F436507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 407 | 251 | 397 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0762505|Ga0436365_0762505_5077_6246 |
| Length | 389 |
| Sequence | MTLIQQLASREGVRFGASSLNPLNRALSLRQFGEKPGSKGGQFMQAPVLVGLLAAVLFGTSALAQSKPPLVTEEAMVATSDPGIEIYVRNKRPADMAAFRPEQTVLFVHGATYPAETAFDLKLDGLSWMEYIASRGYDVWLLDVRGYGQSTRPPEMAEKAEANPPIVTGETAVKDIGVAVDYILQRRKIPKLDLLGWSWGTTLMATYTTQNPSKVERLVLYAPAWIRQTPSLVQAGSGKLGAYRMVTREQAKERWYAGVADDQKGSLIPPGWFDAWADATFATDPVGAAMNPPVVRAPNGVIQDGQQFSGAGKAYYDPSKITVPTLLVHAEWDRDTPPYMAQTLFPLLVNSSGKRYVELAEGTHSIIMEKSRLKLFDAVQAFLDEGRRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791355199 | |||
| 2 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 3 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 4 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 5 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 181 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 215 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 218 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 230 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 232 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 234 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 242 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 243 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 244 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 247 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 248 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 249 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 250 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 251 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.78 |
| Metatranscriptomes | 0 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.85 |
| Nodule | 1.47 |
| Rhizoplane | 3.69 |
| Rhizosphere | 81.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10013837 | 3300003320 | Bacteria | 1884 |
| 2 | JGI25404J52841_10004005 | 3300003659 | Bacteria | 2959 |
| 3 | Ga0055526_1003541 | 3300003771 | Bacteria | 9848 |
| 4 | Ga0055537_1000037 | 3300003773 | Bacteria | 95236 |
| 5 | Ga0055524_1019482 | 3300003775 | Bacteria | 2317 |
| 6 | Ga0055534_1000038 | 3300003784 | Bacteria | 105771 |
| 7 | Ga0055528_1000071 | 3300003790 | Bacteria | 78628 |
| 8 | Ga0070658_10006510 | 3300005327 | Bacteria | 9471 |
| 9 | Ga0070658_10070438 | 3300005327 | Bacteria | 2863 |
| 10 | Ga0070676_10003591 | 3300005328 | Bacteria | 8106 |
| 11 | Ga0070690_100010715 | 3300005330 | Bacteria | 5345 |
| 12 | Ga0068869_100001419 | 3300005334 | Bacteria | 14188 |
| 13 | Ga0070666_10000556 | 3300005335 | Bacteria | 22523 |
| 14 | Ga0068868_100026328 | 3300005338 | Bacteria | 4431 |
| 15 | Ga0068868_100112152 | 3300005338 | Bacteria | 2217 |
| 16 | Ga0068868_100133041 | 3300005338 | Bacteria | 2037 |
| 17 | Ga0070689_100337169 | 3300005340 | Bacteria | 1262 |
| 18 | Ga0070687_100005925 | 3300005343 | Bacteria | 4972 |
| 19 | Ga0070661_100263843 | 3300005344 | Bacteria | 1332 |
| 20 | Ga0070692_10019119 | 3300005345 | Bacteria | 3304 |
| 21 | Ga0070668_100000760 | 3300005347 | Bacteria | 22136 |
| 22 | Ga0070668_100077517 | 3300005347 | Bacteria | 2598 |
| 23 | Ga0070668_100220686 | 3300005347 | Bacteria | 1563 |
| 24 | Ga0070669_100003414 | 3300005353 | Bacteria | 11438 |
| 25 | Ga0070669_100094000 | 3300005353 | Bacteria | 2252 |
| 26 | Ga0070675_100014925 | 3300005354 | Bacteria | 6134 |
| 27 | Ga0070675_100194146 | 3300005354 | Bacteria | 1760 |
| 28 | Ga0070671_100005544 | 3300005355 | Bacteria | 10054 |
| 29 | Ga0070671_100148645 | 3300005355 | Bacteria | 1978 |
| 30 | Ga0070671_100188423 | 3300005355 | Bacteria | 1748 |
| 31 | Ga0070674_100002302 | 3300005356 | Bacteria | 10550 |
| 32 | Ga0070673_100121069 | 3300005364 | Bacteria | 2183 |
| 33 | Ga0070688_100090248 | 3300005365 | Bacteria | 2001 |
| 34 | Ga0070667_100004847 | 3300005367 | Bacteria | 11273 |
| 35 | Ga0070667_100065703 | 3300005367 | Bacteria | 3080 |
| 36 | Ga0070713_100208139 | 3300005436 | Bacteria | 1770 |
| 37 | Ga0070700_100126607 | 3300005441 | Bacteria | 1718 |
| 38 | Ga0070694_100041035 | 3300005444 | Bacteria | 3085 |
| 39 | Ga0070708_100036031 | 3300005445 | Bacteria | 4313 |
| 40 | Ga0070663_100032102 | 3300005455 | Bacteria | 3616 |
| 41 | Ga0070663_100044603 | 3300005455 | Bacteria | 3127 |
| 42 | Ga0070663_100049617 | 3300005455 | Bacteria | 2982 |
| 43 | Ga0070663_100066843 | 3300005455 | Bacteria | 2606 |
| 44 | Ga0070678_100139905 | 3300005456 | Bacteria | 1935 |
| 45 | Ga0070662_100004982 | 3300005457 | Bacteria | 8440 |
| 46 | Ga0070662_100049968 | 3300005457 | Bacteria | 3016 |
| 47 | Ga0070681_10341871 | 3300005458 | Bacteria | 1406 |
| 48 | Ga0068867_100007955 | 3300005459 | Bacteria | 7489 |
| 49 | Ga0070706_100240154 | 3300005467 | Bacteria | 1692 |
| 50 | Ga0070707_100031270 | 3300005468 | Bacteria | 5070 |
| 51 | Ga0070707_100092935 | 3300005468 | Bacteria | 2920 |
| 52 | Ga0070698_100372738 | 3300005471 | Bacteria | 1360 |
| 53 | Ga0070699_100004061 | 3300005518 | Bacteria | 12938 |
| 54 | Ga0068853_100100404 | 3300005539 | Bacteria | 2558 |
| 55 | Ga0068853_100267054 | 3300005539 | Bacteria | 1575 |
| 56 | Ga0068853_100339246 | 3300005539 | Bacteria | 1396 |
| 57 | Ga0070672_100003647 | 3300005543 | Bacteria | 10000 |
| 58 | Ga0070672_100010903 | 3300005543 | Bacteria | 6322 |
| 59 | Ga0070672_100151360 | 3300005543 | Bacteria | 1919 |
| 60 | Ga0070686_100031357 | 3300005544 | Bacteria | 3249 |
| 61 | Ga0070695_100005438 | 3300005545 | Bacteria | 7494 |
| 62 | Ga0070696_100046264 | 3300005546 | Bacteria | 3016 |
| 63 | Ga0070665_100037219 | 3300005548 | Bacteria | 4895 |
| 64 | Ga0070665_100055733 | 3300005548 | Bacteria | 3964 |
| 65 | Ga0070665_100119292 | 3300005548 | Bacteria | 2640 |
| 66 | Ga0070704_100012857 | 3300005549 | Bacteria | 5178 |
| 67 | Ga0070704_100094447 | 3300005549 | Bacteria | 2237 |
| 68 | Ga0070704_100326398 | 3300005549 | Bacteria | 1288 |
| 69 | Ga0068855_100044258 | 3300005563 | Bacteria | 5269 |
| 70 | Ga0068855_100055443 | 3300005563 | Bacteria | 4655 |
| 71 | Ga0068855_100068700 | 3300005563 | Bacteria | 4124 |
| 72 | Ga0068855_100114827 | 3300005563 | Bacteria | 3087 |
| 73 | Ga0070664_100047191 | 3300005564 | Bacteria | 3638 |
| 74 | Ga0070664_100154824 | 3300005564 | Bacteria | 2025 |
| 75 | Ga0070664_100283047 | 3300005564 | Bacteria | 1495 |
| 76 | Ga0068857_100074821 | 3300005577 | Bacteria | 3019 |
| 77 | Ga0068857_100151640 | 3300005577 | Bacteria | 2100 |
| 78 | Ga0070702_100041915 | 3300005615 | Bacteria | 2571 |
| 79 | Ga0068852_100016780 | 3300005616 | Bacteria | 5723 |
| 80 | Ga0068852_100165819 | 3300005616 | Bacteria | 2067 |
| 81 | Ga0068852_100262260 | 3300005616 | Bacteria | 1659 |
| 82 | Ga0068859_100022889 | 3300005617 | Bacteria | 6265 |
| 83 | Ga0068859_100034516 | 3300005617 | Bacteria | 5077 |
| 84 | Ga0068859_100120079 | 3300005617 | Bacteria | 2695 |
| 85 | Ga0068859_100163455 | 3300005617 | Bacteria | 2305 |
| 86 | Ga0068864_100033434 | 3300005618 | Bacteria | 4372 |
| 87 | Ga0068864_100109294 | 3300005618 | Bacteria | 2461 |
