F436507

General Info

Members Datasets Scaffolds Average Seq Length
407 251 397 347

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0762505|Ga0436365_0762505_5077_6246
Length 389
Sequence MTLIQQLASREGVRFGASSLNPLNRALSLRQFGEKPGSKGGQFMQAPVLVGLLAAVLFGTSALAQSKPPLVTEEAMVATSDPGIEIYVRNKRPADMAAFRPEQTVLFVHGATYPAETAFDLKLDGLSWMEYIASRGYDVWLLDVRGYGQSTRPPEMAEKAEANPPIVTGETAVKDIGVAVDYILQRRKIPKLDLLGWSWGTTLMATYTTQNPSKVERLVLYAPAWIRQTPSLVQAGSGKLGAYRMVTREQAKERWYAGVADDQKGSLIPPGWFDAWADATFATDPVGAAMNPPVVRAPNGVIQDGQQFSGAGKAYYDPSKITVPTLLVHAEWDRDTPPYMAQTLFPLLVNSSGKRYVELAEGTHSIIMEKSRLKLFDAVQAFLDEGRRD

Samples

Sample ID Description Type Environment
1 2791355199
2 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
3 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
4 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
5 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
248 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
249 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
250 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
251 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.85
Nodule 1.47
Rhizoplane 3.69
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10013837 3300003320 Bacteria 1884
2 JGI25404J52841_10004005 3300003659 Bacteria 2959
3 Ga0055526_1003541 3300003771 Bacteria 9848
4 Ga0055537_1000037 3300003773 Bacteria 95236
5 Ga0055524_1019482 3300003775 Bacteria 2317
6 Ga0055534_1000038 3300003784 Bacteria 105771
7 Ga0055528_1000071 3300003790 Bacteria 78628
8 Ga0070658_10006510 3300005327 Bacteria 9471
9 Ga0070658_10070438 3300005327 Bacteria 2863
10 Ga0070676_10003591 3300005328 Bacteria 8106
11 Ga0070690_100010715 3300005330 Bacteria 5345
12 Ga0068869_100001419 3300005334 Bacteria 14188
13 Ga0070666_10000556 3300005335 Bacteria 22523
14 Ga0068868_100026328 3300005338 Bacteria 4431
15 Ga0068868_100112152 3300005338 Bacteria 2217
16 Ga0068868_100133041 3300005338 Bacteria 2037
17 Ga0070689_100337169 3300005340 Bacteria 1262
18 Ga0070687_100005925 3300005343 Bacteria 4972
19 Ga0070661_100263843 3300005344 Bacteria 1332
20 Ga0070692_10019119 3300005345 Bacteria 3304
21 Ga0070668_100000760 3300005347 Bacteria 22136
22 Ga0070668_100077517 3300005347 Bacteria 2598
23 Ga0070668_100220686 3300005347 Bacteria 1563
24 Ga0070669_100003414 3300005353 Bacteria 11438
25 Ga0070669_100094000 3300005353 Bacteria 2252
26 Ga0070675_100014925 3300005354 Bacteria 6134
27 Ga0070675_100194146 3300005354 Bacteria 1760
28 Ga0070671_100005544 3300005355 Bacteria 10054
29 Ga0070671_100148645 3300005355 Bacteria 1978
30 Ga0070671_100188423 3300005355 Bacteria 1748
31 Ga0070674_100002302 3300005356 Bacteria 10550
32 Ga0070673_100121069 3300005364 Bacteria 2183
33 Ga0070688_100090248 3300005365 Bacteria 2001
34 Ga0070667_100004847 3300005367 Bacteria 11273
35 Ga0070667_100065703 3300005367 Bacteria 3080
36 Ga0070713_100208139 3300005436 Bacteria 1770
37 Ga0070700_100126607 3300005441 Bacteria 1718
38 Ga0070694_100041035 3300005444 Bacteria 3085
39 Ga0070708_100036031 3300005445 Bacteria 4313
40 Ga0070663_100032102 3300005455 Bacteria 3616
41 Ga0070663_100044603 3300005455 Bacteria 3127
42 Ga0070663_100049617 3300005455 Bacteria 2982
43 Ga0070663_100066843 3300005455 Bacteria 2606
44 Ga0070678_100139905 3300005456 Bacteria 1935
45 Ga0070662_100004982 3300005457 Bacteria 8440
46 Ga0070662_100049968 3300005457 Bacteria 3016
47 Ga0070681_10341871 3300005458 Bacteria 1406
48 Ga0068867_100007955 3300005459 Bacteria 7489
49 Ga0070706_100240154 3300005467 Bacteria 1692
50 Ga0070707_100031270 3300005468 Bacteria 5070
51 Ga0070707_100092935 3300005468 Bacteria 2920
52 Ga0070698_100372738 3300005471 Bacteria 1360
53 Ga0070699_100004061 3300005518 Bacteria 12938
54 Ga0068853_100100404 3300005539 Bacteria 2558
55 Ga0068853_100267054 3300005539 Bacteria 1575
56 Ga0068853_100339246 3300005539 Bacteria 1396
57 Ga0070672_100003647 3300005543 Bacteria 10000
58 Ga0070672_100010903 3300005543 Bacteria 6322
59 Ga0070672_100151360 3300005543 Bacteria 1919
60 Ga0070686_100031357 3300005544 Bacteria 3249
61 Ga0070695_100005438 3300005545 Bacteria 7494
62 Ga0070696_100046264 3300005546 Bacteria 3016
63 Ga0070665_100037219 3300005548 Bacteria 4895
64 Ga0070665_100055733 3300005548 Bacteria 3964
65 Ga0070665_100119292 3300005548 Bacteria 2640
66 Ga0070704_100012857 3300005549 Bacteria 5178
67 Ga0070704_100094447 3300005549 Bacteria 2237
68 Ga0070704_100326398 3300005549 Bacteria 1288
69 Ga0068855_100044258 3300005563 Bacteria 5269
70 Ga0068855_100055443 3300005563 Bacteria 4655
71 Ga0068855_100068700 3300005563 Bacteria 4124
72 Ga0068855_100114827 3300005563 Bacteria 3087
73 Ga0070664_100047191 3300005564 Bacteria 3638
74 Ga0070664_100154824 3300005564 Bacteria 2025
75 Ga0070664_100283047 3300005564 Bacteria 1495
76 Ga0068857_100074821 3300005577 Bacteria 3019
77 Ga0068857_100151640 3300005577 Bacteria 2100
78 Ga0070702_100041915 3300005615 Bacteria 2571
79 Ga0068852_100016780 3300005616 Bacteria 5723
80 Ga0068852_100165819 3300005616 Bacteria 2067
81 Ga0068852_100262260 3300005616 Bacteria 1659
82 Ga0068859_100022889 3300005617 Bacteria 6265
83 Ga0068859_100034516 3300005617 Bacteria 5077
84 Ga0068859_100120079 3300005617 Bacteria 2695
85 Ga0068859_100163455 3300005617 Bacteria 2305
86 Ga0068864_100033434 3300005618 Bacteria 4372
87 Ga0068864_100109294 3300005618 Bacteria 2461
88 Ga0068864_100343496 3300005618 Bacteria 1407
89 Ga0068864_100415191 3300005618 Bacteria 1281
90 Ga0068866_10000902 3300005718 Bacteria 13094
91 Ga0068861_100004108 3300005719 Bacteria 9766
92 Ga0068863_100000783 3300005841 Bacteria 31944
93 Ga0068863_100494555 3300005841 Bacteria 1204
94 Ga0068858_100001938 3300005842 Bacteria 21099
95 Ga0068858_100254696 3300005842 Bacteria 1668
96 Ga0068858_100298318 3300005842 Bacteria 1537
