 Bacteria 1741
249 Ga0207678_10168800 3300026067 Bacteria 1868
250 Ga0207702_10017435 3300026078 Bacteria 5942
251 Ga0207702_10036668 3300026078 Bacteria 4102
252 Ga0207702_10054640 3300026078 Bacteria 3384
253 Ga0207702_10739157 3300026078 Bacteria 971
254 Ga0207648_10517847 3300026089 Bacteria 1093
255 Ga0207674_10036718 3300026116 Bacteria 5101
256 Ga0207683_10781218 3300026121 Bacteria 886
257 Ga0207698_10021696 3300026142 Unclassified 4448
258 Ga0265356_1001627 3300028017 Bacteria 3247
259 Ga0265356_1012586 3300028017 Bacteria 928
260 Ga0265355_1002569 3300028036 Bacteria 1277
261 Ga0268264_10191258 3300028381 Bacteria 1866
262 Ga0265319_1039015 3300028563 Bacteria 1612
263 Ga0265338_10007048 3300028800 Bacteria 14102
264 Ga0265338_10007873 3300028800 Bacteria 13085
265 Ga0265762_1000553 3300030760 Bacteria 6546
266 Ga0265762_1001947 3300030760 Bacteria 3750
267 Ga0265762_1012983 3300030760 Bacteria 1498
268 Ga0265760_10002152 3300031090 Bacteria 5764
269 Ga0265328_10014093 3300031239 Bacteria 3154
270 Ga0265325_10024238 3300031241 Bacteria 3303
271 Ga0265325_10030595 3300031241 Bacteria 2886
272 Ga0265325_10064406 3300031241 Bacteria 1853
273 Ga0265329_10133201 3300031242 Bacteria 800
274 Ga0265339_10027354 3300031249 Bacteria 3255
275 Ga0265339_10035436 3300031249 Bacteria 2800
276 Ga0265331_10036914 3300031250 Unclassified 2396
277 Ga0265331_10057281 3300031250 Bacteria 1849
278 Ga0265316_10006958 3300031344 Bacteria 10725
279 Ga0265316_10029301 3300031344 Bacteria 4528
280 Ga0265316_10085922 3300031344 Bacteria 2406
281 Ga0265314_10000674 3300031711 Bacteria 41721
282 Ga0265314_10195596 3300031711 Bacteria 1199
283 Ga0265342_10119417 3300031712 Bacteria 1486
284 Ga0307416_100204827 3300032002 Bacteria 1876
285 Ga0307411_10409892 3300032005 Bacteria 1123
286 Ga0373934_0003286 3300035086 Bacteria 5913
287 Ga0373934_0020873 3300035086 Bacteria 2520
288 Ga0373936_0149042 3300035113 Bacteria 1013
289 Ga0373945_0000282 3300035116 Bacteria 14393
290 Ga0373945_0051859 3300035116 Bacteria 1510
291 Ga0373954_0083071 3300035118 Bacteria 1532
292 Ga0373954_0089950 3300035118 Bacteria 1474
293 Ga0373956_0184402 3300035119 Bacteria 987
294 Ga0373946_0004856 3300035171 Unclassified 4838
295 Ga0373955_0004645 3300035172 Bacteria 6093
296 Ga0373955_0093643 3300035172 Bacteria 1716
297 Ga0373924_0061636 3300035410 Bacteria 1570
298 Ga0373935_0001426 3300035692 Bacteria 13243
299 Ga0373935_0274073 3300035692 Bacteria 1186
300 Ga0373927_0002490 3300035695 Bacteria 13443
301 Ga0373927_0087130 3300035695 Bacteria 2027
302 Ga0373933_0000034 3300035724 Bacteria 83243
303 Ga0373933_0070791 3300035724 Bacteria 2122
304 Ga0373947_0000214 3300035725 Bacteria 32593
305 Ga0373937_0000001 3300036401 Bacteria 478903
306 Ga0373937_0015831 3300036401 Bacteria 6682
307 Ga0373937_0037100 3300036401 Bacteria 4442
308 Ga0373937_0110734 3300036401 Bacteria 2554
309 Ga0373937_0386844 3300036401 Bacteria 1327
310 Ga0373925_0008218 3300037068 Bacteria 7596
311 Ga0373925_0024800 3300037068 Bacteria 4380
312 Ga0395900_0191864 3300037418 Bacteria 2072