| 88 | Ga0068864_100343496 | 3300005618 | Bacteria | 1407 |
| 89 | Ga0068864_100415191 | 3300005618 | Bacteria | 1281 |
| 90 | Ga0068866_10000902 | 3300005718 | Bacteria | 13094 |
| 91 | Ga0068861_100004108 | 3300005719 | Bacteria | 9766 |
| 92 | Ga0068863_100000783 | 3300005841 | Bacteria | 31944 |
| 93 | Ga0068863_100494555 | 3300005841 | Bacteria | 1204 |
| 94 | Ga0068858_100001938 | 3300005842 | Bacteria | 21099 |
| 95 | Ga0068858_100254696 | 3300005842 | Bacteria | 1668 |
| 96 | Ga0068858_100298318 | 3300005842 | Bacteria | 1537 |
| 97 | Ga0068860_100009197 | 3300005843 | Bacteria | 9820 |
| 98 | Ga0068862_100034971 | 3300005844 | Bacteria | 4253 |
| 99 | Ga0068862_100111719 | 3300005844 | Bacteria | 2399 |
| 100 | Ga0068862_100246231 | 3300005844 | Bacteria | 1627 |
| 101 | Ga0081455_10001734 | 3300005937 | Bacteria | 26379 |
| 102 | Ga0081455_10007959 | 3300005937 | Bacteria | 11084 |
| 103 | Ga0081455_10034290 | 3300005937 | Bacteria | 4550 |
| 104 | Ga0081455_10064387 | 3300005937 | Bacteria | 3070 |
| 105 | Ga0081455_10146263 | 3300005937 | Bacteria | 1828 |
| 106 | Ga0081538_10068762 | 3300005981 | Bacteria | 1966 |
| 107 | Ga0081540_1001346 | 3300005983 | Bacteria | 21378 |
| 108 | Ga0081540_1004896 | 3300005983 | Bacteria | 10084 |
| 109 | Ga0081540_1040152 | 3300005983 | Bacteria | 2443 |
| 110 | Ga0081540_1103135 | 3300005983 | Bacteria | 1224 |
| 111 | Ga0081539_10096323 | 3300005985 | Bacteria | 1518 |
| 112 | Ga0075368_10022953 | 3300006042 | Bacteria | 2379 |
| 113 | Ga0075368_10048291 | 3300006042 | Bacteria | 1687 |
| 114 | Ga0075363_100022329 | 3300006048 | Bacteria | 3198 |
| 115 | Ga0075363_100069619 | 3300006048 | Bacteria | 1909 |
| 116 | Ga0075362_10023881 | 3300006177 | Bacteria | 2589 |
| 117 | Ga0075362_10031695 | 3300006177 | Bacteria | 2289 |
| 118 | Ga0075367_10061838 | 3300006178 | Bacteria | 2235 |
| 119 | Ga0075366_10039087 | 3300006195 | Bacteria | 2803 |
| 120 | Ga0097621_100015005 | 3300006237 | Bacteria | 5816 |
| 121 | Ga0097621_100142720 | 3300006237 | Bacteria | 2047 |
| 122 | Ga0075370_10002413 | 3300006353 | Bacteria | 8656 |
| 123 | Ga0075370_10026310 | 3300006353 | Bacteria | 3222 |
| 124 | Ga0075370_10084875 | 3300006353 | Bacteria | 1823 |
| 125 | Ga0075370_10126853 | 3300006353 | Bacteria | 1488 |
| 126 | Ga0068871_100071294 | 3300006358 | Bacteria | 2857 |
| 127 | Ga0068871_100167446 | 3300006358 | Bacteria | 1882 |
| 128 | Ga0075428_100434958 | 3300006844 | Unclassified | 1406 |
| 129 | Ga0075434_100053320 | 3300006871 | Bacteria | 4019 |
| 130 | Ga0075434_100146813 | 3300006871 | Bacteria | 2379 |
| 131 | Ga0075434_100217469 | 3300006871 | Bacteria | 1931 |
| 132 | Ga0068865_100001184 | 3300006881 | Bacteria | 15163 |
| 133 | Ga0068865_100072039 | 3300006881 | Bacteria | 2453 |
| 134 | Ga0075436_100142265 | 3300006914 | Bacteria | 1686 |
| 135 | Ga0097620_100022889 | 3300006931 | Bacteria | 6265 |
| 136 | Ga0097620_100034517 | 3300006931 | Bacteria | 5077 |
| 137 | Ga0097620_100120080 | 3300006931 | Bacteria | 2695 |
| 138 | Ga0097620_100163449 | 3300006931 | Bacteria | 2305 |
| 139 | Ga0075435_100000865 | 3300007076 | Bacteria | 18968 |
| 140 | Ga0099794_10001213 | 3300007265 | Bacteria | 8888 |
| 141 | Ga0105240_10269167 | 3300009093 | Bacteria | 1962 |
| 142 | Ga0111539_10388992 | 3300009094 | Unclassified | 1624 |
| 143 | Ga0105245_10005163 | 3300009098 | Bacteria | 11468 |
| 144 | Ga0105245_10021203 | 3300009098 | Bacteria | 5696 |
| 145 | Ga0105245_10332277 | 3300009098 | Bacteria | 1500 |
| 146 | Ga0105243_10009954 | 3300009148 | Bacteria | 7227 |
| 147 | Ga0105243_10042432 | 3300009148 | Bacteria | 3561 |
| 148 | Ga0105243_10086143 | 3300009148 | Bacteria | 2576 |
| 149 | Ga0105241_10095106 | 3300009174 | Bacteria | 2358 |
| 150 | Ga0105241_10095632 | 3300009174 | Bacteria | 2352 |
| 151 | Ga0105242_10007756 | 3300009176 | Bacteria | 8258 |
| 152 | Ga0105242_10019124 | 3300009176 | Bacteria | 5365 |
| 153 | Ga0105248_10015826 | 3300009177 | Bacteria | 8313 |
| 154 | Ga0105248_10580898 | 3300009177 | Bacteria | 1264 |
| 155 | Ga0105237_10007358 | 3300009545 | Bacteria | 12063 |
| 156 | Ga0105237_10122606 | 3300009545 | Bacteria | 2593 |
| 157 | Ga0105238_10327477 | 3300009551 | Bacteria | 1518 |
| 158 | Ga0105249_10006557 | 3300009553 | Bacteria | 10128 |
| 159 | Ga0105239_10043137 | 3300010375 | Bacteria | 4943 |
| 160 | Ga0105239_10043263 | 3300010375 | Bacteria | 4936 |
| 161 | Ga0105239_10418062 | 3300010375 | Bacteria | 1518 |
| 162 | Ga0105246_10084814 | 3300011119 | Bacteria | 2267 |
| 163 | Ga0157374_10062636 | 3300013296 | Bacteria | 3487 |
| 164 | Ga0157378_10117339 | 3300013297 | Bacteria | 2448 |
| 165 | Ga0163162_10018958 | 3300013306 | Bacteria | 6747 |
| 166 | Ga0163162_10218178 | 3300013306 | Bacteria | 2037 |
| 167 | Ga0157375_10005405 | 3300013308 | Bacteria | 11104 |
| 168 | Ga0157375_10173559 | 3300013308 | Bacteria | 2304 |
| 169 | Ga0157375_10178507 | 3300013308 | Bacteria | 2274 |
| 170 | Ga0157375_10196382 | 3300013308 | Bacteria | 2173 |
| 171 | Ga0163163_10031500 | 3300014325 | Bacteria | 5119 |
| 172 | Ga0163163_10133232 | 3300014325 | Bacteria | 2525 |
| 173 | Ga0163163_10405092 | 3300014325 | Bacteria | 1422 |
| 174 | Ga0163163_10415874 | 3300014325 | Bacteria | 1403 |
| 175 | Ga0157380_10004783 | 3300014326 | Bacteria | 9435 |
| 176 | Ga0157380_10050504 | 3300014326 | Bacteria | 3286 |
| 177 | Ga0157380_10234345 | 3300014326 | Bacteria | 1651 |
| 178 | Ga0157379_10007030 | 3300014968 | Bacteria | 9725 |
| 179 | Ga0157379_10285346 | 3300014968 | Bacteria | 1503 |
| 180 | Ga0157376_10088500 | 3300014969 | Bacteria | 2675 |
| 181 | Ga0157376_10291774 | 3300014969 | Bacteria | 1540 |
| 182 | Ga0163161_10004265 | 3300017792 | Bacteria | 9968 |
| 183 | Ga0163161_10040857 | 3300017792 | Bacteria | 3332 |
| 184 | Ga0213876_10002735 | 3300021384 | Bacteria | 10277 |
| 185 | Ga0213876_10020591 | 3300021384 | Bacteria | 3486 |
| 186 | Ga0213876_10057244 | 3300021384 | Bacteria | 2058 |
| 187 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 188 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 189 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 190 | Ga0209564_1000271 | 3300025295 | Bacteria | 108422 |
| 191 | Ga0209758_1015189 | 3300025297 | Bacteria | 4013 |
| 192 | Ga0209758_1022421 | 3300025297 | Bacteria | 2897 |
| 193 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 194 | Ga0207656_10108599 | 3300025321 | Bacteria | 1280 |
| 195 | Ga0207642_10001208 | 3300025899 | Bacteria | 7980 |
| 196 | Ga0207688_10029560 | 3300025901 | Bacteria | 3018 |
| 197 | Ga0207688_10035353 | 3300025901 | Bacteria | 2767 |
| 198 | Ga0207688_10038527 | 3300025901 | Bacteria | 2653 |
| 199 | Ga0207680_10008669 | 3300025903 | Bacteria | 5005 |
| 200 | Ga0207680_10058600 | 3300025903 | Bacteria | 2335 |
| 201 | Ga0207645_10000991 | 3300025907 | Bacteria | 23445 |
| 202 | Ga0207643_10015186 | 3300025908 | Bacteria | 4190 |
| 203 | Ga0207705_10030958 | 3300025909 | Bacteria | 3818 |
| 204 | Ga0207705_10216337 | 3300025909 | Bacteria | 1454 |