97 Ga0068860_100009197 3300005843 Bacteria 9820
98 Ga0068862_100034971 3300005844 Bacteria 4253
99 Ga0068862_100111719 3300005844 Bacteria 2399
100 Ga0068862_100246231 3300005844 Bacteria 1627
101 Ga0081455_10001734 3300005937 Bacteria 26379
102 Ga0081455_10007959 3300005937 Bacteria 11084
103 Ga0081455_10034290 3300005937 Bacteria 4550
104 Ga0081455_10064387 3300005937 Bacteria 3070
105 Ga0081455_10146263 3300005937 Bacteria 1828
106 Ga0081538_10068762 3300005981 Bacteria 1966
107 Ga0081540_1001346 3300005983 Bacteria 21378
108 Ga0081540_1004896 3300005983 Bacteria 10084
109 Ga0081540_1040152 3300005983 Bacteria 2443
110 Ga0081540_1103135 3300005983 Bacteria 1224
111 Ga0081539_10096323 3300005985 Bacteria 1518
112 Ga0075368_10022953 3300006042 Bacteria 2379
113 Ga0075368_10048291 3300006042 Bacteria 1687
114 Ga0075363_100022329 3300006048 Bacteria 3198
115 Ga0075363_100069619 3300006048 Bacteria 1909
116 Ga0075362_10023881 3300006177 Bacteria 2589
117 Ga0075362_10031695 3300006177 Bacteria 2289
118 Ga0075367_10061838 3300006178 Bacteria 2235
119 Ga0075366_10039087 3300006195 Bacteria 2803
120 Ga0097621_100015005 3300006237 Bacteria 5816
121 Ga0097621_100142720 3300006237 Bacteria 2047
122 Ga0075370_10002413 3300006353 Bacteria 8656
123 Ga0075370_10026310 3300006353 Bacteria 3222
124 Ga0075370_10084875 3300006353 Bacteria 1823
125 Ga0075370_10126853 3300006353 Bacteria 1488
126 Ga0068871_100071294 3300006358 Bacteria 2857
127 Ga0068871_100167446 3300006358 Bacteria 1882
128 Ga0075428_100434958 3300006844 Unclassified 1406
129 Ga0075434_100053320 3300006871 Bacteria 4019
130 Ga0075434_100146813 3300006871 Bacteria 2379
131 Ga0075434_100217469 3300006871 Bacteria 1931
132 Ga0068865_100001184 3300006881 Bacteria 15163
133 Ga0068865_100072039 3300006881 Bacteria 2453
134 Ga0075436_100142265 3300006914 Bacteria 1686
135 Ga0097620_100022889 3300006931 Bacteria 6265
136 Ga0097620_100034517 3300006931 Bacteria 5077
137 Ga0097620_100120080 3300006931 Bacteria 2695
138 Ga0097620_100163449 3300006931 Bacteria 2305
139 Ga0075435_100000865 3300007076 Bacteria 18968
140 Ga0099794_10001213 3300007265 Bacteria 8888
141 Ga0105240_10269167 3300009093 Bacteria 1962
142 Ga0111539_10388992 3300009094 Unclassified 1624
143 Ga0105245_10005163 3300009098 Bacteria 11468
144 Ga0105245_10021203 3300009098 Bacteria 5696
145 Ga0105245_10332277 3300009098 Bacteria 1500
146 Ga0105243_10009954 3300009148 Bacteria 7227
147 Ga0105243_10042432 3300009148 Bacteria 3561
148 Ga0105243_10086143 3300009148 Bacteria 2576
149 Ga0105241_10095106 3300009174 Bacteria 2358
150 Ga0105241_10095632 3300009174 Bacteria 2352
151 Ga0105242_10007756 3300009176 Bacteria 8258
152 Ga0105242_10019124 3300009176 Bacteria 5365
153 Ga0105248_10015826 3300009177 Bacteria 8313
154 Ga0105248_10580898 3300009177 Bacteria 1264
155 Ga0105237_10007358 3300009545 Bacteria 12063
156 Ga0105237_10122606 3300009545 Bacteria 2593
157 Ga0105238_10327477 3300009551 Bacteria 1518
158 Ga0105249_10006557 3300009553 Bacteria 10128
159 Ga0105239_10043137 3300010375 Bacteria 4943
160 Ga0105239_10043263 3300010375 Bacteria 4936
161 Ga0105239_10418062 3300010375 Bacteria 1518
162 Ga0105246_10084814 3300011119 Bacteria 2267
163 Ga0157374_10062636 3300013296 Bacteria 3487
164 Ga0157378_10117339 3300013297 Bacteria 2448
165 Ga0163162_10018958 3300013306 Bacteria 6747
166 Ga0163162_10218178 3300013306 Bacteria 2037
167 Ga0157375_10005405 3300013308 Bacteria 11104
168 Ga0157375_10173559 3300013308 Bacteria 2304
169 Ga0157375_10178507 3300013308 Bacteria 2274
170 Ga0157375_10196382 3300013308 Bacteria 2173
171 Ga0163163_10031500 3300014325 Bacteria 5119
172 Ga0163163_10133232 3300014325 Bacteria 2525
173 Ga0163163_10405092 3300014325 Bacteria 1422
174 Ga0163163_10415874 3300014325 Bacteria 1403
175 Ga0157380_10004783 3300014326 Bacteria 9435
176 Ga0157380_10050504 3300014326 Bacteria 3286
177 Ga0157380_10234345 3300014326 Bacteria 1651
178 Ga0157379_10007030 3300014968 Bacteria 9725
179 Ga0157379_10285346 3300014968 Bacteria 1503
180 Ga0157376_10088500 3300014969 Bacteria 2675
181 Ga0157376_10291774 3300014969 Bacteria 1540
182 Ga0163161_10004265 3300017792 Bacteria 9968
183 Ga0163161_10040857 3300017792 Bacteria 3332
184 Ga0213876_10002735 3300021384 Bacteria 10277
185 Ga0213876_10020591 3300021384 Bacteria 3486
186 Ga0213876_10057244 3300021384 Bacteria 2058
187 Ga0209565_1000055 3300025263 Bacteria 201184
188 Ga0209673_1000040 3300025273 Bacteria 312633
189 Ga0209675_1000052 3300025291 Bacteria 201332
190 Ga0209564_1000271 3300025295 Bacteria 108422
191 Ga0209758_1015189 3300025297 Bacteria 4013
192 Ga0209758_1022421 3300025297 Bacteria 2897
193 Ga0209256_1000100 3300025299 Bacteria 201246
194 Ga0207656_10108599 3300025321 Bacteria 1280
195 Ga0207642_10001208 3300025899 Bacteria 7980
196 Ga0207688_10029560 3300025901 Bacteria 3018
197 Ga0207688_10035353 3300025901 Bacteria 2767
198 Ga0207688_10038527 3300025901 Bacteria 2653
199 Ga0207680_10008669 3300025903 Bacteria 5005
200 Ga0207680_10058600 3300025903 Bacteria 2335
201 Ga0207645_10000991 3300025907 Bacteria 23445
202 Ga0207643_10015186 3300025908 Bacteria 4190
203 Ga0207705_10030958 3300025909 Bacteria 3818
204 Ga0207705_10216337 3300025909 Bacteria 1454
205 Ga0207654_10028453 3300025911 Bacteria 3046
206 Ga0207654_10088495 3300025911 Bacteria 1882
207 Ga0207695_10353601 3300025913 Bacteria 1356
208 Ga0207671_10008175 3300025914 Bacteria 8922
209 Ga0207660_10039969 3300025917 Bacteria 3281
210 Ga0207662_10010779 3300025918 Bacteria 5052
211 Ga0207646_10031475 3300025922 Bacteria 4802
212 Ga0207681_10002446 3300025923 Bacteria 11773
213 Ga0207650_10103623 3300025925 Bacteria 2194
214 Ga0207659_10002725 3300025926 Bacteria 10535
215 Ga0207687_10106769 3300025927 Bacteria 2070