313 Ga0395900_0503201 3300037418 Bacteria 1162
314 Ga0395900_0753438 3300037418 Bacteria 904
315 Ga0395898_0302432 3300037466 Bacteria 1526
316 Ga0395905_0009724 3300037471 Bacteria 9383
317 Ga0395905_0014136 3300037471 Bacteria 7628
318 Ga0395905_0025400 3300037471 Bacteria 5587
319 Ga0395905_0168332 3300037471 Bacteria 2059
320 Ga0395905_0304518 3300037471 Bacteria 1481
321 Ga0395901_0374336 3300038443 Bacteria 1467
322 Ga0395901_0742425 3300038443 Bacteria 975
323 Ga0395901_0773359 3300038443 Unclassified 951
324 Ga0395901_1013088 3300038443 Bacteria 806
325 Ga0436365_0838184 3300039437 Bacteria 69697
326 Ga0436365_0924676 3300039437 Bacteria 448697
327 Ga0436361_0398041 3300039447 Bacteria 1118
328 Ga0436363_0168751 3300039450 Bacteria 2868
329 Ga0436362_0848211 3300039453 Bacteria 15307
330 Ga0439448_0005399 3300042005 Bacteria 3644
331 Ga0466966_0071402 3300044684 Bacteria 2175
332 Ga0466966_0122968 3300044684 Bacteria 1593
333 Ga0466963_0247333 3300044694 Bacteria 1251
334 Ga0466963_0310096 3300044694 Bacteria 1110
335 Ga0453684_0942431 3300044712 Bacteria 922
336 Ga0466957_0030038 3300044842 Bacteria 3244
337 Ga0466959_0018797 3300045049 Bacteria 5076
338 Ga0451576_0112243 3300045051 Bacteria 2837
339 Ga0466958_0095763 3300045836 Bacteria 1840
340 Ga0466958_0332661 3300045836 Bacteria 977
341 Ga0466967_0000254 3300045976 Bacteria 23430
342 Ga0466967_0149999 3300045976 Bacteria 2178
343 Ga0466967_0203021 3300045976 Bacteria 1878
344 Ga0495603_0566160 3300046455 Bacteria 651
345 Ga0495651_0024503 3300046462 Bacteria 4694
346 Ga0495580_0065051 3300046472 Bacteria 2555
347 Ga0495580_0241754 3300046472 Bacteria 1238
348 Ga0495580_0306807 3300046472 Bacteria 1080
349 Ga0495582_0020616 3300046473 Unclassified 3609
350 Ga0495582_0232763 3300046473 Bacteria 1055
351 Ga0495639_0011943 3300046475 Bacteria 3745
352 Ga0495583_0050909 3300046506 Bacteria 1890
353 Ga0495608_0044603 3300046511 Bacteria 2959
354 Ga0495608_0334391 3300046511 Bacteria 934
355 Ga0495630_0017425 3300046517 Bacteria 5261
356 Ga0495652_0073123 3300046529 Bacteria 2856
357 Ga0495652_0563063 3300046529 Bacteria 782
358 Ga0495665_0001245 3300046531 Bacteria 13582
359 Ga0495586_0055242 3300046535 Bacteria 2152
360 Ga0495587_0000309 3300046536 Bacteria 34877
361 Ga0495645_0333011 3300046543 Bacteria 982
362 Ga0495667_0174160 3300046559 Bacteria 1382
363 Ga0495625_0091045 3300046660 Bacteria 2109
364 Ga0495623_0004281 3300046679 Bacteria 9399
365 Ga0495623_0091817 3300046679 Bacteria 1862
366 Ga0495669_0224006 3300046684 Bacteria 902
367 Ga0495624_0347670 3300046690 Bacteria 892
368 Ga0495674_0093055 3300047319 Bacteria 2573
369 Ga0495684_0006239 3300047471 Bacteria 9264
370 Ga0495686_0004064 3300047472 Bacteria 12221
371 Ga0495602_0003523 3300048088 Bacteria 16192
372 Ga0495602_0105559 3300048088 Bacteria 2302
373 Ga0496100_0424682 3300048903 Bacteria 1016
374 Ga0496102_0080551 3300048905 Bacteria 3000
375 Ga0496104_0365158 3300048907 Bacteria 1356
376 Ga0496104_0623913 3300048907 Bacteria 988
377 Ga0496105_0000676 3300048908 Bacteria 22926