| 205 | Ga0207654_10028453 | 3300025911 | Bacteria | 3046 |
| 206 | Ga0207654_10088495 | 3300025911 | Bacteria | 1882 |
| 207 | Ga0207695_10353601 | 3300025913 | Bacteria | 1356 |
| 208 | Ga0207671_10008175 | 3300025914 | Bacteria | 8922 |
| 209 | Ga0207660_10039969 | 3300025917 | Bacteria | 3281 |
| 210 | Ga0207662_10010779 | 3300025918 | Bacteria | 5052 |
| 211 | Ga0207646_10031475 | 3300025922 | Bacteria | 4802 |
| 212 | Ga0207681_10002446 | 3300025923 | Bacteria | 11773 |
| 213 | Ga0207650_10103623 | 3300025925 | Bacteria | 2194 |
| 214 | Ga0207659_10002725 | 3300025926 | Bacteria | 10535 |
| 215 | Ga0207687_10106769 | 3300025927 | Bacteria | 2070 |
| 216 | Ga0207687_10130952 | 3300025927 | Bacteria | 1891 |
| 217 | Ga0207687_10237922 | 3300025927 | Unclassified | 1441 |
| 218 | Ga0207644_10025826 | 3300025931 | Bacteria | 4041 |
| 219 | Ga0207644_10175167 | 3300025931 | Bacteria | 1678 |
| 220 | Ga0207706_10002990 | 3300025933 | Bacteria | 16305 |
| 221 | Ga0207686_10009032 | 3300025934 | Bacteria | 5396 |
| 222 | Ga0207709_10082683 | 3300025935 | Bacteria | 2074 |
| 223 | Ga0207709_10086216 | 3300025935 | Bacteria | 2038 |
| 224 | Ga0207669_10001042 | 3300025937 | Bacteria | 11839 |
| 225 | Ga0207669_10039476 | 3300025937 | Bacteria | 2728 |
| 226 | Ga0207704_10000481 | 3300025938 | Bacteria | 17780 |
| 227 | Ga0207704_10321754 | 3300025938 | Bacteria | 1193 |
| 228 | Ga0207691_10007506 | 3300025940 | Bacteria | 10495 |
| 229 | Ga0207691_10022699 | 3300025940 | Bacteria | 5916 |
| 230 | Ga0207691_10174995 | 3300025940 | Bacteria | 1878 |
| 231 | Ga0207711_10033430 | 3300025941 | Bacteria | 4351 |
| 232 | Ga0207711_10039567 | 3300025941 | Bacteria | 4011 |
| 233 | Ga0207689_10001694 | 3300025942 | Bacteria | 20950 |
| 234 | Ga0207689_10033642 | 3300025942 | Bacteria | 4258 |
| 235 | Ga0207689_10040579 | 3300025942 | Bacteria | 3852 |
| 236 | Ga0207689_10071767 | 3300025942 | Bacteria | 2844 |
| 237 | Ga0207679_10121820 | 3300025945 | Bacteria | 2078 |
| 238 | Ga0207667_10040179 | 3300025949 | Bacteria | 4981 |
| 239 | Ga0207667_10081146 | 3300025949 | Bacteria | 3360 |
| 240 | Ga0207667_10093070 | 3300025949 | Bacteria | 3113 |
| 241 | Ga0207651_10164069 | 3300025960 | Bacteria | 1745 |
| 242 | Ga0207651_10212066 | 3300025960 | Bacteria | 1560 |
| 243 | Ga0207712_10058114 | 3300025961 | Bacteria | 2732 |
| 244 | Ga0207668_10012830 | 3300025972 | Bacteria | 5141 |
| 245 | Ga0207668_10065005 | 3300025972 | Bacteria | 2580 |
| 246 | Ga0207640_10106106 | 3300025981 | Bacteria | 1981 |
| 247 | Ga0207658_10000803 | 3300025986 | Bacteria | 26405 |
| 248 | Ga0207658_10148088 | 3300025986 | Bacteria | 1909 |
| 249 | Ga0207677_10008102 | 3300026023 | Bacteria | 5850 |
| 250 | Ga0207677_10024391 | 3300026023 | Bacteria | 3757 |
| 251 | Ga0207677_10041110 | 3300026023 | Bacteria | 3054 |
| 252 | Ga0207677_10141502 | 3300026023 | Bacteria | 1842 |
| 253 | Ga0207677_10277601 | 3300026023 | Bacteria | 1374 |
| 254 | Ga0207703_10000414 | 3300026035 | Bacteria | 45564 |
| 255 | Ga0207639_10029720 | 3300026041 | Bacteria | 4004 |
| 256 | Ga0207639_10153799 | 3300026041 | Bacteria | 1930 |
| 257 | Ga0207639_10266953 | 3300026041 | Bacteria | 1499 |
| 258 | Ga0207678_10022892 | 3300026067 | Bacteria | 5469 |
| 259 | Ga0207678_10028329 | 3300026067 | Bacteria | 4890 |
| 260 | Ga0207678_10064629 | 3300026067 | Bacteria | 3143 |
| 261 | Ga0207678_10065876 | 3300026067 | Bacteria | 3110 |
| 262 | Ga0207678_10113281 | 3300026067 | Bacteria | 2314 |
| 263 | Ga0207708_10109125 | 3300026075 | Bacteria | 2147 |
| 264 | Ga0207702_10091238 | 3300026078 | Bacteria | 2667 |
| 265 | Ga0207641_10004330 | 3300026088 | Bacteria | 12325 |
| 266 | Ga0207648_10008467 | 3300026089 | Bacteria | 9955 |
| 267 | Ga0207676_10009499 | 3300026095 | Bacteria | 6923 |
| 268 | Ga0207676_10136668 | 3300026095 | Bacteria | 2092 |
| 269 | Ga0207676_10188886 | 3300026095 | Bacteria | 1811 |
| 270 | Ga0207674_10090143 | 3300026116 | Bacteria | 3058 |
| 271 | Ga0207675_100001498 | 3300026118 | Bacteria | 23384 |
| 272 | Ga0207683_10024289 | 3300026121 | Bacteria | 5218 |
| 273 | Ga0207683_10183002 | 3300026121 | Bacteria | 1900 |
| 274 | Ga0207698_10164115 | 3300026142 | Bacteria | 1947 |
| 275 | Ga0209588_1008163 | 3300027671 | Bacteria | 3099 |
| 276 | Ga0209813_10045961 | 3300027866 | Bacteria | 1347 |
| 277 | Ga0268266_10046480 | 3300028379 | Bacteria | 3716 |
| 278 | Ga0268266_10071889 | 3300028379 | Bacteria | 2999 |
| 279 | Ga0268266_10082457 | 3300028379 | Bacteria | 2805 |
| 280 | Ga0268266_10140767 | 3300028379 | Bacteria | 2165 |
| 281 | Ga0268266_10193124 | 3300028379 | Bacteria | 1860 |
| 282 | Ga0268266_10343312 | 3300028379 | Bacteria | 1402 |
| 283 | Ga0268265_10055231 | 3300028380 | Bacteria | 3016 |
| 284 | Ga0268265_10134932 | 3300028380 | Bacteria | 2057 |
| 285 | Ga0268264_10002739 | 3300028381 | Bacteria | 15386 |
| 286 | Ga0268264_10058992 | 3300028381 | Bacteria | 3215 |
| 287 | Ga0268264_10082788 | 3300028381 | Bacteria | 2747 |
| 288 | Ga0268264_10399025 | 3300028381 | Bacteria | 1321 |
| 289 | Ga0265339_10139651 | 3300031249 | Unclassified | 1234 |
| 290 | Ga0307509_10095387 | 3300031507 | Bacteria | 3030 |
| 291 | Ga0307408_100072996 | 3300031548 | Bacteria | 2542 |
| 292 | Ga0265314_10014682 | 3300031711 | Bacteria | 6251 |
| 293 | Ga0265342_10015597 | 3300031712 | Bacteria | 4994 |
| 294 | Ga0307405_10186386 | 3300031731 | Bacteria | 1494 |
| 295 | Ga0307412_10080027 | 3300031911 | Bacteria | 2256 |
| 296 | Ga0307409_100000446 | 3300031995 | Bacteria | 17523 |
| 297 | Ga0307411_10040162 | 3300032005 | Bacteria | 2966 |
| 298 | Ga0307411_10054801 | 3300032005 | Bacteria | 2620 |
| 299 | Ga0307415_100050983 | 3300032126 | Bacteria | 2807 |
| 300 | Ga0307510_10151719 | 3300033180 | Bacteria | 1934 |
| 301 | Ga0373931_0150998 | 3300035691 | Bacteria | 1354 |
| 302 | Ga0373927_0050758 | 3300035695 | Bacteria | 2683 |
| 303 | Ga0373937_0009736 | 3300036401 | Bacteria | 8379 |
| 304 | Ga0373937_0080091 | 3300036401 | Bacteria | 3020 |
| 305 | Ga0395900_0187836 | 3300037418 | Bacteria | 2097 |
| 306 | Ga0395898_0128776 | 3300037466 | Bacteria | 2425 |
| 307 | Ga0395905_0015984 | 3300037471 | Bacteria | 7134 |
| 308 | Ga0436365_0010208 | 3300039437 | Bacteria | 9446 |
| 309 | Ga0436365_0762505 | 3300039437 | Bacteria | 6518 |
| 310 | Ga0436365_1677539 | 3300039437 | Bacteria | 6665 |
| 311 | Ga0436360_0173977 | 3300039438 | Bacteria | 1824 |
| 312 | Ga0436361_1019152 | 3300039447 | Bacteria | 1156 |
| 313 | Ga0436361_1097249 | 3300039447 | Unclassified | 1582 |
| 314 | Ga0451577_0093320 | 3300042876 | Bacteria | 2688 |
| 315 | Ga0466969_0023955 | 3300044656 | Bacteria | 3142 |
| 316 | Ga0466972_0000454 | 3300044658 | Bacteria | 20973 |
| 317 | Ga0466966_0043730 | 3300044684 | Bacteria | 2870 |
| 318 | Ga0466970_0052715 | 3300044765 | Bacteria | 2172 |
| 319 | Ga0466957_0039690 | 3300044842 | Bacteria | 2841 |
| 320 | Ga0466967_0062964 | 3300045976 | Bacteria | 3294 |
| 321 | Ga0495603_0014382 | 3300046455 | Bacteria | 4786 |
| 322 | Ga0495603_0113454 | 3300046455 | Bacteria | 1580 |