216 Ga0207687_10130952 3300025927 Bacteria 1891
217 Ga0207687_10237922 3300025927 Unclassified 1441
218 Ga0207644_10025826 3300025931 Bacteria 4041
219 Ga0207644_10175167 3300025931 Bacteria 1678
220 Ga0207706_10002990 3300025933 Bacteria 16305
221 Ga0207686_10009032 3300025934 Bacteria 5396
222 Ga0207709_10082683 3300025935 Bacteria 2074
223 Ga0207709_10086216 3300025935 Bacteria 2038
224 Ga0207669_10001042 3300025937 Bacteria 11839
225 Ga0207669_10039476 3300025937 Bacteria 2728
226 Ga0207704_10000481 3300025938 Bacteria 17780
227 Ga0207704_10321754 3300025938 Bacteria 1193
228 Ga0207691_10007506 3300025940 Bacteria 10495
229 Ga0207691_10022699 3300025940 Bacteria 5916
230 Ga0207691_10174995 3300025940 Bacteria 1878
231 Ga0207711_10033430 3300025941 Bacteria 4351
232 Ga0207711_10039567 3300025941 Bacteria 4011
233 Ga0207689_10001694 3300025942 Bacteria 20950
234 Ga0207689_10033642 3300025942 Bacteria 4258
235 Ga0207689_10040579 3300025942 Bacteria 3852
236 Ga0207689_10071767 3300025942 Bacteria 2844
237 Ga0207679_10121820 3300025945 Bacteria 2078
238 Ga0207667_10040179 3300025949 Bacteria 4981
239 Ga0207667_10081146 3300025949 Bacteria 3360
240 Ga0207667_10093070 3300025949 Bacteria 3113
241 Ga0207651_10164069 3300025960 Bacteria 1745
242 Ga0207651_10212066 3300025960 Bacteria 1560
243 Ga0207712_10058114 3300025961 Bacteria 2732
244 Ga0207668_10012830 3300025972 Bacteria 5141
245 Ga0207668_10065005 3300025972 Bacteria 2580
246 Ga0207640_10106106 3300025981 Bacteria 1981
247 Ga0207658_10000803 3300025986 Bacteria 26405
248 Ga0207658_10148088 3300025986 Bacteria 1909
249 Ga0207677_10008102 3300026023 Bacteria 5850
250 Ga0207677_10024391 3300026023 Bacteria 3757
251 Ga0207677_10041110 3300026023 Bacteria 3054
252 Ga0207677_10141502 3300026023 Bacteria 1842
253 Ga0207677_10277601 3300026023 Bacteria 1374
254 Ga0207703_10000414 3300026035 Bacteria 45564
255 Ga0207639_10029720 3300026041 Bacteria 4004
256 Ga0207639_10153799 3300026041 Bacteria 1930
257 Ga0207639_10266953 3300026041 Bacteria 1499
258 Ga0207678_10022892 3300026067 Bacteria 5469
259 Ga0207678_10028329 3300026067 Bacteria 4890
260 Ga0207678_10064629 3300026067 Bacteria 3143
261 Ga0207678_10065876 3300026067 Bacteria 3110
262 Ga0207678_10113281 3300026067 Bacteria 2314
263 Ga0207708_10109125 3300026075 Bacteria 2147
264 Ga0207702_10091238 3300026078 Bacteria 2667
265 Ga0207641_10004330 3300026088 Bacteria 12325
266 Ga0207648_10008467 3300026089 Bacteria 9955
267 Ga0207676_10009499 3300026095 Bacteria 6923
268 Ga0207676_10136668 3300026095 Bacteria 2092
269 Ga0207676_10188886 3300026095 Bacteria 1811
270 Ga0207674_10090143 3300026116 Bacteria 3058
271 Ga0207675_100001498 3300026118 Bacteria 23384
272 Ga0207683_10024289 3300026121 Bacteria 5218
273 Ga0207683_10183002 3300026121 Bacteria 1900
274 Ga0207698_10164115 3300026142 Bacteria 1947
275 Ga0209588_1008163 3300027671 Bacteria 3099
276 Ga0209813_10045961 3300027866 Bacteria 1347
277 Ga0268266_10046480 3300028379 Bacteria 3716
278 Ga0268266_10071889 3300028379 Bacteria 2999
279 Ga0268266_10082457 3300028379 Bacteria 2805
280 Ga0268266_10140767 3300028379 Bacteria 2165
281 Ga0268266_10193124 3300028379 Bacteria 1860
282 Ga0268266_10343312 3300028379 Bacteria 1402
283 Ga0268265_10055231 3300028380 Bacteria 3016
284 Ga0268265_10134932 3300028380 Bacteria 2057
285 Ga0268264_10002739 3300028381 Bacteria 15386
286 Ga0268264_10058992 3300028381 Bacteria 3215
287 Ga0268264_10082788 3300028381 Bacteria 2747
288 Ga0268264_10399025 3300028381 Bacteria 1321
289 Ga0265339_10139651 3300031249 Unclassified 1234
290 Ga0307509_10095387 3300031507 Bacteria 3030
291 Ga0307408_100072996 3300031548 Bacteria 2542
292 Ga0265314_10014682 3300031711 Bacteria 6251
293 Ga0265342_10015597 3300031712 Bacteria 4994
294 Ga0307405_10186386 3300031731 Bacteria 1494
295 Ga0307412_10080027 3300031911 Bacteria 2256
296 Ga0307409_100000446 3300031995 Bacteria 17523
297 Ga0307411_10040162 3300032005 Bacteria 2966
298 Ga0307411_10054801 3300032005 Bacteria 2620
299 Ga0307415_100050983 3300032126 Bacteria 2807
300 Ga0307510_10151719 3300033180 Bacteria 1934
301 Ga0373931_0150998 3300035691 Bacteria 1354
302 Ga0373927_0050758 3300035695 Bacteria 2683
303 Ga0373937_0009736 3300036401 Bacteria 8379
304 Ga0373937_0080091 3300036401 Bacteria 3020
305 Ga0395900_0187836 3300037418 Bacteria 2097
306 Ga0395898_0128776 3300037466 Bacteria 2425
307 Ga0395905_0015984 3300037471 Bacteria 7134
308 Ga0436365_0010208 3300039437 Bacteria 9446
309 Ga0436365_0762505 3300039437 Bacteria 6518
310 Ga0436365_1677539 3300039437 Bacteria 6665
311 Ga0436360_0173977 3300039438 Bacteria 1824
312 Ga0436361_1019152 3300039447 Bacteria 1156
313 Ga0436361_1097249 3300039447 Unclassified 1582
314 Ga0451577_0093320 3300042876 Bacteria 2688
315 Ga0466969_0023955 3300044656 Bacteria 3142
316 Ga0466972_0000454 3300044658 Bacteria 20973
317 Ga0466966_0043730 3300044684 Bacteria 2870
318 Ga0466970_0052715 3300044765 Bacteria 2172
319 Ga0466957_0039690 3300044842 Bacteria 2841
320 Ga0466967_0062964 3300045976 Bacteria 3294
321 Ga0495603_0014382 3300046455 Bacteria 4786
322 Ga0495603_0113454 3300046455 Bacteria 1580
323 Ga0495590_0049535 3300046457 Bacteria 1466
324 Ga0495594_0069505 3300046499 Bacteria 1956
325 Ga0495610_0136780 3300046512 Bacteria 1058
326 Ga0495632_0020861 3300046519 Bacteria 3540
327 Ga0495632_0037796 3300046519 Bacteria 2447
328 Ga0495644_0024829 3300046523 Bacteria 2279
329 Ga0495598_0006214 3300046537 Bacteria 2688
330 Ga0495621_0028434 3300046539 Bacteria 1900
331 Ga0495622_0048962 3300046557 Bacteria 1962
332 Ga0495633_0030968 3300046558 Bacteria 2597
333 Ga0495656_0001144 3300046615 Bacteria 8606
334 Ga0495656_0048909 3300046615 Bacteria 1799
335 Ga0495625_0049404 3300046660 Bacteria 3024
336 Ga0495625_0084400 3300046660 Bacteria 2206