378 Ga0496107_0029556 3300048910 Bacteria 3900
379 Ga0496108_0092875 3300048911 Bacteria 2566
380 Ga0496109_0783629 3300048912 Bacteria 891
381 Ga0496110_0048887 3300048913 Bacteria 3709
382 Ga0496110_0079114 3300048913 Bacteria 2927
383 Ga0496111_0027598 3300048914 Bacteria 4018
384 Ga0496111_0116331 3300048914 Bacteria 1972
385 Ga0496111_0568990 3300048914 Bacteria 831
386 Ga0496112_0156731 3300048915 Unclassified 2244
387 Ga0496113_0468880 3300048916 Bacteria 1012
388 Ga0496114_0284261 3300048917 Bacteria 1459
389 Ga0496115_0112997 3300048918 Bacteria 2232
390 Ga0496115_0320433 3300048918 Bacteria 1268
391 Ga0495682_0058311 3300049460 Bacteria 1397
392 nmdc:mga0qj67_216486_c1 3300050509 Bacteria 1555
393 nmdc:mga06r32_228370_c1 3300050510 Bacteria 1849
394 nmdc:mga08y16_256042_c1 3300050511 Bacteria 1808
395 nmdc:mga0n895_1620_c1 3300050512 Bacteria 16965
396 nmdc:mga0n895_2243_c1 3300050512 Bacteria 14969
397 nmdc:mga0n895_620176_c1 3300050512 Unclassified 1082
398 nmdc:mga0rr50_15212_c1 3300050513 Bacteria 5074
399 nmdc:mga0rr50_19311_c1 3300050513 Bacteria 4597
400 nmdc:mga0rr50_92907_c1 3300050513 Bacteria 2353
401 nmdc:mga08x19_4938_c1 3300050514 Bacteria 7877
402 nmdc:mga0a205_107_c2 3300050515 Bacteria 46625
403 nmdc:mga0a205_380711_c1 3300050515 Bacteria 1276
404 nmdc:mga0a205_5195_c2 3300050515 Bacteria 6348
405 Ga0495601_0274590 3300053077 Bacteria 1099
406 Ga0495619_0522957 3300053085 Bacteria 815
407 Ga0530510_0515424 3300061734 Bacteria 907
408 Ga0495652_0069193
409 JGI25406J46586_10003411
410 Ga0058862_12879174
411 Ga0065712_10079463
412 Ga0070658_10008482
413 Ga0070683_101053243
414 Ga0070670_100004658
415 Ga0068869_100013366
416 Ga0070680_100456563
417 Ga0070682_100330971
418 Ga0070660_100081889
419 Ga0070660_100223041
420 Ga0070660_100411699
421 Ga0070687_100149327
422 Ga0070661_100053994
423 Ga0070671_100251968
424 Ga0070709_10000906
425 Ga0070709_10122619
426 Ga0070714_100001208
427 Ga0070713_100000389
428 Ga0070713_100010099
429 Ga0070713_100043723
430 Ga0070713_100062648
431 Ga0070713_100458771
432 Ga0070710_10001659
433 Ga0070710_10022068
434 Ga0070710_10078631
435 Ga0070710_10102030
436 Ga0070711_100103059
437 Ga0070711_100511637
438 Ga0070711_100567307
439 Ga0070708_100062039
440 Ga0070708_100075451
441 Ga0070708_100098706
442 Ga0070681_10044498
443 Ga0070681_10102444
444 Ga0070681_10187839
445 Ga0070681_10338788
446 Ga0070681_10502662
447 Ga0068867_100457204
448 Ga0070706_100029401
449 Ga0070706_100196984
450 Ga0070707_100226171
451 Ga0070707_100449131
452 Ga0070699_100157631
453 Ga0070699_100305476
454 Ga0070699_100327226
455 Ga0070699_100452132
456 Ga0070679_100322139
457 Ga0070697_100038521
458 Ga0070697_100056705
459 Ga0070697_100117606
460 Ga0070697_100358666
461 Ga0070697_100517165
462 Ga0068853_100170073
463 Ga0070672_100342563
464 Ga0068855_100001865
465 Ga0068855_100026835
466 Ga0068855_100058429
467 Ga0068855_100186670
468 Ga0068855_100202563
469 Ga0068855_100221746
470 Ga0068855_100502855
471 Ga0068857_100107487
472 Ga0068857_100821579
473 Ga0068854_100079376
474 Ga0068856_100008885