| 323 | Ga0495590_0049535 | 3300046457 | Bacteria | 1466 |
| 324 | Ga0495594_0069505 | 3300046499 | Bacteria | 1956 |
| 325 | Ga0495610_0136780 | 3300046512 | Bacteria | 1058 |
| 326 | Ga0495632_0020861 | 3300046519 | Bacteria | 3540 |
| 327 | Ga0495632_0037796 | 3300046519 | Bacteria | 2447 |
| 328 | Ga0495644_0024829 | 3300046523 | Bacteria | 2279 |
| 329 | Ga0495598_0006214 | 3300046537 | Bacteria | 2688 |
| 330 | Ga0495621_0028434 | 3300046539 | Bacteria | 1900 |
| 331 | Ga0495622_0048962 | 3300046557 | Bacteria | 1962 |
| 332 | Ga0495633_0030968 | 3300046558 | Bacteria | 2597 |
| 333 | Ga0495656_0001144 | 3300046615 | Bacteria | 8606 |
| 334 | Ga0495656_0048909 | 3300046615 | Bacteria | 1799 |
| 335 | Ga0495625_0049404 | 3300046660 | Bacteria | 3024 |
| 336 | Ga0495625_0084400 | 3300046660 | Bacteria | 2206 |
| 337 | Ga0495588_0006509 | 3300046674 | Bacteria | 5266 |
| 338 | Ga0495669_0005556 | 3300046684 | Bacteria | 5260 |
| 339 | Ga0495669_0020819 | 3300046684 | Bacteria | 2842 |
| 340 | Ga0495589_0106610 | 3300046794 | Bacteria | 1354 |
| 341 | Ga0495636_0046498 | 3300047318 | Bacteria | 1810 |
| 342 | Ga0495676_0020072 | 3300047321 | Bacteria | 5872 |
| 343 | Ga0495679_041278 | 3300047446 | Bacteria | 1430 |
| 344 | Ga0496101_0002478 | 3300048904 | Bacteria | 11335 |
| 345 | Ga0496101_0132484 | 3300048904 | Bacteria | 1894 |
| 346 | Ga0496102_0060981 | 3300048905 | Bacteria | 3451 |
| 347 | Ga0496102_0232139 | 3300048905 | Bacteria | 1739 |
| 348 | Ga0496104_0015561 | 3300048907 | Bacteria | 6892 |
| 349 | Ga0496107_0155686 | 3300048910 | Bacteria | 1692 |
| 350 | Ga0496108_0090451 | 3300048911 | Bacteria | 2602 |
| 351 | Ga0496109_0021554 | 3300048912 | Bacteria | 5699 |
| 352 | Ga0496109_0482720 | 3300048912 | Unclassified | 1170 |
| 353 | Ga0496111_0071349 | 3300048914 | Bacteria | 2528 |
| 354 | Ga0496112_0087432 | 3300048915 | Bacteria | 3084 |
| 355 | Ga0496113_0022283 | 3300048916 | Bacteria | 4478 |
| 356 | Ga0496114_0023034 | 3300048917 | Bacteria | 5077 |
| 357 | Ga0496115_0017860 | 3300048918 | Bacteria | 5433 |
| 358 | Ga0496115_0329657 | 3300048918 | Bacteria | 1247 |
| 359 | Ga0496121_0053941 | 3300048924 | Bacteria | 3364 |
| 360 | Ga0496121_0135416 | 3300048924 | Bacteria | 1836 |
| 361 | Ga0496124_0072261 | 3300048927 | Bacteria | 2857 |
| 362 | Ga0496126_0005323 | 3300048929 | Bacteria | 14749 |
| 363 | Ga0496126_0024597 | 3300048929 | Bacteria | 5811 |
| 364 | Ga0496126_0035557 | 3300048929 | Bacteria | 4667 |
| 365 | Ga0496126_0071189 | 3300048929 | Bacteria | 3096 |
| 366 | Ga0501039_0127944 | 3300049575 | Bacteria | 1993 |
| 367 | Ga0501048_0170897 | 3300049582 | Bacteria | 1540 |
| 368 | Ga0501067_0124092 | 3300049583 | Bacteria | 1437 |
| 369 | Ga0501069_0180240 | 3300049585 | Bacteria | 1221 |
| 370 | Ga0501076_0371313 | 3300049592 | Bacteria | 1175 |
| 371 | Ga0501235_008552 | 3300049669 | Bacteria | 2234 |
| 372 | Ga0501080_0148570 | 3300049742 | Bacteria | 2167 |
| 373 | Ga0501080_0403235 | 3300049742 | Bacteria | 1230 |
| 374 | Ga0501081_0273045 | 3300049743 | Bacteria | 1237 |
| 375 | nmdc:mga03n38_54981_c1 | 3300050490 | Bacteria | 1792 |
| 376 | nmdc:mga0yw44_64602_c1 | 3300050492 | Bacteria | 2253 |
| 377 | nmdc:mga0k408_72966_c1 | 3300050493 | Bacteria | 2005 |
| 378 | nmdc:mga0k408_79073_c1 | 3300050493 | Bacteria | 1924 |
| 379 | nmdc:mga06z11_12019_c1 | 3300050494 | Bacteria | 3753 |
| 380 | nmdc:mga04h51_65546_c1 | 3300050495 | Bacteria | 1256 |
| 381 | nmdc:mga07m45_3870_c1 | 3300050496 | Bacteria | 7259 |
| 382 | nmdc:mga08y16_203110_c1 | 3300050511 | Bacteria | 2053 |
| 383 | nmdc:mga0n895_139161_c1 | 3300050512 | Bacteria | 2455 |
| 384 | nmdc:mga0n895_72306_c1 | 3300050512 | Bacteria | 3421 |
| 385 | nmdc:mga0rr50_209714_c1 | 3300050513 | Bacteria | 1604 |
| 386 | nmdc:mga0rr50_3774_c1 | 3300050513 | Bacteria | 8786 |
| 387 | nmdc:mga08x19_280845_c1 | 3300050514 | Bacteria | 1154 |
| 388 | Ga0495601_0017478 | 3300053077 | Bacteria | 4354 |
| 389 | Ga0495612_0047012 | 3300053078 | Bacteria | 1768 |
| 390 | Ga0500641_0089724 | 3300053096 | Bacteria | 1311 |
| 391 | Ga0500595_027906 | 3300053119 | Bacteria | 1928 |
| 392 | Ga0500590_059642 | 3300053148 | Bacteria | 1920 |
| 393 | Ga0500645_022490 | 3300053730 | Bacteria | 1938 |
| 394 | Ga0501084_0223356 | 3300054114 | Bacteria | 1589 |
| 395 | Ga0501084_0400385 | 3300054114 | Bacteria | 1160 |
| 396 | Ga0530510_0056853 | 3300061734 | Bacteria | 2827 |
| 397 | Ga0530510_0194652 | 3300061734 | Bacteria | 1505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_10237922 | Ga0207687_102379222 | 295 |
| 2 | 3300049582 | Ga0501048_0170897 | Ga0501048_0170897_547_1440 | 295 |
| 3 | 3300049592 | Ga0501076_0371313 | Ga0501076_0371313_134_1027 | 295 |
| 4 | 3300048929 | Ga0496126_0035557 | Ga0496126_0035557_2057_3001 | 311 |
| 5 | 3300048911 | Ga0496108_0090451 | Ga0496108_0090451_1636_2586 | 314 |
| 6 | 3300050493 | nmdc:mga0k408_79073_c1 | nmdc:mga0k408_79073_c1_113_1057 | 314 |
| 7 | 3300013297 | Ga0157378_10117339 | Ga0157378_101173393 | 315 |
| 8 | 3300014325 | Ga0163163_10133232 | Ga0163163_101332323 | 315 |
| 9 | 3300046499 | Ga0495594_0069505 | Ga0495594_0069505_15_962 | 315 |
| 10 | 3300046512 | Ga0495610_0136780 | Ga0495610_0136780_51_998 | 315 |
| 11 | 3300046519 | Ga0495632_0020861 | Ga0495632_0020861_1349_2296 | 315 |
| 12 | 3300046519 | Ga0495632_0037796 | Ga0495632_0037796_1054_2001 | 315 |
| 13 | 3300046615 | Ga0495656_0048909 | Ga0495656_0048909_564_1511 | 315 |
| 14 | 3300046660 | Ga0495625_0049404 | Ga0495625_0049404_2049_2996 | 315 |
| 15 | 3300047446 | Ga0495679_041278 | Ga0495679_041278_27_974 | 315 |
| 16 | 3300048904 | Ga0496101_0132484 | Ga0496101_0132484_32_979 | 315 |
| 17 | 3300048924 | Ga0496121_0135416 | Ga0496121_0135416_879_1826 | 315 |
| 18 | 3300048929 | Ga0496126_0071189 | Ga0496126_0071189_541_1488 | 315 |
| 19 | 3300049743 | Ga0501081_0273045 | Ga0501081_0273045_277_1224 | 315 |
| 20 | 3300050493 | nmdc:mga0k408_72966_c1 | nmdc:mga0k408_72966_c1_62_1009 | 315 |
| 21 | 3300050513 | nmdc:mga0rr50_209714_c1 | nmdc:mga0rr50_209714_c1_619_1566 | 315 |
| 22 | 3300053119 | Ga0500595_027906 | Ga0500595_027906_279_1226 | 315 |
| 23 | 3300053148 | Ga0500590_059642 | Ga0500590_059642_460_1407 | 315 |
| 24 | 3300053730 | Ga0500645_022490 | Ga0500645_022490_32_979 | 315 |
| 25 | iso_pu_bacteria | 2876808645 | 2876816611 | 315 |
| 26 | iso_pu_bacteria | 2879110137 | 2879115868 | 315 |
| 27 | 3300005335 | Ga0070666_10000556 | Ga0070666_1000055618 | 317 |
| 28 | 3300005353 | Ga0070669_100003414 | Ga0070669_1000034147 | 317 |
| 29 | 3300005354 | Ga0070675_100014925 | Ga0070675_1000149253 | 317 |
| 30 | 3300005356 | Ga0070674_100002302 | Ga0070674_10000230210 | 317 |
| 31 | 3300005367 | Ga0070667_100004847 | Ga0070667_1000048476 | 317 |
| 32 | 3300005543 | Ga0070672_100003647 | Ga0070672_1000036477 | 317 |
| 33 | 3300005617 | Ga0068859_100022889 | Ga0068859_1000228896 | 317 |
| 34 | 3300005842 | Ga0068858_100001938 | Ga0068858_1000019387 | 317 |
| 35 | 3300006931 | Ga0097620_100022889 | Ga0097620_1000228896 | 317 |