337 Ga0495588_0006509 3300046674 Bacteria 5266
338 Ga0495669_0005556 3300046684 Bacteria 5260
339 Ga0495669_0020819 3300046684 Bacteria 2842
340 Ga0495589_0106610 3300046794 Bacteria 1354
341 Ga0495636_0046498 3300047318 Bacteria 1810
342 Ga0495676_0020072 3300047321 Bacteria 5872
343 Ga0495679_041278 3300047446 Bacteria 1430
344 Ga0496101_0002478 3300048904 Bacteria 11335
345 Ga0496101_0132484 3300048904 Bacteria 1894
346 Ga0496102_0060981 3300048905 Bacteria 3451
347 Ga0496102_0232139 3300048905 Bacteria 1739
348 Ga0496104_0015561 3300048907 Bacteria 6892
349 Ga0496107_0155686 3300048910 Bacteria 1692
350 Ga0496108_0090451 3300048911 Bacteria 2602
351 Ga0496109_0021554 3300048912 Bacteria 5699
352 Ga0496109_0482720 3300048912 Unclassified 1170
353 Ga0496111_0071349 3300048914 Bacteria 2528
354 Ga0496112_0087432 3300048915 Bacteria 3084
355 Ga0496113_0022283 3300048916 Bacteria 4478
356 Ga0496114_0023034 3300048917 Bacteria 5077
357 Ga0496115_0017860 3300048918 Bacteria 5433
358 Ga0496115_0329657 3300048918 Bacteria 1247
359 Ga0496121_0053941 3300048924 Bacteria 3364
360 Ga0496121_0135416 3300048924 Bacteria 1836
361 Ga0496124_0072261 3300048927 Bacteria 2857
362 Ga0496126_0005323 3300048929 Bacteria 14749
363 Ga0496126_0024597 3300048929 Bacteria 5811
364 Ga0496126_0035557 3300048929 Bacteria 4667
365 Ga0496126_0071189 3300048929 Bacteria 3096
366 Ga0501039_0127944 3300049575 Bacteria 1993
367 Ga0501048_0170897 3300049582 Bacteria 1540
368 Ga0501067_0124092 3300049583 Bacteria 1437
369 Ga0501069_0180240 3300049585 Bacteria 1221
370 Ga0501076_0371313 3300049592 Bacteria 1175
371 Ga0501235_008552 3300049669 Bacteria 2234
372 Ga0501080_0148570 3300049742 Bacteria 2167
373 Ga0501080_0403235 3300049742 Bacteria 1230
374 Ga0501081_0273045 3300049743 Bacteria 1237
375 nmdc:mga03n38_54981_c1 3300050490 Bacteria 1792
376 nmdc:mga0yw44_64602_c1 3300050492 Bacteria 2253
377 nmdc:mga0k408_72966_c1 3300050493 Bacteria 2005
378 nmdc:mga0k408_79073_c1 3300050493 Bacteria 1924
379 nmdc:mga06z11_12019_c1 3300050494 Bacteria 3753
380 nmdc:mga04h51_65546_c1 3300050495 Bacteria 1256
381 nmdc:mga07m45_3870_c1 3300050496 Bacteria 7259
382 nmdc:mga08y16_203110_c1 3300050511 Bacteria 2053
383 nmdc:mga0n895_139161_c1 3300050512 Bacteria 2455
384 nmdc:mga0n895_72306_c1 3300050512 Bacteria 3421
385 nmdc:mga0rr50_209714_c1 3300050513 Bacteria 1604
386 nmdc:mga0rr50_3774_c1 3300050513 Bacteria 8786
387 nmdc:mga08x19_280845_c1 3300050514 Bacteria 1154
388 Ga0495601_0017478 3300053077 Bacteria 4354
389 Ga0495612_0047012 3300053078 Bacteria 1768
390 Ga0500641_0089724 3300053096 Bacteria 1311
391 Ga0500595_027906 3300053119 Bacteria 1928
392 Ga0500590_059642 3300053148 Bacteria 1920
393 Ga0500645_022490 3300053730 Bacteria 1938
394 Ga0501084_0223356 3300054114 Bacteria 1589
395 Ga0501084_0400385 3300054114 Bacteria 1160
396 Ga0530510_0056853 3300061734 Bacteria 2827
397 Ga0530510_0194652 3300061734 Bacteria 1505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10237922 Ga0207687_102379222 295
2 3300049582 Ga0501048_0170897 Ga0501048_0170897_547_1440 295
3 3300049592 Ga0501076_0371313 Ga0501076_0371313_134_1027 295
4 3300048929 Ga0496126_0035557 Ga0496126_0035557_2057_3001 311
5 3300048911 Ga0496108_0090451 Ga0496108_0090451_1636_2586 314
6 3300050493 nmdc:mga0k408_79073_c1 nmdc:mga0k408_79073_c1_113_1057 314
7 3300013297 Ga0157378_10117339 Ga0157378_101173393 315
8 3300014325 Ga0163163_10133232 Ga0163163_101332323 315
9 3300046499 Ga0495594_0069505 Ga0495594_0069505_15_962 315
10 3300046512 Ga0495610_0136780 Ga0495610_0136780_51_998 315
11 3300046519 Ga0495632_0020861 Ga0495632_0020861_1349_2296 315
12 3300046519 Ga0495632_0037796 Ga0495632_0037796_1054_2001 315
13 3300046615 Ga0495656_0048909 Ga0495656_0048909_564_1511 315
14 3300046660 Ga0495625_0049404 Ga0495625_0049404_2049_2996 315
15 3300047446 Ga0495679_041278 Ga0495679_041278_27_974 315
16 3300048904 Ga0496101_0132484 Ga0496101_0132484_32_979 315
17 3300048924 Ga0496121_0135416 Ga0496121_0135416_879_1826 315
18 3300048929 Ga0496126_0071189 Ga0496126_0071189_541_1488 315
19 3300049743 Ga0501081_0273045 Ga0501081_0273045_277_1224 315
20 3300050493 nmdc:mga0k408_72966_c1 nmdc:mga0k408_72966_c1_62_1009 315
21 3300050513 nmdc:mga0rr50_209714_c1 nmdc:mga0rr50_209714_c1_619_1566 315
22 3300053119 Ga0500595_027906 Ga0500595_027906_279_1226 315
23 3300053148 Ga0500590_059642 Ga0500590_059642_460_1407 315
24 3300053730 Ga0500645_022490 Ga0500645_022490_32_979 315
25 iso_pu_bacteria 2876808645 2876816611 315
26 iso_pu_bacteria 2879110137 2879115868 315
27 3300005335 Ga0070666_10000556 Ga0070666_1000055618 317
28 3300005353 Ga0070669_100003414 Ga0070669_1000034147 317
29 3300005354 Ga0070675_100014925 Ga0070675_1000149253 317
30 3300005356 Ga0070674_100002302 Ga0070674_10000230210 317
31 3300005367 Ga0070667_100004847 Ga0070667_1000048476 317
32 3300005543 Ga0070672_100003647 Ga0070672_1000036477 317
33 3300005617 Ga0068859_100022889 Ga0068859_1000228896 317
34 3300005842 Ga0068858_100001938 Ga0068858_1000019387 317
35 3300006931 Ga0097620_100022889 Ga0097620_1000228896 317
36 3300025903 Ga0207680_10008669 Ga0207680_100086692 317
37 3300025923 Ga0207681_10002446 Ga0207681_100024467 317
38 3300025926 Ga0207659_10002725 Ga0207659_1000272510 317
39 3300025937 Ga0207669_10001042 Ga0207669_100010427 317
40 3300025940 Ga0207691_10007506 Ga0207691_1000750610 317
41 3300025941 Ga0207711_10033430 Ga0207711_100334304 317
42 3300025986 Ga0207658_10000803 Ga0207658_1000080311 317
43 3300026089 Ga0207648_10008467 Ga0207648_100084679 317
44 3300048912 Ga0496109_0482720 Ga0496109_0482720_73_1122 318
45 3300005563 Ga0068855_100044258 Ga0068855_1000442586 319
46 3300009174 Ga0105241_10095106 Ga0105241_100951063 319