475 Ga0068856_100141720
476 Ga0068856_100183361
477 Ga0068856_100797716
478 Ga0068856_101098148
479 Ga0068852_100140840
480 Ga0068852_100265156
481 Ga0068852_100320097
482 Ga0068861_100561194
483 Ga0068851_10226226
484 Ga0068858_100101410
485 Ga0068860_100138925
486 Ga0081455_10226406
487 Ga0081540_1041782
488 Ga0081539_10000053
489 Ga0070717_10006718
490 Ga0070717_10040859
491 Ga0070717_10041817
492 Ga0070717_10043132
493 Ga0070717_10063811
494 Ga0070717_10174196
495 Ga0070717_10201163
496 Ga0070717_10213901
497 Ga0070717_10351191
498 Ga0070717_10428152
499 Ga0070717_10651358
500 Ga0070715_10034792
501 Ga0070715_10171349
502 Ga0070716_100002778
503 Ga0070716_100064654
504 Ga0070712_100000206
505 Ga0070712_100010638
506 Ga0070712_100112795
507 Ga0075428_100043336
508 Ga0075428_100893800
509 Ga0075430_100274422
510 Ga0075431_100056179
511 Ga0075431_100117061
512 Ga0075433_10000048
513 Ga0075433_10013283
514 Ga0075434_100000575
515 Ga0075434_100001629
516 Ga0075434_100749308
517 Ga0075429_100350245
518 Ga0068865_100073518
519 Ga0075436_100041650
520 Ga0075435_100006929
521 Ga0075435_100021727
522 Ga0105240_10000532
523 Ga0105240_10001704
524 Ga0105240_10013422
525 Ga0105240_10081055
526 Ga0105240_10126776
527 Ga0105240_10383188
528 Ga0111539_10319609
529 Ga0105245_10000892
530 Ga0105245_10006772
531 Ga0105245_10007883
532 Ga0105245_10095726
533 Ga0114129_10160352
534 Ga0114129_10657056
535 Ga0105241_10147074
536 Ga0105241_10195567
537 Ga0105242_10157471
538 Ga0105242_10501616
539 Ga0105238_10011419
540 Ga0105238_10053009
541 Ga0105238_10109893
542 Ga0105238_10138275
543 Ga0105238_10324163
544 Ga0105249_10071492
545 Ga0105239_10233619
546 Ga0105246_10009793
547 Ga0157373_10077380
548 Ga0157373_10151213
549 Ga0157370_10003413
550 Ga0157370_10004899
551 Ga0157370_10052758
552 Ga0157370_10083233
553 Ga0157370_10443176
554 Ga0157369_10000876
555 Ga0157369_10019819
556 Ga0157369_10061704
557 Ga0157369_10076717
558 Ga0157369_10144026
559 Ga0157369_10184770
560 Ga0157374_10005838
561 Ga0157374_10007447
562 Ga0157374_10145197
563 Ga0157374_10225751
564 Ga0157378_10002303
565 Ga0163162_10132724
566 Ga0163162_10267537
567 Ga0157372_10063905
568 Ga0157372_10302605
569 Ga0157372_10417308
570 Ga0157372_10584963
571 Ga0157375_10003270
572 Ga0163163_10069351
573 Ga0163163_10167630
574 Ga0157380_11134126
575 Ga0157379_10570839
576 Ga0213873_10014508
577 Ga0213874_10008505
578 Ga0213876_10000017
579 Ga0213876_10000413
580 Ga0224712_10033578
581 Ga0224569_100001
582 Ga0224571_100001
583 Ga0228598_1000020
584 Ga0207692_10001123
585 Ga0207692_10047739
586 Ga0207692_10095694
587 Ga0207692_10206277
588 Ga0207685_10113752
589 Ga0207699_10008915
590 Ga0207699_10197250
591 Ga0207699_10335989
592 Ga0207705_10051577
593 Ga0207684_10010618
594 Ga0207684_10137003
595 Ga0207654_10156134
596 Ga0207654_10256570
597 Ga0207707_10220679
598 Ga0207707_10237606
599 Ga0207695_10002273
600 Ga0207695_10056306
601 Ga0207695_10072199
602 Ga0207695_10654071
603 Ga0207693_10000284
604 Ga0207693_10004946
605 Ga0207693_10029720
606 Ga0207693_10030569
607 Ga0207663_10062262