| 36 | 3300025903 | Ga0207680_10008669 | Ga0207680_100086692 | 317 |
| 37 | 3300025923 | Ga0207681_10002446 | Ga0207681_100024467 | 317 |
| 38 | 3300025926 | Ga0207659_10002725 | Ga0207659_1000272510 | 317 |
| 39 | 3300025937 | Ga0207669_10001042 | Ga0207669_100010427 | 317 |
| 40 | 3300025940 | Ga0207691_10007506 | Ga0207691_1000750610 | 317 |
| 41 | 3300025941 | Ga0207711_10033430 | Ga0207711_100334304 | 317 |
| 42 | 3300025986 | Ga0207658_10000803 | Ga0207658_1000080311 | 317 |
| 43 | 3300026089 | Ga0207648_10008467 | Ga0207648_100084679 | 317 |
| 44 | 3300048912 | Ga0496109_0482720 | Ga0496109_0482720_73_1122 | 318 |
| 45 | 3300005563 | Ga0068855_100044258 | Ga0068855_1000442586 | 319 |
| 46 | 3300009174 | Ga0105241_10095106 | Ga0105241_100951063 | 319 |
| 47 | 3300010375 | Ga0105239_10043263 | Ga0105239_100432631 | 319 |
| 48 | 3300025297 | Ga0209758_1022421 | Ga0209758_10224213 | 319 |
| 49 | 3300025911 | Ga0207654_10028453 | Ga0207654_100284531 | 319 |
| 50 | 3300025942 | Ga0207689_10033642 | Ga0207689_100336427 | 319 |
| 51 | 3300026023 | Ga0207677_10024391 | Ga0207677_100243915 | 319 |
| 52 | 3300026041 | Ga0207639_10266953 | Ga0207639_102669531 | 319 |
| 53 | 3300053077 | Ga0495601_0017478 | Ga0495601_0017478_2337_3296 | 319 |
| 54 | 3300005545 | Ga0070695_100005438 | Ga0070695_1000054386 | 320 |
| 55 | 3300046455 | Ga0495603_0014382 | Ga0495603_0014382_3560_4522 | 320 |
| 56 | 3300046558 | Ga0495633_0030968 | Ga0495633_0030968_495_1457 | 320 |
| 57 | 3300048917 | Ga0496114_0023034 | Ga0496114_0023034_3802_4863 | 320 |
| 58 | 3300035695 | Ga0373927_0050758 | Ga0373927_0050758_1183_2229 | 324 |
| 59 | 3300049742 | Ga0501080_0148570 | Ga0501080_0148570_363_1355 | 324 |
| 60 | 3300049742 | Ga0501080_0403235 | Ga0501080_0403235_204_1196 | 324 |
| 61 | 3300026023 | Ga0207677_10141502 | Ga0207677_101415022 | 325 |
| 62 | 3300039447 | Ga0436361_1019152 | Ga0436361_1019152_103_1095 | 325 |
| 63 | 3300039437 | Ga0436365_0010208 | Ga0436365_0010208_1450_2463 | 326 |
| 64 | 3300005327 | Ga0070658_10070438 | Ga0070658_100704382 | 327 |
| 65 | 3300025909 | Ga0207705_10216337 | Ga0207705_102163372 | 327 |
| 66 | 3300031711 | Ga0265314_10014682 | Ga0265314_100146825 | 327 |
| 67 | 3300031712 | Ga0265342_10015597 | Ga0265342_100155972 | 327 |
| 68 | 3300005937 | Ga0081455_10064387 | Ga0081455_100643872 | 329 |
| 69 | 3300006358 | Ga0068871_100071294 | Ga0068871_1000712942 | 329 |
| 70 | 3300025942 | Ga0207689_10040579 | Ga0207689_100405796 | 329 |
| 71 | 3300005355 | Ga0070671_100005544 | Ga0070671_1000055446 | 331 |
| 72 | 3300005616 | Ga0068852_100262260 | Ga0068852_1002622602 | 331 |
| 73 | 3300006237 | Ga0097621_100015005 | Ga0097621_1000150054 | 331 |
| 74 | 3300014968 | Ga0157379_10285346 | Ga0157379_102853461 | 331 |
| 75 | 3300025925 | Ga0207650_10103623 | Ga0207650_101036232 | 331 |
| 76 | 3300025941 | Ga0207711_10039567 | Ga0207711_100395672 | 331 |
| 77 | 3300026095 | Ga0207676_10136668 | Ga0207676_101366682 | 331 |
| 78 | 3300046523 | Ga0495644_0024829 | Ga0495644_0024829_18_1013 | 331 |
| 79 | 3300046537 | Ga0495598_0006214 | Ga0495598_0006214_415_1410 | 331 |
| 80 | 3300046539 | Ga0495621_0028434 | Ga0495621_0028434_383_1378 | 331 |
| 81 | 3300046615 | Ga0495656_0001144 | Ga0495656_0001144_6016_7011 | 331 |
| 82 | 3300046794 | Ga0495589_0106610 | Ga0495589_0106610_211_1206 | 331 |
| 83 | 3300047318 | Ga0495636_0046498 | Ga0495636_0046498_238_1233 | 331 |
| 84 | 3300025981 | Ga0207640_10106106 | Ga0207640_101061063 | 333 |
| 85 | 3300028379 | Ga0268266_10193124 | Ga0268266_101931242 | 333 |
| 86 | 3300061734 | Ga0530510_0056853 | Ga0530510_0056853_305_1309 | 333 |
| 87 | 3300005937 | Ga0081455_10001734 | Ga0081455_1000173420 | 334 |
| 88 | 3300021384 | Ga0213876_10020591 | Ga0213876_100205914 | 335 |
| 89 | 3300037466 | Ga0395898_0128776 | Ga0395898_0128776_35_1096 | 335 |
| 90 | 3300005455 | Ga0070663_100032102 | Ga0070663_1000321022 | 337 |
| 91 | 3300026067 | Ga0207678_10028329 | Ga0207678_100283292 | 337 |
| 92 | 3300009093 | Ga0105240_10269167 | Ga0105240_102691671 | 338 |
| 93 | 3300037418 | Ga0395900_0187836 | Ga0395900_0187836_594_1637 | 338 |
| 94 | 3300037471 | Ga0395905_0015984 | Ga0395905_0015984_863_1906 | 338 |
| 95 | 3300005458 | Ga0070681_10341871 | Ga0070681_103418711 | 339 |
| 96 | 3300005539 | Ga0068853_100100404 | Ga0068853_1001004042 | 339 |
| 97 | 3300005549 | Ga0070704_100094447 | Ga0070704_1000944471 | 339 |
| 98 | 3300005563 | Ga0068855_100114827 | Ga0068855_1001148271 | 339 |
| 99 | 3300005842 | Ga0068858_100254696 | Ga0068858_1002546961 | 339 |
| 100 | 3300009094 | Ga0111539_10388992 | Ga0111539_103889921 | 339 |
| 101 | 3300009098 | Ga0105245_10332277 | Ga0105245_103322771 | 339 |
| 102 | 3300009174 | Ga0105241_10095632 | Ga0105241_100956322 | 339 |
| 103 | 3300009545 | Ga0105237_10007358 | Ga0105237_100073583 | 339 |
| 104 | 3300025911 | Ga0207654_10088495 | Ga0207654_100884951 | 339 |
| 105 | 3300025914 | Ga0207671_10008175 | Ga0207671_100081753 | 339 |
| 106 | 3300025938 | Ga0207704_10321754 | Ga0207704_103217541 | 339 |
| 107 | 3300025949 | Ga0207667_10093070 | Ga0207667_100930703 | 339 |
| 108 | 3300026041 | Ga0207639_10029720 | Ga0207639_100297202 | 339 |
| 109 | 3300035691 | Ga0373931_0150998 | Ga0373931_0150998_234_1253 | 339 |
| 110 | 3300036401 | Ga0373937_0080091 | Ga0373937_0080091_1576_2640 | 339 |
| 111 | 3300050512 | nmdc:mga0n895_139161_c1 | nmdc:mga0n895_139161_c1_594_1613 | 339 |
| 112 | 3300003775 | Ga0055524_1019482 | Ga0055524_10194822 | 341 |
| 113 | 3300005563 | Ga0068855_100055443 | Ga0068855_1000554436 | 341 |
| 114 | 3300006871 | Ga0075434_100217469 | Ga0075434_1002174692 | 341 |
| 115 | 3300007265 | Ga0099794_10001213 | Ga0099794_100012132 | 341 |
| 116 | 3300025263 | Ga0209565_1000055 | Ga0209565_100005564 | 341 |
| 117 | 3300025273 | Ga0209673_1000040 | Ga0209673_100004064 | 341 |
| 118 | 3300025291 | Ga0209675_1000052 | Ga0209675_1000052125 | 341 |
| 119 | 3300025295 | Ga0209564_1000271 | Ga0209564_100027165 | 341 |
| 120 | 3300025299 | Ga0209256_1000100 | Ga0209256_1000100125 | 341 |
| 121 | 3300025949 | Ga0207667_10040179 | Ga0207667_100401796 | 341 |
| 122 | 3300027671 | Ga0209588_1008163 | Ga0209588_10081634 | 341 |
| 123 | 3300042876 | Ga0451577_0093320 | Ga0451577_0093320_1521_2567 | 341 |
| 124 | iso_pu_bacteria | 8056967851 | 8056969841 | 341 |
| 125 | 3300005327 | Ga0070658_10006510 | Ga0070658_100065108 | 342 |
| 126 | 3300005328 | Ga0070676_10003591 | Ga0070676_100035913 | 342 |
| 127 | 3300005330 | Ga0070690_100010715 | Ga0070690_1000107155 | 342 |
| 128 | 3300005334 | Ga0068869_100001419 | Ga0068869_1000014198 | 342 |
| 129 | 3300005338 | Ga0068868_100026328 | Ga0068868_1000263285 | 342 |
| 130 | 3300005343 | Ga0070687_100005925 | Ga0070687_1000059255 | 342 |
| 131 | 3300005347 | Ga0070668_100000760 | Ga0070668_10000076016 | 342 |
| 132 | 3300005354 | Ga0070675_100194146 | Ga0070675_1001941462 | 342 |
| 133 | 3300005355 | Ga0070671_100188423 | Ga0070671_1001884231 | 342 |
| 134 | 3300005436 | Ga0070713_100208139 | Ga0070713_1002081392 | 342 |
| 135 | 3300005445 | Ga0070708_100036031 | Ga0070708_1000360313 | 342 |