47 3300010375 Ga0105239_10043263 Ga0105239_100432631 319
48 3300025297 Ga0209758_1022421 Ga0209758_10224213 319
49 3300025911 Ga0207654_10028453 Ga0207654_100284531 319
50 3300025942 Ga0207689_10033642 Ga0207689_100336427 319
51 3300026023 Ga0207677_10024391 Ga0207677_100243915 319
52 3300026041 Ga0207639_10266953 Ga0207639_102669531 319
53 3300053077 Ga0495601_0017478 Ga0495601_0017478_2337_3296 319
54 3300005545 Ga0070695_100005438 Ga0070695_1000054386 320
55 3300046455 Ga0495603_0014382 Ga0495603_0014382_3560_4522 320
56 3300046558 Ga0495633_0030968 Ga0495633_0030968_495_1457 320
57 3300048917 Ga0496114_0023034 Ga0496114_0023034_3802_4863 320
58 3300035695 Ga0373927_0050758 Ga0373927_0050758_1183_2229 324
59 3300049742 Ga0501080_0148570 Ga0501080_0148570_363_1355 324
60 3300049742 Ga0501080_0403235 Ga0501080_0403235_204_1196 324
61 3300026023 Ga0207677_10141502 Ga0207677_101415022 325
62 3300039447 Ga0436361_1019152 Ga0436361_1019152_103_1095 325
63 3300039437 Ga0436365_0010208 Ga0436365_0010208_1450_2463 326
64 3300005327 Ga0070658_10070438 Ga0070658_100704382 327
65 3300025909 Ga0207705_10216337 Ga0207705_102163372 327
66 3300031711 Ga0265314_10014682 Ga0265314_100146825 327
67 3300031712 Ga0265342_10015597 Ga0265342_100155972 327
68 3300005937 Ga0081455_10064387 Ga0081455_100643872 329
69 3300006358 Ga0068871_100071294 Ga0068871_1000712942 329
70 3300025942 Ga0207689_10040579 Ga0207689_100405796 329
71 3300005355 Ga0070671_100005544 Ga0070671_1000055446 331
72 3300005616 Ga0068852_100262260 Ga0068852_1002622602 331
73 3300006237 Ga0097621_100015005 Ga0097621_1000150054 331
74 3300014968 Ga0157379_10285346 Ga0157379_102853461 331
75 3300025925 Ga0207650_10103623 Ga0207650_101036232 331
76 3300025941 Ga0207711_10039567 Ga0207711_100395672 331
77 3300026095 Ga0207676_10136668 Ga0207676_101366682 331
78 3300046523 Ga0495644_0024829 Ga0495644_0024829_18_1013 331
79 3300046537 Ga0495598_0006214 Ga0495598_0006214_415_1410 331
80 3300046539 Ga0495621_0028434 Ga0495621_0028434_383_1378 331
81 3300046615 Ga0495656_0001144 Ga0495656_0001144_6016_7011 331
82 3300046794 Ga0495589_0106610 Ga0495589_0106610_211_1206 331
83 3300047318 Ga0495636_0046498 Ga0495636_0046498_238_1233 331
84 3300025981 Ga0207640_10106106 Ga0207640_101061063 333
85 3300028379 Ga0268266_10193124 Ga0268266_101931242 333
86 3300061734 Ga0530510_0056853 Ga0530510_0056853_305_1309 333
87 3300005937 Ga0081455_10001734 Ga0081455_1000173420 334
88 3300021384 Ga0213876_10020591 Ga0213876_100205914 335
89 3300037466 Ga0395898_0128776 Ga0395898_0128776_35_1096 335
90 3300005455 Ga0070663_100032102 Ga0070663_1000321022 337
91 3300026067 Ga0207678_10028329 Ga0207678_100283292 337
92 3300009093 Ga0105240_10269167 Ga0105240_102691671 338
93 3300037418 Ga0395900_0187836 Ga0395900_0187836_594_1637 338
94 3300037471 Ga0395905_0015984 Ga0395905_0015984_863_1906 338
95 3300005458 Ga0070681_10341871 Ga0070681_103418711 339
96 3300005539 Ga0068853_100100404 Ga0068853_1001004042 339
97 3300005549 Ga0070704_100094447 Ga0070704_1000944471 339
98 3300005563 Ga0068855_100114827 Ga0068855_1001148271 339
99 3300005842 Ga0068858_100254696 Ga0068858_1002546961 339
100 3300009094 Ga0111539_10388992 Ga0111539_103889921 339
101 3300009098 Ga0105245_10332277 Ga0105245_103322771 339
102 3300009174 Ga0105241_10095632 Ga0105241_100956322 339
103 3300009545 Ga0105237_10007358 Ga0105237_100073583 339
104 3300025911 Ga0207654_10088495 Ga0207654_100884951 339
105 3300025914 Ga0207671_10008175 Ga0207671_100081753 339
106 3300025938 Ga0207704_10321754 Ga0207704_103217541 339
107 3300025949 Ga0207667_10093070 Ga0207667_100930703 339
108 3300026041 Ga0207639_10029720 Ga0207639_100297202 339
109 3300035691 Ga0373931_0150998 Ga0373931_0150998_234_1253 339
110 3300036401 Ga0373937_0080091 Ga0373937_0080091_1576_2640 339
111 3300050512 nmdc:mga0n895_139161_c1 nmdc:mga0n895_139161_c1_594_1613 339
112 3300003775 Ga0055524_1019482 Ga0055524_10194822 341
113 3300005563 Ga0068855_100055443 Ga0068855_1000554436 341
114 3300006871 Ga0075434_100217469 Ga0075434_1002174692 341
115 3300007265 Ga0099794_10001213 Ga0099794_100012132 341
116 3300025263 Ga0209565_1000055 Ga0209565_100005564 341
117 3300025273 Ga0209673_1000040 Ga0209673_100004064 341
118 3300025291 Ga0209675_1000052 Ga0209675_1000052125 341
119 3300025295 Ga0209564_1000271 Ga0209564_100027165 341
120 3300025299 Ga0209256_1000100 Ga0209256_1000100125 341
121 3300025949 Ga0207667_10040179 Ga0207667_100401796 341
122 3300027671 Ga0209588_1008163 Ga0209588_10081634 341
123 3300042876 Ga0451577_0093320 Ga0451577_0093320_1521_2567 341
124 iso_pu_bacteria 8056967851 8056969841 341
125 3300005327 Ga0070658_10006510 Ga0070658_100065108 342
126 3300005328 Ga0070676_10003591 Ga0070676_100035913 342
127 3300005330 Ga0070690_100010715 Ga0070690_1000107155 342
128 3300005334 Ga0068869_100001419 Ga0068869_1000014198 342
129 3300005338 Ga0068868_100026328 Ga0068868_1000263285 342
130 3300005343 Ga0070687_100005925 Ga0070687_1000059255 342
131 3300005347 Ga0070668_100000760 Ga0070668_10000076016 342
132 3300005354 Ga0070675_100194146 Ga0070675_1001941462 342
133 3300005355 Ga0070671_100188423 Ga0070671_1001884231 342
134 3300005436 Ga0070713_100208139 Ga0070713_1002081392 342
135 3300005445 Ga0070708_100036031 Ga0070708_1000360313 342
136 3300005457 Ga0070662_100004982 Ga0070662_1000049825 342
137 3300005459 Ga0068867_100007955 Ga0068867_1000079554 342
138 3300005467 Ga0070706_100240154 Ga0070706_1002401542 342
139 3300005468 Ga0070707_100031270 Ga0070707_1000312703 342
140 3300005468 Ga0070707_100092935 Ga0070707_1000929355 342
141 3300005471 Ga0070698_100372738 Ga0070698_1003727381 342
142 3300005544 Ga0070686_100031357 Ga0070686_1000313573 342
143 3300005564 Ga0070664_100154824 Ga0070664_1001548242 342
144 3300005564 Ga0070664_100283047 Ga0070664_1002830471 342