608 Ga0207663_10240137
609 Ga0207663_10432261
610 Ga0207663_10440907
611 Ga0207660_10074900
612 Ga0207660_10441850
613 Ga0207662_10310399
614 Ga0207657_10046275
615 Ga0207657_10073125
616 Ga0207657_10173386
617 Ga0207649_10205979
618 Ga0207652_10351818
619 Ga0207646_10049499
620 Ga0207646_10251179
621 Ga0207646_10298173
622 Ga0207646_10375999
623 Ga0207646_10396735
624 Ga0207646_10633467
625 Ga0207694_10019710
626 Ga0207694_10043779
627 Ga0207694_10133275
628 Ga0207694_10181666
629 Ga0207687_10001759
630 Ga0207687_10057809
631 Ga0207700_10001574
632 Ga0207700_10020929
633 Ga0207700_10043401
634 Ga0207700_10464981
635 Ga0207664_10014550
636 Ga0207664_10186892
637 Ga0207690_10127523
638 Ga0207709_10495575
639 Ga0207709_10639530
640 Ga0207704_10115819
641 Ga0207665_10003905
642 Ga0207665_10007152
643 Ga0207665_10029147
644 Ga0207711_10005162
645 Ga0207711_10676360
646 Ga0207689_10018227
647 Ga0207667_10010223
648 Ga0207667_10037042
649 Ga0207667_10072449
650 Ga0207667_10146508
651 Ga0207667_10244687
652 Ga0207667_10260787
653 Ga0207667_10341215
654 Ga0207712_10067581
655 Ga0207712_10161676
656 Ga0207678_10168800
657 Ga0207702_10017435
658 Ga0207702_10036668
659 Ga0207702_10054640
660 Ga0207702_10739157
661 Ga0207648_10517847
662 Ga0207674_10036718
663 Ga0207683_10781218
664 Ga0207698_10021696
665 Ga0265356_1001627
666 Ga0265356_1012586
667 Ga0265355_1002569
668 Ga0268264_10191258
669 Ga0265319_1039015
670 Ga0265338_10007048
671 Ga0265338_10007873
672 Ga0265762_1000553
673 Ga0265762_1001947
674 Ga0265762_1012983
675 Ga0265760_10002152
676 Ga0265328_10014093
677 Ga0265325_10024238
678 Ga0265325_10030595
679 Ga0265325_10064406
680 Ga0265329_10133201
681 Ga0265339_10027354
682 Ga0265339_10035436
683 Ga0265331_10036914
684 Ga0265331_10057281
685 Ga0265316_10006958
686 Ga0265316_10029301
687 Ga0265316_10085922
688 Ga0265314_10000674
689 Ga0265314_10195596
690 Ga0265342_10119417
691 Ga0307416_100204827
692 Ga0307411_10409892
693 Ga0373934_0003286
694 Ga0373934_0020873
695 Ga0373936_0149042
696 Ga0373945_0000282
697 Ga0373945_0051859
698 Ga0373954_0083071
699 Ga0373954_0089950
700 Ga0373956_0184402
701 Ga0373946_0004856
702 Ga0373955_0004645
703 Ga0373955_0093643
704 Ga0373924_0061636
705 Ga0373935_0001426
706 Ga0373935_0274073
707 Ga0373927_0002490
708 Ga0373927_0087130
709 Ga0373933_0000034
710 Ga0373933_0070791
711 Ga0373947_0000214
712 Ga0373937_0000001
713 Ga0373937_0015831
714 Ga0373937_0037100
715 Ga0373937_0110734
716 Ga0373937_0386844
717 Ga0373925_0008218
718 Ga0373925_0024800
719 Ga0395900_0191864
720 Ga0395900_0503201
721 Ga0395900_0753438
722 Ga0395898_0302432
723 Ga0395905_0009724
724 Ga0395905_0014136
725 Ga0395905_0025400
726 Ga0395905_0168332
727 Ga0395905_0304518
728 Ga0395901_0374336
729 Ga0395901_0742425
730 Ga0395901_0773359
731 Ga0395901_1013088
732 Ga0436365_0838184
733 Ga0436365_0924676
734 Ga0436361_0398041
735 Ga0436363_0168751
736 Ga0436362_0848211
737 Ga0439448_0005399
738 Ga0466966_0071402
739 Ga0466966_0122968
740 Ga0466963_0247333
741 Ga0466963_0310096
742 Ga0453684_0942431
743 Ga0466957_0030038