| 136 | 3300005457 | Ga0070662_100004982 | Ga0070662_1000049825 | 342 |
| 137 | 3300005459 | Ga0068867_100007955 | Ga0068867_1000079554 | 342 |
| 138 | 3300005467 | Ga0070706_100240154 | Ga0070706_1002401542 | 342 |
| 139 | 3300005468 | Ga0070707_100031270 | Ga0070707_1000312703 | 342 |
| 140 | 3300005468 | Ga0070707_100092935 | Ga0070707_1000929355 | 342 |
| 141 | 3300005471 | Ga0070698_100372738 | Ga0070698_1003727381 | 342 |
| 142 | 3300005544 | Ga0070686_100031357 | Ga0070686_1000313573 | 342 |
| 143 | 3300005564 | Ga0070664_100154824 | Ga0070664_1001548242 | 342 |
| 144 | 3300005564 | Ga0070664_100283047 | Ga0070664_1002830471 | 342 |
| 145 | 3300005577 | Ga0068857_100074821 | Ga0068857_1000748213 | 342 |
| 146 | 3300005577 | Ga0068857_100151640 | Ga0068857_1001516403 | 342 |
| 147 | 3300005616 | Ga0068852_100016780 | Ga0068852_1000167805 | 342 |
| 148 | 3300005618 | Ga0068864_100033434 | Ga0068864_1000334345 | 342 |
| 149 | 3300005718 | Ga0068866_10000902 | Ga0068866_100009027 | 342 |
| 150 | 3300005719 | Ga0068861_100004108 | Ga0068861_1000041085 | 342 |
| 151 | 3300005841 | Ga0068863_100000783 | Ga0068863_10000078316 | 342 |
| 152 | 3300005843 | Ga0068860_100009197 | Ga0068860_1000091976 | 342 |
| 153 | 3300005844 | Ga0068862_100034971 | Ga0068862_1000349713 | 342 |
| 154 | 3300006844 | Ga0075428_100434958 | Ga0075428_1004349582 | 342 |
| 155 | 3300006871 | Ga0075434_100053320 | Ga0075434_1000533202 | 342 |
| 156 | 3300006881 | Ga0068865_100001184 | Ga0068865_1000011844 | 342 |
| 157 | 3300006914 | Ga0075436_100142265 | Ga0075436_1001422651 | 342 |
| 158 | 3300007076 | Ga0075435_100000865 | Ga0075435_1000008653 | 342 |
| 159 | 3300009545 | Ga0105237_10122606 | Ga0105237_101226062 | 342 |
| 160 | 3300014325 | Ga0163163_10415874 | Ga0163163_104158741 | 342 |
| 161 | 3300017792 | Ga0163161_10004265 | Ga0163161_100042656 | 342 |
| 162 | 3300025899 | Ga0207642_10001208 | Ga0207642_100012087 | 342 |
| 163 | 3300025903 | Ga0207680_10058600 | Ga0207680_100586002 | 342 |
| 164 | 3300025907 | Ga0207645_10000991 | Ga0207645_1000099110 | 342 |
| 165 | 3300025909 | Ga0207705_10030958 | Ga0207705_100309583 | 342 |
| 166 | 3300025918 | Ga0207662_10010779 | Ga0207662_100107792 | 342 |
| 167 | 3300025922 | Ga0207646_10031475 | Ga0207646_100314753 | 342 |
| 168 | 3300025927 | Ga0207687_10106769 | Ga0207687_101067692 | 342 |
| 169 | 3300025931 | Ga0207644_10025826 | Ga0207644_100258262 | 342 |
| 170 | 3300025933 | Ga0207706_10002990 | Ga0207706_100029905 | 342 |
| 171 | 3300025938 | Ga0207704_10000481 | Ga0207704_100004817 | 342 |
| 172 | 3300025942 | Ga0207689_10001694 | Ga0207689_1000169411 | 342 |
| 173 | 3300025945 | Ga0207679_10121820 | Ga0207679_101218203 | 342 |
| 174 | 3300026023 | Ga0207677_10008102 | Ga0207677_100081021 | 342 |
| 175 | 3300026023 | Ga0207677_10277601 | Ga0207677_102776012 | 342 |
| 176 | 3300026035 | Ga0207703_10000414 | Ga0207703_1000041447 | 342 |
| 177 | 3300026067 | Ga0207678_10113281 | Ga0207678_101132812 | 342 |
| 178 | 3300026078 | Ga0207702_10091238 | Ga0207702_100912382 | 342 |
| 179 | 3300026088 | Ga0207641_10004330 | Ga0207641_100043307 | 342 |
| 180 | 3300026095 | Ga0207676_10009499 | Ga0207676_100094995 | 342 |
| 181 | 3300026116 | Ga0207674_10090143 | Ga0207674_100901432 | 342 |
| 182 | 3300026118 | Ga0207675_100001498 | Ga0207675_10000149810 | 342 |
| 183 | 3300026142 | Ga0207698_10164115 | Ga0207698_101641151 | 342 |
| 184 | 3300028381 | Ga0268264_10002739 | Ga0268264_100027396 | 342 |
| 185 | 3300031911 | Ga0307412_10080027 | Ga0307412_100800272 | 342 |
| 186 | 3300031995 | Ga0307409_100000446 | Ga0307409_10000044612 | 342 |
| 187 | 3300032005 | Ga0307411_10040162 | Ga0307411_100401622 | 342 |
| 188 | 3300039438 | Ga0436360_0173977 | Ga0436360_0173977_688_1728 | 342 |
| 189 | 3300048918 | Ga0496115_0329657 | Ga0496115_0329657_161_1216 | 342 |
| 190 | 3300048929 | Ga0496126_0024597 | Ga0496126_0024597_2160_3215 | 342 |
| 191 | 3300049669 | Ga0501235_008552 | Ga0501235_008552_258_1307 | 342 |
| 192 | 3300050512 | nmdc:mga0n895_72306_c1 | nmdc:mga0n895_72306_c1_466_1527 | 342 |
| 193 | 3300050513 | nmdc:mga0rr50_3774_c1 | nmdc:mga0rr50_3774_c1_6923_7984 | 342 |
| 194 | 3300050514 | nmdc:mga08x19_280845_c1 | nmdc:mga08x19_280845_c1_68_1129 | 342 |
| 195 | iso_pu_bacteria | 2874604998 | 2874605550 | 342 |
| 196 | iso_pu_bacteria | 2889033259 | 2889039401 | 342 |
| 197 | iso_pu_bacteria | 8006984368 | 8006987883 | 342 |
| 198 | iso_pu_bacteria | 8056673599 | 8056676929 | 342 |
| 199 | 3300005345 | Ga0070692_10019119 | Ga0070692_100191193 | 343 |
| 200 | 3300005444 | Ga0070694_100041035 | Ga0070694_1000410351 | 343 |
| 201 | 3300005546 | Ga0070696_100046264 | Ga0070696_1000462643 | 343 |
| 202 | 3300005549 | Ga0070704_100012857 | Ga0070704_1000128575 | 343 |
| 203 | 3300005617 | Ga0068859_100120079 | Ga0068859_1001200792 | 343 |
| 204 | 3300005937 | Ga0081455_10034290 | Ga0081455_100342902 | 343 |
| 205 | 3300005983 | Ga0081540_1103135 | Ga0081540_11031351 | 343 |
| 206 | 3300006931 | Ga0097620_100120080 | Ga0097620_1001200802 | 343 |
| 207 | 3300009176 | Ga0105242_10019124 | Ga0105242_100191242 | 343 |
| 208 | 3300021384 | Ga0213876_10002735 | Ga0213876_1000273511 | 343 |
| 209 | 3300021384 | Ga0213876_10057244 | Ga0213876_100572443 | 343 |
| 210 | 3300025917 | Ga0207660_10039969 | Ga0207660_100399692 | 343 |
| 211 | 3300025934 | Ga0207686_10009032 | Ga0207686_100090325 | 343 |
| 212 | 3300036401 | Ga0373937_0009736 | Ga0373937_0009736_7141_8199 | 343 |
| 213 | 3300039437 | Ga0436365_1677539 | Ga0436365_1677539_2816_3850 | 343 |
| 214 | 3300044656 | Ga0466969_0023955 | Ga0466969_0023955_1763_2821 | 343 |
| 215 | 3300044684 | Ga0466966_0043730 | Ga0466966_0043730_640_1698 | 343 |
| 216 | 3300046684 | Ga0495669_0020819 | Ga0495669_0020819_468_1517 | 343 |
| 217 | iso_pu_bacteria | 2791355199 | 2793079940 | 343 |
| 218 | iso_pu_bacteria | 8006964411 | 8006969651 | 343 |
| 219 | iso_pu_bacteria | 8006994254 | 8006995660 | 343 |
| 220 | 3300005340 | Ga0070689_100337169 | Ga0070689_1003371692 | 344 |
| 221 | 3300005364 | Ga0070673_100121069 | Ga0070673_1001210692 | 344 |
| 222 | 3300005617 | Ga0068859_100034516 | Ga0068859_1000345163 | 344 |
| 223 | 3300005618 | Ga0068864_100343496 | Ga0068864_1003434962 | 344 |
| 224 | 3300005841 | Ga0068863_100494555 | Ga0068863_1004945551 | 344 |
| 225 | 3300005983 | Ga0081540_1040152 | Ga0081540_10401522 | 344 |
| 226 | 3300006931 | Ga0097620_100034517 | Ga0097620_1000345173 | 344 |
| 227 | 3300009098 | Ga0105245_10005163 | Ga0105245_100051633 | 344 |
| 228 | 3300025960 | Ga0207651_10212066 | Ga0207651_102120662 | 344 |
| 229 | 3300031249 | Ga0265339_10139651 | Ga0265339_101396511 | 344 |
| 230 | 3300046457 | Ga0495590_0049535 | Ga0495590_0049535_398_1432 | 344 |
| 231 | 3300046660 | Ga0495625_0084400 | Ga0495625_0084400_958_2019 | 344 |
| 232 | 3300053078 | Ga0495612_0047012 | Ga0495612_0047012_254_1294 | 344 |
| 233 | 3300054114 | Ga0501084_0223356 | Ga0501084_0223356_223_1257 | 344 |
| 234 | 3300054114 | Ga0501084_0400385 | Ga0501084_0400385_58_1098 | 344 |