145 3300005577 Ga0068857_100074821 Ga0068857_1000748213 342
146 3300005577 Ga0068857_100151640 Ga0068857_1001516403 342
147 3300005616 Ga0068852_100016780 Ga0068852_1000167805 342
148 3300005618 Ga0068864_100033434 Ga0068864_1000334345 342
149 3300005718 Ga0068866_10000902 Ga0068866_100009027 342
150 3300005719 Ga0068861_100004108 Ga0068861_1000041085 342
151 3300005841 Ga0068863_100000783 Ga0068863_10000078316 342
152 3300005843 Ga0068860_100009197 Ga0068860_1000091976 342
153 3300005844 Ga0068862_100034971 Ga0068862_1000349713 342
154 3300006844 Ga0075428_100434958 Ga0075428_1004349582 342
155 3300006871 Ga0075434_100053320 Ga0075434_1000533202 342
156 3300006881 Ga0068865_100001184 Ga0068865_1000011844 342
157 3300006914 Ga0075436_100142265 Ga0075436_1001422651 342
158 3300007076 Ga0075435_100000865 Ga0075435_1000008653 342
159 3300009545 Ga0105237_10122606 Ga0105237_101226062 342
160 3300014325 Ga0163163_10415874 Ga0163163_104158741 342
161 3300017792 Ga0163161_10004265 Ga0163161_100042656 342
162 3300025899 Ga0207642_10001208 Ga0207642_100012087 342
163 3300025903 Ga0207680_10058600 Ga0207680_100586002 342
164 3300025907 Ga0207645_10000991 Ga0207645_1000099110 342
165 3300025909 Ga0207705_10030958 Ga0207705_100309583 342
166 3300025918 Ga0207662_10010779 Ga0207662_100107792 342
167 3300025922 Ga0207646_10031475 Ga0207646_100314753 342
168 3300025927 Ga0207687_10106769 Ga0207687_101067692 342
169 3300025931 Ga0207644_10025826 Ga0207644_100258262 342
170 3300025933 Ga0207706_10002990 Ga0207706_100029905 342
171 3300025938 Ga0207704_10000481 Ga0207704_100004817 342
172 3300025942 Ga0207689_10001694 Ga0207689_1000169411 342
173 3300025945 Ga0207679_10121820 Ga0207679_101218203 342
174 3300026023 Ga0207677_10008102 Ga0207677_100081021 342
175 3300026023 Ga0207677_10277601 Ga0207677_102776012 342
176 3300026035 Ga0207703_10000414 Ga0207703_1000041447 342
177 3300026067 Ga0207678_10113281 Ga0207678_101132812 342
178 3300026078 Ga0207702_10091238 Ga0207702_100912382 342
179 3300026088 Ga0207641_10004330 Ga0207641_100043307 342
180 3300026095 Ga0207676_10009499 Ga0207676_100094995 342
181 3300026116 Ga0207674_10090143 Ga0207674_100901432 342
182 3300026118 Ga0207675_100001498 Ga0207675_10000149810 342
183 3300026142 Ga0207698_10164115 Ga0207698_101641151 342
184 3300028381 Ga0268264_10002739 Ga0268264_100027396 342
185 3300031911 Ga0307412_10080027 Ga0307412_100800272 342
186 3300031995 Ga0307409_100000446 Ga0307409_10000044612 342
187 3300032005 Ga0307411_10040162 Ga0307411_100401622 342
188 3300039438 Ga0436360_0173977 Ga0436360_0173977_688_1728 342
189 3300048918 Ga0496115_0329657 Ga0496115_0329657_161_1216 342
190 3300048929 Ga0496126_0024597 Ga0496126_0024597_2160_3215 342
191 3300049669 Ga0501235_008552 Ga0501235_008552_258_1307 342
192 3300050512 nmdc:mga0n895_72306_c1 nmdc:mga0n895_72306_c1_466_1527 342
193 3300050513 nmdc:mga0rr50_3774_c1 nmdc:mga0rr50_3774_c1_6923_7984 342
194 3300050514 nmdc:mga08x19_280845_c1 nmdc:mga08x19_280845_c1_68_1129 342
195 iso_pu_bacteria 2874604998 2874605550 342
196 iso_pu_bacteria 2889033259 2889039401 342
197 iso_pu_bacteria 8006984368 8006987883 342
198 iso_pu_bacteria 8056673599 8056676929 342
199 3300005345 Ga0070692_10019119 Ga0070692_100191193 343
200 3300005444 Ga0070694_100041035 Ga0070694_1000410351 343
201 3300005546 Ga0070696_100046264 Ga0070696_1000462643 343
202 3300005549 Ga0070704_100012857 Ga0070704_1000128575 343
203 3300005617 Ga0068859_100120079 Ga0068859_1001200792 343
204 3300005937 Ga0081455_10034290 Ga0081455_100342902 343
205 3300005983 Ga0081540_1103135 Ga0081540_11031351 343
206 3300006931 Ga0097620_100120080 Ga0097620_1001200802 343
207 3300009176 Ga0105242_10019124 Ga0105242_100191242 343
208 3300021384 Ga0213876_10002735 Ga0213876_1000273511 343
209 3300021384 Ga0213876_10057244 Ga0213876_100572443 343
210 3300025917 Ga0207660_10039969 Ga0207660_100399692 343
211 3300025934 Ga0207686_10009032 Ga0207686_100090325 343
212 3300036401 Ga0373937_0009736 Ga0373937_0009736_7141_8199 343
213 3300039437 Ga0436365_1677539 Ga0436365_1677539_2816_3850 343
214 3300044656 Ga0466969_0023955 Ga0466969_0023955_1763_2821 343
215 3300044684 Ga0466966_0043730 Ga0466966_0043730_640_1698 343
216 3300046684 Ga0495669_0020819 Ga0495669_0020819_468_1517 343
217 iso_pu_bacteria 2791355199 2793079940 343
218 iso_pu_bacteria 8006964411 8006969651 343
219 iso_pu_bacteria 8006994254 8006995660 343
220 3300005340 Ga0070689_100337169 Ga0070689_1003371692 344
221 3300005364 Ga0070673_100121069 Ga0070673_1001210692 344
222 3300005617 Ga0068859_100034516 Ga0068859_1000345163 344
223 3300005618 Ga0068864_100343496 Ga0068864_1003434962 344
224 3300005841 Ga0068863_100494555 Ga0068863_1004945551 344
225 3300005983 Ga0081540_1040152 Ga0081540_10401522 344
226 3300006931 Ga0097620_100034517 Ga0097620_1000345173 344
227 3300009098 Ga0105245_10005163 Ga0105245_100051633 344
228 3300025960 Ga0207651_10212066 Ga0207651_102120662 344
229 3300031249 Ga0265339_10139651 Ga0265339_101396511 344
230 3300046457 Ga0495590_0049535 Ga0495590_0049535_398_1432 344
231 3300046660 Ga0495625_0084400 Ga0495625_0084400_958_2019 344
232 3300053078 Ga0495612_0047012 Ga0495612_0047012_254_1294 344
233 3300054114 Ga0501084_0223356 Ga0501084_0223356_223_1257 344
234 3300054114 Ga0501084_0400385 Ga0501084_0400385_58_1098 344
235 3300061734 Ga0530510_0194652 Ga0530510_0194652_173_1213 344
236 3300003771 Ga0055526_1003541 Ga0055526_10035416 345
237 3300003773 Ga0055537_1000037 Ga0055537_100003783 345
238 3300003784 Ga0055534_1000038 Ga0055534_100003882 345
239 3300003790 Ga0055528_1000071 Ga0055528_100007166 345
240 3300005347 Ga0070668_100077517 Ga0070668_1000775173 345
241 3300005355 Ga0070671_100148645 Ga0070671_1001486452 345
242 3300005365 Ga0070688_100090248 Ga0070688_1000902482 345
243 3300005367 Ga0070667_100065703 Ga0070667_1000657032 345
244 3300005441 Ga0070700_100126607 Ga0070700_1001266072 345
245 3300005455 Ga0070663_100066843 Ga0070663_1000668432 345
246 3300005457 Ga0070662_100049968 Ga0070662_1000499681 345
247 3300005518 Ga0070699_100004061 Ga0070699_1000040613 345
248 3300005543 Ga0070672_100010903 Ga0070672_1000109032 345
249 3300005549 Ga0070704_100326398 Ga0070704_1003263981 345
250 3300005563 Ga0068855_100068700 Ga0068855_1000687003 345
251 3300005615 Ga0070702_100041915 Ga0070702_1000419153 345
252 3300005842 Ga0068858_100298318 Ga0068858_1002983182 345
253 3300005844 Ga0068862_100111719 Ga0068862_1001117191 345
254 3300006881 Ga0068865_100072039 Ga0068865_1000720391 345
255 3300009098 Ga0105245_10021203 Ga0105245_100212034 345
256 3300009148 Ga0105243_10009954 Ga0105243_100099547 345
257 3300009148 Ga0105243_10086143 Ga0105243_100861432 345
258 3300009176 Ga0105242_10007756 Ga0105242_100077563 345
259 3300009177 Ga0105248_10015826 Ga0105248_100158265 345
260 3300009177 Ga0105248_10580898 Ga0105248_105808981 345
261 3300009553 Ga0105249_10006557 Ga0105249_100065577 345
262 3300010375 Ga0105239_10418062 Ga0105239_104180621 345
263 3300013306 Ga0163162_10018958 Ga0163162_100189586 345
264 3300013308 Ga0157375_10005405 Ga0157375_100054056 345
265 3300013308 Ga0157375_10178507 Ga0157375_101785072 345
266 3300014326 Ga0157380_10004783 Ga0157380_100047836 345
267 3300014968 Ga0157379_10007030 Ga0157379_100070306 345
268 3300014969 Ga0157376_10291774 Ga0157376_102917742 345
269 3300017792 Ga0163161_10040857 Ga0163161_100408572 345
270 3300025931 Ga0207644_10175167 Ga0207644_101751672 345
271 3300025935 Ga0207709_10082683 Ga0207709_100826831 345
272 3300025937 Ga0207669_10039476 Ga0207669_100394762 345
273 3300025940 Ga0207691_10022699 Ga0207691_100226992 345
274 3300025960 Ga0207651_10164069 Ga0207651_101640691 345
275 3300025961 Ga0207712_10058114 Ga0207712_100581141 345
276 3300025972 Ga0207668_10065005 Ga0207668_100650052 345
277 3300025986 Ga0207658_10148088 Ga0207658_101480881 345
278 3300026067 Ga0207678_10064629 Ga0207678_100646292 345
279 3300026075 Ga0207708_10109125 Ga0207708_101091251 345
280 3300028379 Ga0268266_10071889 Ga0268266_100718892 345
281 3300028379 Ga0268266_10343312 Ga0268266_103433122 345
282 3300028380 Ga0268265_10134932 Ga0268265_101349322 345
283 3300028381 Ga0268264_10058992 Ga0268264_100589923 345
284 3300028381 Ga0268264_10399025 Ga0268264_103990251 345
285 3300039447 Ga0436361_1097249 Ga0436361_1097249_192_1289 345
286 3300044842 Ga0466957_0039690 Ga0466957_0039690_1275_2312 345
287 3300045976 Ga0466967_0062964 Ga0466967_0062964_1104_2141 345
288 3300046557 Ga0495622_0048962 Ga0495622_0048962_470_1507 345
289 3300046684 Ga0495669_0005556 Ga0495669_0005556_3557_4594 345
290 3300048905 Ga0496102_0060981 Ga0496102_0060981_1835_2872 345
291 3300049575 Ga0501039_0127944 Ga0501039_0127944_925_1962 345
292 3300050511 nmdc:mga08y16_203110_c1 nmdc:mga08y16_203110_c1_594_1853 345
293 3300003320 rootH2_10013837 rootH2_100138372 346
294 3300003659 JGI25404J52841_10004005 JGI25404J52841_100040051 346
295 3300005338 Ga0068868_100112152 Ga0068868_1001121522 346
296 3300005338 Ga0068868_100133041 Ga0068868_1001330412 346
297 3300005344 Ga0070661_100263843 Ga0070661_1002638431 346
298 3300005347 Ga0070668_100220686 Ga0070668_1002206861 346
299 3300005353 Ga0070669_100094000 Ga0070669_1000940002 346
300 3300005455 Ga0070663_100044603 Ga0070663_1000446033 346
301 3300005455 Ga0070663_100049617 Ga0070663_1000496172 346
302 3300005456 Ga0070678_100139905 Ga0070678_1001399052 346
303 3300005539 Ga0068853_100267054 Ga0068853_1002670542 346
304 3300005539 Ga0068853_100339246 Ga0068853_1003392462 346
305 3300005543 Ga0070672_100151360 Ga0070672_1001513602 346
306 3300005548 Ga0070665_100037219 Ga0070665_1000372194 346
307 3300005548 Ga0070665_100055733 Ga0070665_1000557332 346
308 3300005548 Ga0070665_100119292 Ga0070665_1001192922 346
309 3300005564 Ga0070664_100047191 Ga0070664_1000471912 346
310 3300005616 Ga0068852_100165819 Ga0068852_1001658192 346
311 3300005617 Ga0068859_100163455 Ga0068859_1001634552 346
312 3300005618 Ga0068864_100109294 Ga0068864_1001092942 346
313 3300005618 Ga0068864_100415191 Ga0068864_1004151911 346
314 3300005844 Ga0068862_100246231 Ga0068862_1002462311 346
315 3300005937 Ga0081455_10007959 Ga0081455_100079591 346
316 3300005937 Ga0081455_10146263 Ga0081455_101462632 346
317 3300005981 Ga0081538_10068762 Ga0081538_100687621 346
318 3300005983 Ga0081540_1001346 Ga0081540_10013463 346
319 3300005983 Ga0081540_1004896 Ga0081540_10048966 346
320 3300005985 Ga0081539_10096323 Ga0081539_100963231 346
321 3300006042 Ga0075368_10022953 Ga0075368_100229531 346
322 3300006042 Ga0075368_10048291 Ga0075368_100482912 346
323 3300006048 Ga0075363_100022329 Ga0075363_1000223294 346
324 3300006048 Ga0075363_100069619 Ga0075363_1000696191 346
325 3300006177 Ga0075362_10023881 Ga0075362_100238812 346
326 3300006177 Ga0075362_10031695 Ga0075362_100316952 346
327 3300006178 Ga0075367_10061838 Ga0075367_100618382 346
328 3300006195 Ga0075366_10039087 Ga0075366_100390872 346
329 3300006237 Ga0097621_100142720 Ga0097621_1001427202 346
330 3300006353 Ga0075370_10002413 Ga0075370_100024137 346
331 3300006353 Ga0075370_10026310 Ga0075370_100263103 346
332 3300006353 Ga0075370_10084875 Ga0075370_100848751 346
333 3300006353 Ga0075370_10126853 Ga0075370_101268531 346
334 3300006358 Ga0068871_100167446 Ga0068871_1001674461 346
335 3300006871 Ga0075434_100146813 Ga0075434_1001468132 346
336 3300006931 Ga0097620_100163449 Ga0097620_1001634492 346
337 3300009148 Ga0105243_10042432 Ga0105243_100424323 346
338 3300009551 Ga0105238_10327477 Ga0105238_103274771 346
339 3300010375 Ga0105239_10043137 Ga0105239_100431375 346
340 3300011119 Ga0105246_10084814 Ga0105246_100848142 346
341 3300013296 Ga0157374_10062636 Ga0157374_100626363 346
342 3300013306 Ga0163162_10218178 Ga0163162_102181782 346
343 3300013308 Ga0157375_10173559 Ga0157375_101735592 346
344 3300013308 Ga0157375_10196382 Ga0157375_101963821 346
345 3300014325 Ga0163163_10031500 Ga0163163_100315006 346
346 3300014325 Ga0163163_10405092 Ga0163163_104050921 346
347 3300014326 Ga0157380_10050504 Ga0157380_100505043 346
348 3300014326 Ga0157380_10234345 Ga0157380_102343451 346
349 3300014969 Ga0157376_10088500 Ga0157376_100885002 346
350 3300025297 Ga0209758_1015189 Ga0209758_10151892 346
351 3300025321 Ga0207656_10108599 Ga0207656_101085991 346
352 3300025901 Ga0207688_10029560 Ga0207688_100295603 346
353 3300025901 Ga0207688_10035353 Ga0207688_100353533 346
354 3300025901 Ga0207688_10038527 Ga0207688_100385272 346
355 3300025908 Ga0207643_10015186 Ga0207643_100151864 346
356 3300025913 Ga0207695_10353601 Ga0207695_103536011 346
357 3300025927 Ga0207687_10130952 Ga0207687_101309521 346
358 3300025935 Ga0207709_10086216 Ga0207709_100862162 346
359 3300025940 Ga0207691_10174995 Ga0207691_101749952 346
360 3300025942 Ga0207689_10071767 Ga0207689_100717672 346
361 3300025949 Ga0207667_10081146 Ga0207667_100811464 346
362 3300025972 Ga0207668_10012830 Ga0207668_100128304 346
363 3300026023 Ga0207677_10041110 Ga0207677_100411103 346
364 3300026041 Ga0207639_10153799 Ga0207639_101537992 346
365 3300026067 Ga0207678_10022892 Ga0207678_100228925 346
366 3300026067 Ga0207678_10065876 Ga0207678_100658762 346
367 3300026095 Ga0207676_10188886 Ga0207676_101888861 346
368 3300026121 Ga0207683_10024289 Ga0207683_100242894 346
369 3300026121 Ga0207683_10183002 Ga0207683_101830022 346
370 3300027866 Ga0209813_10045961 Ga0209813_100459611 346
371 3300028379 Ga0268266_10046480 Ga0268266_100464804 346
372 3300028379 Ga0268266_10082457 Ga0268266_100824571 346
373 3300028379 Ga0268266_10140767 Ga0268266_101407672 346
374 3300028380 Ga0268265_10055231 Ga0268265_100552314 346
375 3300028381 Ga0268264_10082788 Ga0268264_100827884 346
376 3300031507 Ga0307509_10095387 Ga0307509_100953874 346
377 3300031548 Ga0307408_100072996 Ga0307408_1000729963 346
378 3300031731 Ga0307405_10186386 Ga0307405_101863862 346
379 3300032005 Ga0307411_10054801 Ga0307411_100548013 346
380 3300032126 Ga0307415_100050983 Ga0307415_1000509832 346
381 3300033180 Ga0307510_10151719 Ga0307510_101517191 346
382 3300039437 Ga0436365_0762505 Ga0436365_0762505_5077_6246 346
383 3300044658 Ga0466972_0000454 Ga0466972_0000454_332_1378 346
384 3300044765 Ga0466970_0052715 Ga0466970_0052715_329_1375 346
385 3300046455 Ga0495603_0113454 Ga0495603_0113454_179_1219 346
386 3300046674 Ga0495588_0006509 Ga0495588_0006509_4048_5088 346
387 3300047321 Ga0495676_0020072 Ga0495676_0020072_1882_2922 346
388 3300048904 Ga0496101_0002478 Ga0496101_0002478_6002_7141 346
389 3300048905 Ga0496102_0232139 Ga0496102_0232139_78_1217 346
390 3300048907 Ga0496104_0015561 Ga0496104_0015561_5316_6455 346
391 3300048910 Ga0496107_0155686 Ga0496107_0155686_209_1357 346
392 3300048912 Ga0496109_0021554 Ga0496109_0021554_3394_4533 346
393 3300048914 Ga0496111_0071349 Ga0496111_0071349_913_2052 346
394 3300048915 Ga0496112_0087432 Ga0496112_0087432_1482_2621 346
395 3300048916 Ga0496113_0022283 Ga0496113_0022283_2216_3355 346
396 3300048918 Ga0496115_0017860 Ga0496115_0017860_4099_5238 346
397 3300048924 Ga0496121_0053941 Ga0496121_0053941_780_1820 346
398 3300048927 Ga0496124_0072261 Ga0496124_0072261_1073_2113 346
399 3300048929 Ga0496126_0005323 Ga0496126_0005323_5827_6867 346
400 3300049583 Ga0501067_0124092 Ga0501067_0124092_55_1095 346
401 3300049585 Ga0501069_0180240 Ga0501069_0180240_129_1169 346
402 3300050490 nmdc:mga03n38_54981_c1 nmdc:mga03n38_54981_c1_35_1183 346
403 3300050492 nmdc:mga0yw44_64602_c1 nmdc:mga0yw44_64602_c1_984_2024 346
404 3300050494 nmdc:mga06z11_12019_c1 nmdc:mga06z11_12019_c1_337_1377 346
405 3300050495 nmdc:mga04h51_65546_c1 nmdc:mga04h51_65546_c1_57_1205 346
406 3300050496 nmdc:mga07m45_3870_c1 nmdc:mga07m45_3870_c1_1575_2615 346
407 3300053096 Ga0500641_0089724 Ga0500641_0089724_215_1255 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

100

265

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

103

371

0.65

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

105

378

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7982 30 340
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7868 26 342
3jwe-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase in complex with sar629 0.7829 34 342
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7798 26 342
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.7783 26 342
ID Description Score Start End Superfamily
af_A4IBE6_136_370_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7989 19 178 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7982 30 340 3.40.50.1820
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7893 27 342 3.40.50.1820
af_Q54H73_43_283_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7811 29 342 3.40.50.1820
af_P9WLC7_41_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7791 29 339 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A191UIH0-F1-model_v4 Alpha/beta hydrolase 0.9884 30 341 GO:0016020
GO:0016042
GO:0016787
AF-A0A1R0HDR4-F1-model_v4 deleted 0.9872 30 341
AF-A0A7V8BLH7-F1-model_v4 Alpha/beta hydrolase 0.9779 16 341 GO:0016020
GO:0016787
AF-A0A850FGC5-F1-model_v4 Alpha/beta fold hydrolase 0.9771 27 341 GO:0016020
GO:0016787
AF-F5LBV4-F1-model_v4 Hydrolase, alpha/beta domain protein 0.9753 64 341 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
91.99 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map