744 Ga0466959_0018797
745 Ga0451576_0112243
746 Ga0466958_0095763
747 Ga0466958_0332661
748 Ga0466967_0000254
749 Ga0466967_0149999
750 Ga0466967_0203021
751 Ga0495603_0566160
752 Ga0495651_0024503
753 Ga0495580_0065051
754 Ga0495580_0241754
755 Ga0495580_0306807
756 Ga0495582_0020616
757 Ga0495582_0232763
758 Ga0495639_0011943
759 Ga0495583_0050909
760 Ga0495608_0044603
761 Ga0495608_0334391
762 Ga0495630_0017425
763 Ga0495652_0073123
764 Ga0495652_0563063
765 Ga0495665_0001245
766 Ga0495586_0055242
767 Ga0495587_0000309
768 Ga0495645_0333011
769 Ga0495667_0174160
770 Ga0495625_0091045
771 Ga0495623_0004281
772 Ga0495623_0091817
773 Ga0495669_0224006
774 Ga0495624_0347670
775 Ga0495674_0093055
776 Ga0495684_0006239
777 Ga0495686_0004064
778 Ga0495602_0003523
779 Ga0495602_0105559
780 Ga0496100_0424682
781 Ga0496102_0080551
782 Ga0496104_0365158
783 Ga0496104_0623913
784 Ga0496105_0000676
785 Ga0496107_0029556
786 Ga0496108_0092875
787 Ga0496109_0783629
788 Ga0496110_0048887
789 Ga0496110_0079114
790 Ga0496111_0027598
791 Ga0496111_0116331
792 Ga0496111_0568990
793 Ga0496112_0156731
794 Ga0496113_0468880
795 Ga0496114_0284261
796 Ga0496115_0112997
797 Ga0496115_0320433
798 Ga0495682_0058311
799 nmdc:mga0qj67_216486_c1
800 nmdc:mga06r32_228370_c1
801 nmdc:mga08y16_256042_c1
802 nmdc:mga0n895_1620_c1
803 nmdc:mga0n895_2243_c1
804 nmdc:mga0n895_620176_c1
805 nmdc:mga0rr50_15212_c1
806 nmdc:mga0rr50_19311_c1
807 nmdc:mga0rr50_92907_c1
808 nmdc:mga08x19_4938_c1
809 nmdc:mga0a205_107_c2
810 nmdc:mga0a205_380711_c1
811 nmdc:mga0a205_5195_c2
812 Ga0495601_0274590
813 Ga0495619_0522957
814 Ga0530510_0515424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

42

151

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

186

262

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9795 4 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9758 5 123
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.975 5 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9745 5 121
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9723 5 121
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9889 3 82 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9853 5 82 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9838 5 87 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9821 5 87 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9813 5 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6N9GW68-F1-model_v4 Response regulator transcription factor 0.9067 33 232 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6N9GW68-F1-model_v4 Response regulator transcription factor 0.8742 33 232 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2G6CAE7-F1-model_v4 Two-component system response regulator CreB 0.8499 4 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6N8B6S6-F1-model_v4 Response regulator transcription factor 0.8407 4 229 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2G6CAE7-F1-model_v4 Two-component system response regulator CreB 0.8334 4 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map