| 235 | 3300061734 | Ga0530510_0194652 | Ga0530510_0194652_173_1213 | 344 |
| 236 | 3300003771 | Ga0055526_1003541 | Ga0055526_10035416 | 345 |
| 237 | 3300003773 | Ga0055537_1000037 | Ga0055537_100003783 | 345 |
| 238 | 3300003784 | Ga0055534_1000038 | Ga0055534_100003882 | 345 |
| 239 | 3300003790 | Ga0055528_1000071 | Ga0055528_100007166 | 345 |
| 240 | 3300005347 | Ga0070668_100077517 | Ga0070668_1000775173 | 345 |
| 241 | 3300005355 | Ga0070671_100148645 | Ga0070671_1001486452 | 345 |
| 242 | 3300005365 | Ga0070688_100090248 | Ga0070688_1000902482 | 345 |
| 243 | 3300005367 | Ga0070667_100065703 | Ga0070667_1000657032 | 345 |
| 244 | 3300005441 | Ga0070700_100126607 | Ga0070700_1001266072 | 345 |
| 245 | 3300005455 | Ga0070663_100066843 | Ga0070663_1000668432 | 345 |
| 246 | 3300005457 | Ga0070662_100049968 | Ga0070662_1000499681 | 345 |
| 247 | 3300005518 | Ga0070699_100004061 | Ga0070699_1000040613 | 345 |
| 248 | 3300005543 | Ga0070672_100010903 | Ga0070672_1000109032 | 345 |
| 249 | 3300005549 | Ga0070704_100326398 | Ga0070704_1003263981 | 345 |
| 250 | 3300005563 | Ga0068855_100068700 | Ga0068855_1000687003 | 345 |
| 251 | 3300005615 | Ga0070702_100041915 | Ga0070702_1000419153 | 345 |
| 252 | 3300005842 | Ga0068858_100298318 | Ga0068858_1002983182 | 345 |
| 253 | 3300005844 | Ga0068862_100111719 | Ga0068862_1001117191 | 345 |
| 254 | 3300006881 | Ga0068865_100072039 | Ga0068865_1000720391 | 345 |
| 255 | 3300009098 | Ga0105245_10021203 | Ga0105245_100212034 | 345 |
| 256 | 3300009148 | Ga0105243_10009954 | Ga0105243_100099547 | 345 |
| 257 | 3300009148 | Ga0105243_10086143 | Ga0105243_100861432 | 345 |
| 258 | 3300009176 | Ga0105242_10007756 | Ga0105242_100077563 | 345 |
| 259 | 3300009177 | Ga0105248_10015826 | Ga0105248_100158265 | 345 |
| 260 | 3300009177 | Ga0105248_10580898 | Ga0105248_105808981 | 345 |
| 261 | 3300009553 | Ga0105249_10006557 | Ga0105249_100065577 | 345 |
| 262 | 3300010375 | Ga0105239_10418062 | Ga0105239_104180621 | 345 |
| 263 | 3300013306 | Ga0163162_10018958 | Ga0163162_100189586 | 345 |
| 264 | 3300013308 | Ga0157375_10005405 | Ga0157375_100054056 | 345 |
| 265 | 3300013308 | Ga0157375_10178507 | Ga0157375_101785072 | 345 |
| 266 | 3300014326 | Ga0157380_10004783 | Ga0157380_100047836 | 345 |
| 267 | 3300014968 | Ga0157379_10007030 | Ga0157379_100070306 | 345 |
| 268 | 3300014969 | Ga0157376_10291774 | Ga0157376_102917742 | 345 |
| 269 | 3300017792 | Ga0163161_10040857 | Ga0163161_100408572 | 345 |
| 270 | 3300025931 | Ga0207644_10175167 | Ga0207644_101751672 | 345 |
| 271 | 3300025935 | Ga0207709_10082683 | Ga0207709_100826831 | 345 |
| 272 | 3300025937 | Ga0207669_10039476 | Ga0207669_100394762 | 345 |
| 273 | 3300025940 | Ga0207691_10022699 | Ga0207691_100226992 | 345 |
| 274 | 3300025960 | Ga0207651_10164069 | Ga0207651_101640691 | 345 |
| 275 | 3300025961 | Ga0207712_10058114 | Ga0207712_100581141 | 345 |
| 276 | 3300025972 | Ga0207668_10065005 | Ga0207668_100650052 | 345 |
| 277 | 3300025986 | Ga0207658_10148088 | Ga0207658_101480881 | 345 |
| 278 | 3300026067 | Ga0207678_10064629 | Ga0207678_100646292 | 345 |
| 279 | 3300026075 | Ga0207708_10109125 | Ga0207708_101091251 | 345 |
| 280 | 3300028379 | Ga0268266_10071889 | Ga0268266_100718892 | 345 |
| 281 | 3300028379 | Ga0268266_10343312 | Ga0268266_103433122 | 345 |
| 282 | 3300028380 | Ga0268265_10134932 | Ga0268265_101349322 | 345 |
| 283 | 3300028381 | Ga0268264_10058992 | Ga0268264_100589923 | 345 |
| 284 | 3300028381 | Ga0268264_10399025 | Ga0268264_103990251 | 345 |
| 285 | 3300039447 | Ga0436361_1097249 | Ga0436361_1097249_192_1289 | 345 |
| 286 | 3300044842 | Ga0466957_0039690 | Ga0466957_0039690_1275_2312 | 345 |
| 287 | 3300045976 | Ga0466967_0062964 | Ga0466967_0062964_1104_2141 | 345 |
| 288 | 3300046557 | Ga0495622_0048962 | Ga0495622_0048962_470_1507 | 345 |
| 289 | 3300046684 | Ga0495669_0005556 | Ga0495669_0005556_3557_4594 | 345 |
| 290 | 3300048905 | Ga0496102_0060981 | Ga0496102_0060981_1835_2872 | 345 |
| 291 | 3300049575 | Ga0501039_0127944 | Ga0501039_0127944_925_1962 | 345 |
| 292 | 3300050511 | nmdc:mga08y16_203110_c1 | nmdc:mga08y16_203110_c1_594_1853 | 345 |
| 293 | 3300003320 | rootH2_10013837 | rootH2_100138372 | 346 |
| 294 | 3300003659 | JGI25404J52841_10004005 | JGI25404J52841_100040051 | 346 |
| 295 | 3300005338 | Ga0068868_100112152 | Ga0068868_1001121522 | 346 |
| 296 | 3300005338 | Ga0068868_100133041 | Ga0068868_1001330412 | 346 |
| 297 | 3300005344 | Ga0070661_100263843 | Ga0070661_1002638431 | 346 |
| 298 | 3300005347 | Ga0070668_100220686 | Ga0070668_1002206861 | 346 |
| 299 | 3300005353 | Ga0070669_100094000 | Ga0070669_1000940002 | 346 |
| 300 | 3300005455 | Ga0070663_100044603 | Ga0070663_1000446033 | 346 |
| 301 | 3300005455 | Ga0070663_100049617 | Ga0070663_1000496172 | 346 |
| 302 | 3300005456 | Ga0070678_100139905 | Ga0070678_1001399052 | 346 |
| 303 | 3300005539 | Ga0068853_100267054 | Ga0068853_1002670542 | 346 |
| 304 | 3300005539 | Ga0068853_100339246 | Ga0068853_1003392462 | 346 |
| 305 | 3300005543 | Ga0070672_100151360 | Ga0070672_1001513602 | 346 |
| 306 | 3300005548 | Ga0070665_100037219 | Ga0070665_1000372194 | 346 |
| 307 | 3300005548 | Ga0070665_100055733 | Ga0070665_1000557332 | 346 |
| 308 | 3300005548 | Ga0070665_100119292 | Ga0070665_1001192922 | 346 |
| 309 | 3300005564 | Ga0070664_100047191 | Ga0070664_1000471912 | 346 |
| 310 | 3300005616 | Ga0068852_100165819 | Ga0068852_1001658192 | 346 |
| 311 | 3300005617 | Ga0068859_100163455 | Ga0068859_1001634552 | 346 |
| 312 | 3300005618 | Ga0068864_100109294 | Ga0068864_1001092942 | 346 |
| 313 | 3300005618 | Ga0068864_100415191 | Ga0068864_1004151911 | 346 |
| 314 | 3300005844 | Ga0068862_100246231 | Ga0068862_1002462311 | 346 |
| 315 | 3300005937 | Ga0081455_10007959 | Ga0081455_100079591 | 346 |
| 316 | 3300005937 | Ga0081455_10146263 | Ga0081455_101462632 | 346 |
| 317 | 3300005981 | Ga0081538_10068762 | Ga0081538_100687621 | 346 |
| 318 | 3300005983 | Ga0081540_1001346 | Ga0081540_10013463 | 346 |
| 319 | 3300005983 | Ga0081540_1004896 | Ga0081540_10048966 | 346 |
| 320 | 3300005985 | Ga0081539_10096323 | Ga0081539_100963231 | 346 |
| 321 | 3300006042 | Ga0075368_10022953 | Ga0075368_100229531 | 346 |
| 322 | 3300006042 | Ga0075368_10048291 | Ga0075368_100482912 | 346 |
| 323 | 3300006048 | Ga0075363_100022329 | Ga0075363_1000223294 | 346 |
| 324 | 3300006048 | Ga0075363_100069619 | Ga0075363_1000696191 | 346 |
| 325 | 3300006177 | Ga0075362_10023881 | Ga0075362_100238812 | 346 |
| 326 | 3300006177 | Ga0075362_10031695 | Ga0075362_100316952 | 346 |
| 327 | 3300006178 | Ga0075367_10061838 | Ga0075367_100618382 | 346 |
| 328 | 3300006195 | Ga0075366_10039087 | Ga0075366_100390872 | 346 |
| 329 | 3300006237 | Ga0097621_100142720 | Ga0097621_1001427202 | 346 |
| 330 | 3300006353 | Ga0075370_10002413 | Ga0075370_100024137 | 346 |
| 331 | 3300006353 | Ga0075370_10026310 | Ga0075370_100263103 | 346 |
| 332 | 3300006353 | Ga0075370_10084875 | Ga0075370_100848751 | 346 |
| 333 | 3300006353 | Ga0075370_10126853 | Ga0075370_101268531 | 346 |
| 334 | 3300006358 | Ga0068871_100167446 | Ga0068871_1001674461 | 346 |
| 335 | 3300006871 | Ga0075434_100146813 | Ga0075434_1001468132 | 346 |
| 336 | 3300006931 | Ga0097620_100163449 | Ga0097620_1001634492 | 346 |
| 337 | 3300009148 | Ga0105243_10042432 | Ga0105243_100424323 | 346 |
| 338 | 3300009551 | Ga0105238_10327477 | Ga0105238_103274771 | 346 |
| 339 | 3300010375 | Ga0105239_10043137 | Ga0105239_100431375 | 346 |
| 340 | 3300011119 | Ga0105246_10084814 | Ga0105246_100848142 | 346 |
| 341 | 3300013296 | Ga0157374_10062636 | Ga0157374_100626363 | 346 |
| 342 | 3300013306 | Ga0163162_10218178 | Ga0163162_102181782 | 346 |
| 343 | 3300013308 | Ga0157375_10173559 | Ga0157375_101735592 | 346 |
| 344 | 3300013308 | Ga0157375_10196382 | Ga0157375_101963821 | 346 |
| 345 | 3300014325 | Ga0163163_10031500 | Ga0163163_100315006 | 346 |
| 346 | 3300014325 | Ga0163163_10405092 | Ga0163163_104050921 | 346 |
| 347 | 3300014326 | Ga0157380_10050504 | Ga0157380_100505043 | 346 |
| 348 | 3300014326 | Ga0157380_10234345 | Ga0157380_102343451 | 346 |
| 349 | 3300014969 | Ga0157376_10088500 | Ga0157376_100885002 | 346 |
| 350 | 3300025297 | Ga0209758_1015189 | Ga0209758_10151892 | 346 |
| 351 | 3300025321 | Ga0207656_10108599 | Ga0207656_101085991 | 346 |
| 352 | 3300025901 | Ga0207688_10029560 | Ga0207688_100295603 | 346 |
| 353 | 3300025901 | Ga0207688_10035353 | Ga0207688_100353533 | 346 |
| 354 | 3300025901 | Ga0207688_10038527 | Ga0207688_100385272 | 346 |
| 355 | 3300025908 | Ga0207643_10015186 | Ga0207643_100151864 | 346 |
| 356 | 3300025913 | Ga0207695_10353601 | Ga0207695_103536011 | 346 |
| 357 | 3300025927 | Ga0207687_10130952 | Ga0207687_101309521 | 346 |
| 358 | 3300025935 | Ga0207709_10086216 | Ga0207709_100862162 | 346 |
| 359 | 3300025940 | Ga0207691_10174995 | Ga0207691_101749952 | 346 |
| 360 | 3300025942 | Ga0207689_10071767 | Ga0207689_100717672 | 346 |
| 361 | 3300025949 | Ga0207667_10081146 | Ga0207667_100811464 | 346 |
| 362 | 3300025972 | Ga0207668_10012830 | Ga0207668_100128304 | 346 |
| 363 | 3300026023 | Ga0207677_10041110 | Ga0207677_100411103 | 346 |
| 364 | 3300026041 | Ga0207639_10153799 | Ga0207639_101537992 | 346 |
| 365 | 3300026067 | Ga0207678_10022892 | Ga0207678_100228925 | 346 |
| 366 | 3300026067 | Ga0207678_10065876 | Ga0207678_100658762 | 346 |
| 367 | 3300026095 | Ga0207676_10188886 | Ga0207676_101888861 | 346 |
| 368 | 3300026121 | Ga0207683_10024289 | Ga0207683_100242894 | 346 |
| 369 | 3300026121 | Ga0207683_10183002 | Ga0207683_101830022 | 346 |
| 370 | 3300027866 | Ga0209813_10045961 | Ga0209813_100459611 | 346 |
| 371 | 3300028379 | Ga0268266_10046480 | Ga0268266_100464804 | 346 |
| 372 | 3300028379 | Ga0268266_10082457 | Ga0268266_100824571 | 346 |
| 373 | 3300028379 | Ga0268266_10140767 | Ga0268266_101407672 | 346 |
| 374 | 3300028380 | Ga0268265_10055231 | Ga0268265_100552314 | 346 |
| 375 | 3300028381 | Ga0268264_10082788 | Ga0268264_100827884 | 346 |
| 376 | 3300031507 | Ga0307509_10095387 | Ga0307509_100953874 | 346 |
| 377 | 3300031548 | Ga0307408_100072996 | Ga0307408_1000729963 | 346 |
| 378 | 3300031731 | Ga0307405_10186386 | Ga0307405_101863862 | 346 |
| 379 | 3300032005 | Ga0307411_10054801 | Ga0307411_100548013 | 346 |
| 380 | 3300032126 | Ga0307415_100050983 | Ga0307415_1000509832 | 346 |
| 381 | 3300033180 | Ga0307510_10151719 | Ga0307510_101517191 | 346 |
| 382 | 3300039437 | Ga0436365_0762505 | Ga0436365_0762505_5077_6246 | 346 |
| 383 | 3300044658 | Ga0466972_0000454 | Ga0466972_0000454_332_1378 | 346 |
| 384 | 3300044765 | Ga0466970_0052715 | Ga0466970_0052715_329_1375 | 346 |
| 385 | 3300046455 | Ga0495603_0113454 | Ga0495603_0113454_179_1219 | 346 |
| 386 | 3300046674 | Ga0495588_0006509 | Ga0495588_0006509_4048_5088 | 346 |
| 387 | 3300047321 | Ga0495676_0020072 | Ga0495676_0020072_1882_2922 | 346 |
| 388 | 3300048904 | Ga0496101_0002478 | Ga0496101_0002478_6002_7141 | 346 |
| 389 | 3300048905 | Ga0496102_0232139 | Ga0496102_0232139_78_1217 | 346 |
| 390 | 3300048907 | Ga0496104_0015561 | Ga0496104_0015561_5316_6455 | 346 |
| 391 | 3300048910 | Ga0496107_0155686 | Ga0496107_0155686_209_1357 | 346 |
| 392 | 3300048912 | Ga0496109_0021554 | Ga0496109_0021554_3394_4533 | 346 |
| 393 | 3300048914 | Ga0496111_0071349 | Ga0496111_0071349_913_2052 | 346 |
| 394 | 3300048915 | Ga0496112_0087432 | Ga0496112_0087432_1482_2621 | 346 |
| 395 | 3300048916 | Ga0496113_0022283 | Ga0496113_0022283_2216_3355 | 346 |
| 396 | 3300048918 | Ga0496115_0017860 | Ga0496115_0017860_4099_5238 | 346 |
| 397 | 3300048924 | Ga0496121_0053941 | Ga0496121_0053941_780_1820 | 346 |
| 398 | 3300048927 | Ga0496124_0072261 | Ga0496124_0072261_1073_2113 | 346 |
| 399 | 3300048929 | Ga0496126_0005323 | Ga0496126_0005323_5827_6867 | 346 |
| 400 | 3300049583 | Ga0501067_0124092 | Ga0501067_0124092_55_1095 | 346 |
| 401 | 3300049585 | Ga0501069_0180240 | Ga0501069_0180240_129_1169 | 346 |
| 402 | 3300050490 | nmdc:mga03n38_54981_c1 | nmdc:mga03n38_54981_c1_35_1183 | 346 |
| 403 | 3300050492 | nmdc:mga0yw44_64602_c1 | nmdc:mga0yw44_64602_c1_984_2024 | 346 |
| 404 | 3300050494 | nmdc:mga06z11_12019_c1 | nmdc:mga06z11_12019_c1_337_1377 | 346 |
| 405 | 3300050495 | nmdc:mga04h51_65546_c1 | nmdc:mga04h51_65546_c1_57_1205 | 346 |
| 406 | 3300050496 | nmdc:mga07m45_3870_c1 | nmdc:mga07m45_3870_c1_1575_2615 | 346 |
| 407 | 3300053096 | Ga0500641_0089724 | Ga0500641_0089724_215_1255 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3trd-assembly1.cif.gz_A | structure of an alpha-beta serine hydrolase homologue from coxiella burnetii | 0.7982 | 30 | 340 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.7868 | 26 | 342 |
| 3jwe-assembly1.cif.gz_A | crystal structure of human mono-glyceride lipase in complex with sar629 | 0.7829 | 34 | 342 |
| 3bdi-assembly1.cif.gz_A | crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution | 0.7798 | 26 | 342 |
| 6eic-assembly3.cif.gz_B | crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis | 0.7783 | 26 | 342 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4IBE6_136_370_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7989 | 19 | 178 | 3.40.50.1820 |
| 3trdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7982 | 30 | 340 | 3.40.50.1820 |
| 2hdwB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7893 | 27 | 342 | 3.40.50.1820 |
| af_Q54H73_43_283_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7811 | 29 | 342 | 3.40.50.1820 |
| af_P9WLC7_41_273_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7791 | 29 | 339 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A191UIH0-F1-model_v4 | Alpha/beta hydrolase | 0.9884 | 30 | 341 |
GO:0016020
GO:0016042 GO:0016787 |
| AF-A0A1R0HDR4-F1-model_v4 | deleted | 0.9872 | 30 | 341 |
|
| AF-A0A7V8BLH7-F1-model_v4 | Alpha/beta hydrolase | 0.9779 | 16 | 341 |
GO:0016020
GO:0016787 |
| AF-A0A850FGC5-F1-model_v4 | Alpha/beta fold hydrolase | 0.9771 | 27 | 341 |
GO:0016020
GO:0016787 |
| AF-F5LBV4-F1-model_v4 | Hydrolase, alpha/beta domain protein | 0.9753 | 64 | 341 |
GO:0016020
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar