F436479

General Info

Members Datasets Scaffolds Average Seq Length
407 212 812 395

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10108141|Ga0207688_101081411
Length 402
Sequence MNLALTDEELAFRDEMRTFFRTQIPADIREAYAHGEELGRDRMVEAQQILNAHGLAVPHWPVEWGGKDWTPVQHNIWLDELQLASVPEPLAFNANMVGPVIAAFGSQEQKEKFLPATANLDIWWCQGFSEPEAGSDLASLKTRAVRDDSGDGAWVINGSKMFTTGAHNCQYVFLITNTDPAAQKHKSLTMFLVPLDAPGIEIRGIRTVDGDRTNIVYYSDVRVDDRYRLGEVNGGWTVVREPLNAEHGAVKAADDGLADVSIMMHQAGFMAAAVDKAAAKSAIADPNGRRLIDDGSVGYRLGRSVARMEAALSSPSIFGRVALAQTMRDISPDLMDILGAASALPIGTDGAADDGAAEYVYRFAPLVGIYGGTLEVFRNMIAQYVLGLGKPNYSPPLAQKVS

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 2547132424 Nocardia nova SH22a Isolate Unclassified
202 2582580736 Prauserella sp. Am3 Isolate Unclassified
203 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
204 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
205 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
206 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
207 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
208 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
209 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
210 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
211 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
212 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.74
Nodule 0.25
Rhizoplane 8.35
Rhizosphere 66.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10108141 3300025901 Bacteria 1612
2 JGI24744J21845_10000332 3300002077 Bacteria 7953
3 Ga0055540_1000003 3300003792 Bacteria 428375
4 Ga0070676_10009059 3300005328 Bacteria 5384
5 Ga0070683_100147589 3300005329 Bacteria 2229
6 Ga0068869_100026800 3300005334 Bacteria 4014
7 Ga0070666_10072304 3300005335 Bacteria 2348
8 Ga0070682_100002179 3300005337 Bacteria 10853
9 Ga0070682_100010340 3300005337 Bacteria 5293
10 Ga0068868_100004472 3300005338 Bacteria 9807
11 Ga0070689_100006944 3300005340 Bacteria 7886
12 Ga0070691_10002442 3300005341 Bacteria 8242
13 Ga0070668_100004285 3300005347 Bacteria 10587
14 Ga0070668_100009686 3300005347 Bacteria 7145
15 Ga0070668_100232151 3300005347 Bacteria 1526
16 Ga0070669_100026088 3300005353 Bacteria 4203
17 Ga0070671_100012031 3300005355 Bacteria 6962
18 Ga0070674_100002367 3300005356 Bacteria 10408
19 Ga0070688_100005332 3300005365 Bacteria 6759
20 Ga0070667_100000087 3300005367 Bacteria 114528
21 Ga0070667_100009215 3300005367 Bacteria 8175
22 Ga0070709_10011129 3300005434 Bacteria 5003
23 Ga0070709_10047928 3300005434 Bacteria 2664
24 Ga0070709_10126377 3300005434 Bacteria 1740
25 Ga0070714_100011720 3300005435 Bacteria 6965
26 Ga0070714_100091139 3300005435 Bacteria 2670
27 Ga0070714_100264936 3300005435 Bacteria 1592
28 Ga0070713_100024597 3300005436 Bacteria 4694
29 Ga0070713_100029207 3300005436 Bacteria 4364
30 Ga0070710_10001170 3300005437 Bacteria 12378
31 Ga0070710_10018650 3300005437 Bacteria 3572
32 Ga0070701_10002772 3300005438 Bacteria 6805
33 Ga0070711_100001182 3300005439 Bacteria 14074
34 Ga0070711_100055534 3300005439 Bacteria 2736
35 Ga0070705_100002936 3300005440 Bacteria 8426
36 Ga0070700_100056028 3300005441 Bacteria 2469
37 Ga0070694_100012912 3300005444 Bacteria 5209
38 Ga0070663_100006424 3300005455 Bacteria 7070
39 Ga0070678_100000500 3300005456 Bacteria 18858
40 Ga0070662_100007398 3300005457 Bacteria 7118
41 Ga0070662_100054917 3300005457 Bacteria 2888
42 Ga0068867_100002343 3300005459 Bacteria 13335
43 Ga0068853_100001832 3300005539 Bacteria 15615
44 Ga0068853_100228710 3300005539 Bacteria 1700
45 Ga0070672_100151746 3300005543 Bacteria 1917
46 Ga0070696_100006254 3300005546 Bacteria 7969
47 Ga0070693_100013463 3300005547 Bacteria 4167
48 Ga0070665_100004632 3300005548 Bacteria 14375
49 Ga0070665_100036330 3300005548 Bacteria 4956
50 Ga0068855_100205650 3300005563 Bacteria 2215
51 Ga0068854_100002281 3300005578 Bacteria 11806
52 Ga0068854_100075691 3300005578 Bacteria 2472
53 Ga0070702_100002658 3300005615 Bacteria 7800
54 Ga0070702_100032211 3300005615 Bacteria 2875
55 Ga0068859_100001028 3300005617 Bacteria 28595
56 Ga0068859_100008906 3300005617 Bacteria 10133
57 Ga0068859_100295319 3300005617 Bacteria 1713
58 Ga0068866_10001884 3300005718 Bacteria 8775
59 Ga0068861_100000802 3300005719 Bacteria 18966
60 Ga0068863_100000179 3300005841 Bacteria 67666
61 Ga0068863_100052431 3300005841 Bacteria 3866
62 Ga0068858_100000362 3300005842 Bacteria 47914
63 Ga0068858_100002057 3300005842 Bacteria 20489
64 Ga0068858_100079652 3300005842 Bacteria 3043
65 Ga0068860_100000020 3300005843 Bacteria 283324
66 Ga0068860_100022194 3300005843 Bacteria 6145
67 Ga0068860_100036428 3300005843 Bacteria 4714
68 Ga0068862_100000013 3300005844 Bacteria 263115
69 Ga0081455_10041022 3300005937 Bacteria 4076
70 Ga0081455_10066278 3300005937 Bacteria 3016
71 Ga0075365_10005583 3300006038 Bacteria 6801
72 Ga0075365_10034847 3300006038 Bacteria 3253
73 Ga0075363_100000251 3300006048 Bacteria 15253
74 Ga0075363_100005038 3300006048 Bacteria 5846
75 Ga0075363_100059778 3300006048 Bacteria 2050
76 Ga0075363_100080380 3300006048 Bacteria 1783
77 Ga0075364_10000251 3300006051 Bacteria 25860
78 Ga0075364_10006692 3300006051 Bacteria 6794
79 Ga0075364_10011597 3300006051 Bacteria 5357
80 Ga0075364_10018714 3300006051 Bacteria 4340
81 Ga0075364_10023781 3300006051 Bacteria 3882
82 Ga0075364_10043015 3300006051 Bacteria 2936
83 Ga0075364_10045368 3300006051 Bacteria 2861
84 Ga0075364_10063558 3300006051 Bacteria 2423
85 Ga0075364_10131528 3300006051 Bacteria 1679
86 Ga0070715_10003666 3300006163 Bacteria 4934
87 Ga0070716_100005152 3300006173 Bacteria 6317
88 Ga0070716_100009317 3300006173 Bacteria 4892
89 Ga0070712_100001618 3300006175 Bacteria 13779
90 Ga0075362_10052155 3300006177 Bacteria 1832
91 Ga0075367_10006979 3300006178 Bacteria 5752
92 Ga0075367_10019128 3300006178 Bacteria 3793
93 Ga0075367_10019348 3300006178 Bacteria 3774
94 Ga0075369_10006037 3300006186 Bacteria 4564
95 Ga0075369_10010505 3300006186 Bacteria 3621
96 Ga0075369_10025931 3300006186 Bacteria 2441
97 Ga0075369_10068577 3300006186 Bacteria 1559
98 Ga0097621_100050823 3300006237 Bacteria 3372
99 Ga0075370_10163100 3300006353 Bacteria 1308
100 Ga0075428_100017380 3300006844 Bacteria 7949
101 Ga0068865_100002769 3300006881 Bacteria 10416
102 Ga0068865_100233692 3300006881 Bacteria 1444
103 Ga0097620_100001028 3300006931 Bacteria 28595
104 Ga0097620_100008906 3300006931 Bacteria 10133
105 Ga0097620_100295312 3300006931 Bacteria 1713
106 Ga0105245_10050872 3300009098 Bacteria 3714
107 Ga0105245_10198644 3300009098 Bacteria 1925
108 Ga0105247_10000009 3300009101 Bacteria 385991
109 Ga0105247_10002169 3300009101 Bacteria 13546
110 Ga0105247_10006631 3300009101 Bacteria 7152
111 Ga0114129_10031834 3300009147 Bacteria 7456
112 Ga0105243_10020952 3300009148 Bacteria 4960
113 Ga0105243_10152996 3300009148 Bacteria 1981
114 Ga0105243_10300667 3300009148 Bacteria 1454
115 Ga0105242_10059321 3300009176 Bacteria 3139
116 Ga0105248_10000207 3300009177 Bacteria 67863
117 Ga0105248_10014527 3300009177 Bacteria 8668
118 Ga0105248_10031749 3300009177 Bacteria 5901
119 Ga0105237_10027162 3300009545 Bacteria 5845
120 Ga0105249_10000057 3300009553 Bacteria 159358
121 Ga0105249_10008458 3300009553 Bacteria 8966
122 Ga0105239_10009005 3300010375 Bacteria 11297
123 Ga0105246_10041223 3300011119 Bacteria 3119
124 Ga0157374_10090731 3300013296 Bacteria 2913
125 Ga0163162_10002754 3300013306 Bacteria 16695
126 Ga0163162_10005969 3300013306 Bacteria 11789
127 Ga0163162_10129923 3300013306 Bacteria 2627
128 Ga0157375_10002051 3300013308 Bacteria 17385
129 Ga0163163_10080741 3300014325 Bacteria 3253
130 Ga0157380_10047341 3300014326 Bacteria 3382
131 Ga0157380_10052531 3300014326 Bacteria 3228
132 Ga0157377_10008849 3300014745 Bacteria 4924
133 Ga0157379_10025821 3300014968 Bacteria 5222
134 Ga0163161_10002525 3300017792 Bacteria 13055
135 Ga0163161_10027809 3300017792 Bacteria 4012
136 Ga0213876_10001956 3300021384 Bacteria 12341
137 Ga0213876_10012446 3300021384 Bacteria 4529
138 Ga0213876_10024242 3300021384 Bacteria 3202
139 Ga0213875_10009369 3300021388 Bacteria 4965
140 Ga0213875_10022192 3300021388 Bacteria 3037
141 Ga0213875_10027400 3300021388 Bacteria 2711
142 Ga0209051_1000011 3300025303 Bacteria 610828
143 Ga0207692_10000618 3300025898 Bacteria 12501
144 Ga0207692_10004015 3300025898 Bacteria 5789
145 Ga0207642_10001497 3300025899 Bacteria 7201
146 Ga0207710_10000014 3300025900 Bacteria 408072
147 Ga0207688_10007334 3300025901 Bacteria 6002
148 Ga0207680_10044756 3300025903 Bacteria 2605
149 Ga0207647_10022456 3300025904 Bacteria 4190
150 Ga0207699_10029128 3300025906 Bacteria 3076
151 Ga0207645_10057780 3300025907 Bacteria 2477
152 Ga0207693_10003177 3300025915 Bacteria 14115
153 Ga0207693_10017206 3300025915 Bacteria 5765
154 Ga0207663_10062047 3300025916 Bacteria 2374
155 Ga0207660_10208822 3300025917 Bacteria 1528
156 Ga0207694_10068340 3300025924 Bacteria 2774
157 Ga0207687_10028822 3300025927 Bacteria 3731
158 Ga0207687_10075968 3300025927 Bacteria 2412
159 Ga0207687_10197384 3300025927 Bacteria 1570
160 Ga0207664_10014132 3300025929 Bacteria 5757
161 Ga0207664_10135484 3300025929 Bacteria 2078
162 Ga0207664_10219963 3300025929 Bacteria 1646
163 Ga0207664_10237016 3300025929 Bacteria 1588
164 Ga0207644_10017810 3300025931 Bacteria 4804
165 Ga0207644_10225376 3300025931 Bacteria 1487
166 Ga0207706_10003345 3300025933 Bacteria 15338
167 Ga0207706_10026230 3300025933 Bacteria 5215
168 Ga0207686_10002402 3300025934 Bacteria 10211
169 Ga0207709_10005453 3300025935 Bacteria 7227
170 Ga0207669_10099868 3300025937 Bacteria 1915
171 Ga0207665_10001010 3300025939 Bacteria 19000
172 Ga0207691_10125242 3300025940 Bacteria 2274
173 Ga0207711_10000242 3300025941 Bacteria 58458
174 Ga0207711_10017815 3300025941 Bacteria 5901
175 Ga0207689_10025076 3300025942 Bacteria 4999
176 Ga0207661_10266600 3300025944 Bacteria 1527
177 Ga0207667_10350901 3300025949 Bacteria 1505
178 Ga0207712_10000050 3300025961 Bacteria 159469
179 Ga0207658_10000065 3300025986 Bacteria 117079
180 Ga0207658_10037243 3300025986 Bacteria 3493
181 Ga0207703_10024055 3300026035 Bacteria 4792
182 Ga0207639_10009174 3300026041 Bacteria 6817
183 Ga0207678_10007025 3300026067 Bacteria 9998
184 Ga0207708_10001771 3300026075 Bacteria 15957
185 Ga0207708_10018876 3300026075 Bacteria 5194
186 Ga0207641_10000682 3300026088 Bacteria 36701
187 Ga0207641_10038519 3300026088 Bacteria 3997
188 Ga0207648_10004710 3300026089 Bacteria 13951
189 Ga0207648_10036508 3300026089 Bacteria 4329
190 Ga0207676_10225832 3300026095 Bacteria 1671
191 Ga0207675_100002573 3300026118 Bacteria 17967
192 Ga0207683_10001516 3300026121 Bacteria 20909
193 Ga0207683_10031262 3300026121 Bacteria 4620
194 Ga0268266_10002104 3300028379 Bacteria 21995
195 Ga0268266_10011349 3300028379 Bacteria 7748
196 Ga0268266_10031723 3300028379 Bacteria 4489
197 Ga0268265_10000004 3300028380 Bacteria 648376
198 Ga0268265_10003369 3300028380 Bacteria 11509
199 Ga0268264_10000024 3300028381 Bacteria 470081
200 Ga0265327_10002298 3300031251 Bacteria 20489
201 Ga0307407_10020085 3300031903 Bacteria 3415
202 Ga0307411_10005429 3300032005 Bacteria 6261
203 Ga0373931_0007088 3300035691 Bacteria 5271
204 Ga0373931_0021628 3300035691 Bacteria 3228
205 Ga0436364_0778559 3300037853 Bacteria 4965
206 Ga0436364_0846225 3300037853 Bacteria 3027
207 Ga0436364_1228823 3300037853 Bacteria 13711
208 Ga0436364_1356824 3300037853 Bacteria 8977
209 Ga0436365_0142660 3300039437 Bacteria 17361
210 Ga0436365_0641432 3300039437 Bacteria 31945
211 Ga0436365_0772403 3300039437 Bacteria 19656
212 Ga0436365_0987088 3300039437 Bacteria 25400
213 Ga0436365_1462022 3300039437 Bacteria 1416
214 Ga0436365_1699224 3300039437 Bacteria 32267
215 Ga0436365_1889369 3300039437 Bacteria 169293
216 Ga0436363_0159981 3300039450 Bacteria 2662
217 Ga0436363_1185090 3300039450 Bacteria 1630
218 Ga0439465_0022619 3300041413 Bacteria 1975
219 Ga0466972_0037638 3300044658 Bacteria 2365
220 Ga0466972_0072230 3300044658 Bacteria 1646
221 Ga0466965_0008239 3300044683 Bacteria 4815
222 Ga0466965_0062187 3300044683 Bacteria 1867
223 Ga0466965_0078036 3300044683 Bacteria 1672
224 Ga0466966_0004041 3300044684 Bacteria 9690
225 Ga0466966_0004625 3300044684 Bacteria 9067
226 Ga0466966_0010550 3300044684 Bacteria 6141
227 Ga0466966_0014593 3300044684 Bacteria 5201
228 Ga0466966_0021032 3300044684 Bacteria 4287
229 Ga0466966_0023867 3300044684 Bacteria 4002
230 Ga0466966_0045987 3300044684 Bacteria 2789
231 Ga0466961_0006017 3300044693 Bacteria 7694
232 Ga0466961_0027566 3300044693 Bacteria 3654
233 Ga0466961_0042953 3300044693 Bacteria 2896
234 Ga0466961_0092275 3300044693 Bacteria 1911
235 Ga0466963_0025816 3300044694 Bacteria 3751
236 Ga0466971_0009945 3300044719 Bacteria 4155
237 Ga0466971_0076504 3300044719 Bacteria 1523
238 Ga0466968_0028195 3300044735 Bacteria 2314
239 Ga0466968_0036675 3300044735 Bacteria 2055
240 Ga0466970_0001308 3300044765 Bacteria 12064
241 Ga0466970_0017626 3300044765 Bacteria 3691
242 Ga0466970_0034531 3300044765 Bacteria 2678
243 Ga0466970_0071619 3300044765 Bacteria 1864
244 Ga0466957_0007883 3300044842 Bacteria 6039
245 Ga0466957_0026434 3300044842 Bacteria 3443
246 Ga0466957_0035693 3300044842 Bacteria 2984
247 Ga0466957_0165911 3300044842 Bacteria 1436
248 Ga0466960_0000107 3300044901 Bacteria 27764
249 Ga0466960_0000414 3300044901 Bacteria 14717
250 Ga0466960_0003543 3300044901 Bacteria 6013
251 Ga0466960_0011543 3300044901 Bacteria 3700
252 Ga0466960_0088472 3300044901 Bacteria 1574
253 Ga0466959_0010600 3300045049 Bacteria 6597
254 Ga0466959_0036960 3300045049 Bacteria 3607
255 Ga0466958_0005579 3300045836 Bacteria 6786
256 Ga0466958_0006221 3300045836 Bacteria 6480
257 Ga0466958_0006318 3300045836 Bacteria 6440
258 Ga0466967_0001781 3300045976 Bacteria 12890
259 Ga0466967_0031796 3300045976 Bacteria 4449
260 Ga0466967_0061630 3300045976 Bacteria 3328
261 Ga0466967_0062037 3300045976 Bacteria 3317
262 Ga0466967_0121810 3300045976 Bacteria 2411
263 Ga0495603_0050758 3300046455 Bacteria 2466
264 Ga0495638_0000482 3300046460 Bacteria 47851
265 Ga0495638_0012315 3300046460 Bacteria 5866
266 Ga0495582_0024191 3300046473 Bacteria 3322
267 Ga0495634_0115075 3300046642 Bacteria 1726
268 Ga0495674_0012792 3300047319 Bacteria 7902
269 Ga0495672_0015063 3300047320 Bacteria 5263
270 Ga0495686_0002741 3300047472 Bacteria 16101
271 Ga0496100_0006932 3300048903 Bacteria 6211
272 Ga0496100_0011278 3300048903 Bacteria 5084
273 Ga0496100_0072082 3300048903 Bacteria 2308
274 Ga0496101_0004603 3300048904 Bacteria 8710
275 Ga0496101_0026183 3300048904 Bacteria 4054
276 Ga0496101_0035316 3300048904 Bacteria 3535
277 Ga0496101_0053025 3300048904 Bacteria 2925
278 Ga0496101_0111774 3300048904 Bacteria 2057
279 Ga0496102_0000388 3300048905 Bacteria 51859
280 Ga0496102_0000845 3300048905 Bacteria 29432
281 Ga0496102_0017502 3300048905 Bacteria 6277
282 Ga0496102_0022462 3300048905 Bacteria 5590
283 Ga0496102_0023926 3300048905 Bacteria 5429
284 Ga0496102_0090412 3300048905 Bacteria 2833
285 Ga0496103_0000818 3300048906 Bacteria 22805
286 Ga0496103_0002924 3300048906 Bacteria 10582
287 Ga0496104_0000946 3300048907 Bacteria 24980
288 Ga0496104_0049301 3300048907 Bacteria 3971
289 Ga0496105_0023585 3300048908 Bacteria 4992
290 Ga0496105_0251502 3300048908 Bacteria 1431
291 Ga0496106_0013522 3300048909 Bacteria 6027
292 Ga0496106_0164562 3300048909 Bacteria 1755
293 Ga0496107_0003254 3300048910 Bacteria 10812
294 Ga0496109_0029667 3300048912 Bacteria 4900
295 Ga0496112_0000544 3300048915 Bacteria 25835
296 Ga0496112_0014419 3300048915 Bacteria 7331
297 Ga0496112_0078667 3300048915 Bacteria 3261
298 Ga0496112_0128548 3300048915 Bacteria 2504
299 Ga0496112_0207680 3300048915 Bacteria 1916
300 Ga0496113_0067418 3300048916 Bacteria 2713
301 Ga0496113_0084384 3300048916 Bacteria 2439
302 Ga0496113_0187400 3300048916 Bacteria 1642
303 Ga0496114_0000231 3300048917 Bacteria 40742
304 Ga0496115_0000317 3300048918 Bacteria 41021
305 Ga0496116_0054341 3300048919 Bacteria 2639
306 Ga0496117_0003589 3300048920 Bacteria 17902
307 Ga0496118_0000029 3300048921 Bacteria 340978
308 Ga0496118_0000236 3300048921 Bacteria 97321
309 Ga0496118_0000514 3300048921 Bacteria 63548
310 Ga0496119_0001677 3300048922 Bacteria 25898
311 Ga0496121_0072072 3300048924 Bacteria 2774
312 Ga0496123_0007115 3300048926 Bacteria 10627
313 Ga0496124_0014655 3300048927 Bacteria 7568
314 Ga0496125_0009543 3300048928 Bacteria 9953
315 Ga0496126_0004696 3300048929 Bacteria 16140
316 Ga0496126_0006601 3300048929 Bacteria 12915
317 Ga0496126_0037584 3300048929 Bacteria 4516
318 Ga0496126_0039132 3300048929 Bacteria 4403
319 Ga0501032_0000706 3300049569 Bacteria 27189
320 Ga0501032_0003536 3300049569 Bacteria 11921
321 Ga0501032_0012400 3300049569 Bacteria 6091
322 Ga0501033_0019046 3300049570 Bacteria 5190
323 Ga0501033_0024955 3300049570 Bacteria 4505
324 Ga0501033_0034299 3300049570 Bacteria 3808
325 Ga0501034_0002643 3300049571 Bacteria 21229
326 Ga0501034_0005365 3300049571 Bacteria 14032
327 Ga0501034_0028141 3300049571 Bacteria 5717
328 Ga0501034_0309263 3300049571 Bacteria 1515
329 Ga0501036_0027264 3300049572 Bacteria 4827
330 Ga0501036_0058213 3300049572 Bacteria 3274
331 Ga0501037_0007917 3300049573 Bacteria 7787
332 Ga0501037_0011656 3300049573 Bacteria 6472
333 Ga0501037_0016413 3300049573 Bacteria 5450
334 Ga0501038_0013246 3300049574 Bacteria 7520
335 Ga0501039_0000342 3300049575 Bacteria 33472
336 Ga0501043_0000206 3300049579 Bacteria 54177
337 Ga0501046_0000699 3300049580 Bacteria 32420
338 Ga0501046_0044976 3300049580 Bacteria 3509
339 Ga0501047_0012171 3300049581 Bacteria 8143
340 Ga0501047_0061297 3300049581 Bacteria 3629
341 Ga0501047_0118553 3300049581 Bacteria 2529
342 Ga0501048_0006295 3300049582 Bacteria 9026
343 Ga0501069_0038331 3300049585 Bacteria 2646
344 Ga0501070_0000213 3300049586 Bacteria 55004
345 Ga0501070_0002796 3300049586 Bacteria 15235
346 Ga0501035_0000340 3300049822 Bacteria 54226
347 Ga0501035_0002802 3300049822 Bacteria 16852
348 Ga0501035_0012718 3300049822 Bacteria 7777
349 Ga0501035_0066513 3300049822 Bacteria 3198
350 Ga0501035_0172482 3300049822 Bacteria 1868
351 Ga0501044_0000380 3300049823 Bacteria 55272
352 Ga0501044_0001631 3300049823 Bacteria 26304
353 Ga0501044_0017582 3300049823 Bacteria 7669
354 Ga0501044_0171634 3300049823 Bacteria 2140
355 Ga0501044_0206905 3300049823 Bacteria 1918
356 nmdc:mga03n38_12556_c1 3300050490 Bacteria 3192
357 nmdc:mga03n38_15397_c1 3300050490 Bacteria 2952
358 nmdc:mga03n38_64947_c1 3300050490 Bacteria 1672
359 nmdc:mga03n38_799_c1 3300050490 Bacteria 8371
360 nmdc:mga03n38_8760_c1 3300050490 Bacteria 3646
361 nmdc:mga00v17_120158_c1 3300050491 Bacteria 1672
362 nmdc:mga00v17_120951_c1 3300050491 Bacteria 1667
363 nmdc:mga00v17_19299_c1 3300050491 Bacteria 3891
364 nmdc:mga00v17_23865_c1 3300050491 Bacteria 3542
365 nmdc:mga00v17_34559_c1 3300050491 Bacteria 3004
366 nmdc:mga00v17_5728_c1 3300050491 Bacteria 6564
367 nmdc:mga00v17_66186_c1 3300050491 Bacteria 2231
368 nmdc:mga0yw44_108485_c1 3300050492 Bacteria 1776
369 nmdc:mga0yw44_162400_c1 3300050492 Bacteria 1463
370 nmdc:mga0yw44_1784_c1 3300050492 Bacteria 8779
371 nmdc:mga0yw44_20775_c1 3300050492 Bacteria 3650
372 nmdc:mga0yw44_63655_c1 3300050492 Bacteria 2268
373 nmdc:mga0yw44_64109_c1 3300050492 Bacteria 2261
374 nmdc:mga0k408_58678_c1 3300050493 Bacteria 2235
375 nmdc:mga06z11_18018_c1 3300050494 Bacteria 3218
376 nmdc:mga06z11_20816_c1 3300050494 Bacteria 3037
377 nmdc:mga06z11_64355_c1 3300050494 Bacteria 1921
378 nmdc:mga07m45_110546_c1 3300050496 Bacteria 1582
379 nmdc:mga0qj67_154497_c1 3300050509 Bacteria 1862
380 nmdc:mga0qj67_31716_c1 3300050509 Bacteria 4118
381 nmdc:mga0sz30_10190_c1 3300050516 Bacteria 3596
382 nmdc:mga0sz30_5650_c2 3300050516 Bacteria 2714
383 Ga0500635_0002016 3300053080 Bacteria 4962
384 Ga0500643_001012 3300053087 Bacteria 17174
385 Ga0500562_002169 3300053108 Bacteria 4906
386 Ga0500652_000173 3300053131 Bacteria 24995
387 Ga0500652_008049 3300053131 Bacteria 3492
388 Ga0500658_0135051 3300053134 Bacteria 1103
389 Ga0500616_0005655 3300053153 Bacteria 8433
390 Ga0500616_0012601 3300053153 Bacteria 4946
391 Ga0500645_000123 3300053730 Bacteria 61404
392 Ga0466962_0004573 3300061719 Bacteria 6642
393 Ga0466962_0061330 3300061719 Bacteria 1795
394 Ga0466962_0158551 3300061719 Bacteria 1099
395 2548695568 2547132424 Bacteria 8348532
396 2583150207 2582580736 Bacteria 5325865
397 2644636029 2643221715 Bacteria 6671032
398 2738667003 2738541264 Bacteria 5935393
399 2739145847 2738541356 Bacteria 5935017
400 2739328752 2738543028 Bacteria 6917070
401 2842138672 2842134933 Bacteria 5847019
402 2902804043 2902799365 Bacteria 5419524
403 2902815541 2902810491 Bacteria 6794147
404 2917739626 2917736166 Bacteria 9690793
405 2929214596 2929212328 Bacteria 7708288
406 2939586468 2939582691 Bacteria 7088898
407 Ga0207688_10108141
408 JGI24744J21845_10000332
409 Ga0055540_1000003
410 Ga0070676_10009059
411 Ga0070683_100147589
412 Ga0068869_100026800
413 Ga0070666_10072304
414 Ga0070682_100002179
415 Ga0070682_100010340
416 Ga0068868_100004472
417 Ga0070689_100006944
418 Ga0070691_10002442
419 Ga0070668_100004285
420 Ga0070668_100009686
421 Ga0070668_100232151
422 Ga0070669_100026088
423 Ga0070671_100012031
424 Ga0070674_100002367
425 Ga0070688_100005332
426 Ga0070667_100000087
427 Ga0070667_100009215
428 Ga0070709_10011129
429 Ga0070709_10047928
430 Ga0070709_10126377
431 Ga0070714_100011720
432 Ga0070714_100091139
433 Ga0070714_100264936
434 Ga0070713_100024597
435 Ga0070713_100029207
436 Ga0070710_10001170
437 Ga0070710_10018650
438 Ga0070701_10002772
439 Ga0070711_100001182
440 Ga0070711_100055534
441 Ga0070705_100002936
442 Ga0070700_100056028
443 Ga0070694_100012912
444 Ga0070663_100006424
445 Ga0070678_100000500
446 Ga0070662_100007398
447 Ga0070662_100054917
448 Ga0068867_100002343
449 Ga0068853_100001832
450 Ga0068853_100228710
451 Ga0070672_100151746
452 Ga0070696_100006254
453 Ga0070693_100013463
454 Ga0070665_100004632
455 Ga0070665_100036330
456 Ga0068855_100205650
457 Ga0068854_100002281
458 Ga0068854_100075691
459 Ga0070702_100002658
460 Ga0070702_100032211
461 Ga0068859_100001028
462 Ga0068859_100008906
463 Ga0068859_100295319
464 Ga0068866_10001884
465 Ga0068861_100000802
466 Ga0068863_100000179
467 Ga0068863_100052431
468 Ga0068858_100000362
469 Ga0068858_100002057
470 Ga0068858_100079652
471 Ga0068860_100000020
472 Ga0068860_100022194
473 Ga0068860_100036428
474 Ga0068862_100000013
475 Ga0081455_10041022
476 Ga0081455_10066278
477 Ga0075365_10005583
478 Ga0075365_10034847
479 Ga0075363_100000251
480 Ga0075363_100005038
481 Ga0075363_100059778
482 Ga0075363_100080380
483 Ga0075364_10000251
484 Ga0075364_10006692
485 Ga0075364_10011597
486 Ga0075364_10018714
487 Ga0075364_10023781
488 Ga0075364_10043015
489 Ga0075364_10045368
490 Ga0075364_10063558
491 Ga0075364_10131528
492 Ga0070715_10003666
493 Ga0070716_100005152
494 Ga0070716_100009317
495 Ga0070712_100001618
496 Ga0075362_10052155
497 Ga0075367_10006979
498 Ga0075367_10019128
499 Ga0075367_10019348
500 Ga0075369_10006037
501 Ga0075369_10010505
502 Ga0075369_10025931
503 Ga0075369_10068577
504 Ga0097621_100050823
505 Ga0075370_10163100
506 Ga0075428_100017380
507 Ga0068865_100002769
508 Ga0068865_100233692
509 Ga0097620_100001028
510 Ga0097620_100008906
511 Ga0097620_100295312
512 Ga0105245_10050872
513 Ga0105245_10198644
514 Ga0105247_10000009
515 Ga0105247_10002169
516 Ga0105247_10006631
517 Ga0114129_10031834
518 Ga0105243_10020952
519 Ga0105243_10152996
520 Ga0105243_10300667
521 Ga0105242_10059321
522 Ga0105248_10000207
523 Ga0105248_10014527
524 Ga0105248_10031749
525 Ga0105237_10027162
526 Ga0105249_10000057
527 Ga0105249_10008458
528 Ga0105239_10009005
529 Ga0105246_10041223
530 Ga0157374_10090731
531 Ga0163162_10002754
532 Ga0163162_10005969
533 Ga0163162_10129923
534 Ga0157375_10002051
535 Ga0163163_10080741
536 Ga0157380_10047341
537 Ga0157380_10052531
538 Ga0157377_10008849
539 Ga0157379_10025821
540 Ga0163161_10002525
541 Ga0163161_10027809
542 Ga0213876_10001956
543 Ga0213876_10012446
544 Ga0213876_10024242
545 Ga0213875_10009369
546 Ga0213875_10022192
547 Ga0213875_10027400
548 Ga0209051_1000011
549 Ga0207692_10000618
550 Ga0207692_10004015
551 Ga0207642_10001497
552 Ga0207710_10000014
553 Ga0207688_10007334
554 Ga0207680_10044756
555 Ga0207647_10022456
556 Ga0207699_10029128
557 Ga0207645_10057780
558 Ga0207693_10003177
559 Ga0207693_10017206
560 Ga0207663_10062047
561 Ga0207660_10208822
562 Ga0207694_10068340
563 Ga0207687_10028822
564 Ga0207687_10075968
565 Ga0207687_10197384
566 Ga0207664_10014132
567 Ga0207664_10135484
568 Ga0207664_10219963
569 Ga0207664_10237016
570 Ga0207644_10017810
571 Ga0207644_10225376
572 Ga0207706_10003345
573 Ga0207706_10026230
574 Ga0207686_10002402
575 Ga0207709_10005453
576 Ga0207669_10099868
577 Ga0207665_10001010
578 Ga0207691_10125242
579 Ga0207711_10000242
580 Ga0207711_10017815
581 Ga0207689_10025076
582 Ga0207661_10266600
583 Ga0207667_10350901
584 Ga0207712_10000050
585 Ga0207658_10000065
586 Ga0207658_10037243
587 Ga0207703_10024055
588 Ga0207639_10009174
589 Ga0207678_10007025
590 Ga0207708_10001771
591 Ga0207708_10018876
592 Ga0207641_10000682
593 Ga0207641_10038519
594 Ga0207648_10004710
595 Ga0207648_10036508
596 Ga0207676_10225832
597 Ga0207675_100002573
598 Ga0207683_10001516
599 Ga0207683_10031262
600 Ga0268266_10002104
601 Ga0268266_10011349
602 Ga0268266_10031723
603 Ga0268265_10000004
604 Ga0268265_10003369
605 Ga0268264_10000024
606 Ga0265327_10002298
607 Ga0307407_10020085
608 Ga0307411_10005429
609 Ga0373931_0007088
610 Ga0373931_0021628
611 Ga0436364_0778559
612 Ga0436364_0846225
613 Ga0436364_1228823
614 Ga0436364_1356824
615 Ga0436365_0142660
616 Ga0436365_0641432
617 Ga0436365_0772403
618 Ga0436365_0987088
619 Ga0436365_1462022
620 Ga0436365_1699224
621 Ga0436365_1889369
622 Ga0436363_0159981
623 Ga0436363_1185090
624 Ga0439465_0022619
625 Ga0466972_0037638
626 Ga0466972_0072230
627 Ga0466965_0008239
628 Ga0466965_0062187
629 Ga0466965_0078036
630 Ga0466966_0004041
631 Ga0466966_0004625
632 Ga0466966_0010550
633 Ga0466966_0014593
634 Ga0466966_0021032
635 Ga0466966_0023867
636 Ga0466966_0045987
637 Ga0466961_0006017
638 Ga0466961_0027566
639 Ga0466961_0042953
640 Ga0466961_0092275
641 Ga0466963_0025816
642 Ga0466971_0009945
643 Ga0466971_0076504
644 Ga0466968_0028195
645 Ga0466968_0036675
646 Ga0466970_0001308
647 Ga0466970_0017626
648 Ga0466970_0034531
649 Ga0466970_0071619
650 Ga0466957_0007883
651 Ga0466957_0026434
652 Ga0466957_0035693
653 Ga0466957_0165911
654 Ga0466960_0000107
655 Ga0466960_0000414
656 Ga0466960_0003543
657 Ga0466960_0011543
658 Ga0466960_0088472
659 Ga0466959_0010600
660 Ga0466959_0036960
661 Ga0466958_0005579
662 Ga0466958_0006221
663 Ga0466958_0006318
664 Ga0466967_0001781
665 Ga0466967_0031796
666 Ga0466967_0061630
667 Ga0466967_0062037
668 Ga0466967_0121810
669 Ga0495603_0050758
670 Ga0495638_0000482
671 Ga0495638_0012315
672 Ga0495582_0024191
673 Ga0495634_0115075
674 Ga0495674_0012792
675 Ga0495672_0015063
676 Ga0495686_0002741
677 Ga0496100_0006932
678 Ga0496100_0011278
679 Ga0496100_0072082
680 Ga0496101_0004603
681 Ga0496101_0026183
682 Ga0496101_0035316
683 Ga0496101_0053025
684 Ga0496101_0111774
685 Ga0496102_0000388
686 Ga0496102_0000845
687 Ga0496102_0017502
688 Ga0496102_0022462
689 Ga0496102_0023926
690 Ga0496102_0090412
691 Ga0496103_0000818
692 Ga0496103_0002924
693 Ga0496104_0000946
694 Ga0496104_0049301
695 Ga0496105_0023585
696 Ga0496105_0251502
697 Ga0496106_0013522
698 Ga0496106_0164562
699 Ga0496107_0003254
700 Ga0496109_0029667
701 Ga0496112_0000544
702 Ga0496112_0014419
703 Ga0496112_0078667
704 Ga0496112_0128548
705 Ga0496112_0207680
706 Ga0496113_0067418
707 Ga0496113_0084384
708 Ga0496113_0187400
709 Ga0496114_0000231
710 Ga0496115_0000317
711 Ga0496116_0054341
712 Ga0496117_0003589
713 Ga0496118_0000029
714 Ga0496118_0000236
715 Ga0496118_0000514
716 Ga0496119_0001677
717 Ga0496121_0072072
718 Ga0496123_0007115
719 Ga0496124_0014655
720 Ga0496125_0009543
721 Ga0496126_0004696
722 Ga0496126_0006601
723 Ga0496126_0037584
724 Ga0496126_0039132
725 Ga0501032_0000706
726 Ga0501032_0003536
727 Ga0501032_0012400
728 Ga0501033_0019046
729 Ga0501033_0024955
730 Ga0501033_0034299
731 Ga0501034_0002643
732 Ga0501034_0005365
733 Ga0501034_0028141
734 Ga0501034_0309263
735 Ga0501036_0027264
736 Ga0501036_0058213
737 Ga0501037_0007917
738 Ga0501037_0011656
739 Ga0501037_0016413
740 Ga0501038_0013246
741 Ga0501039_0000342
742 Ga0501043_0000206
743 Ga0501046_0000699
744 Ga0501046_0044976
745 Ga0501047_0012171
746 Ga0501047_0061297
747 Ga0501047_0118553
748 Ga0501048_0006295
749 Ga0501069_0038331
750 Ga0501070_0000213
751 Ga0501070_0002796
752 Ga0501035_0000340
753 Ga0501035_0002802
754 Ga0501035_0012718
755 Ga0501035_0066513
756 Ga0501035_0172482
757 Ga0501044_0000380
758 Ga0501044_0001631
759 Ga0501044_0017582
760 Ga0501044_0171634
761 Ga0501044_0206905
762 nmdc:mga03n38_12556_c1
763 nmdc:mga03n38_15397_c1
764 nmdc:mga03n38_64947_c1
765 nmdc:mga03n38_799_c1
766 nmdc:mga03n38_8760_c1
767 nmdc:mga00v17_120158_c1
768 nmdc:mga00v17_120951_c1
769 nmdc:mga00v17_19299_c1
770 nmdc:mga00v17_23865_c1
771 nmdc:mga00v17_34559_c1
772 nmdc:mga00v17_5728_c1
773 nmdc:mga00v17_66186_c1
774 nmdc:mga0yw44_108485_c1
775 nmdc:mga0yw44_162400_c1
776 nmdc:mga0yw44_1784_c1
777 nmdc:mga0yw44_20775_c1
778 nmdc:mga0yw44_63655_c1
779 nmdc:mga0yw44_64109_c1
780 nmdc:mga0k408_58678_c1
781 nmdc:mga06z11_18018_c1
782 nmdc:mga06z11_20816_c1
783 nmdc:mga06z11_64355_c1
784 nmdc:mga07m45_110546_c1
785 nmdc:mga0qj67_154497_c1
786 nmdc:mga0qj67_31716_c1
787 nmdc:mga0sz30_10190_c1
788 nmdc:mga0sz30_5650_c2
789 Ga0500635_0002016
790 Ga0500643_001012
791 Ga0500562_002169
792 Ga0500652_000173
793 Ga0500652_008049
794 Ga0500658_0135051
795 Ga0500616_0005655
796 Ga0500616_0012601
797 Ga0500645_000123
798 Ga0466962_0004573
799 Ga0466962_0061330
800 Ga0466962_0158551
801 2548695568
802 2583150207
803 2644636029
804 2738667003
805 2739145847
806 2739328752
807 2842138672
808 2902804043
809 2902815541
810 2917739626
811 2929214596
812 2939586468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

6

121

0.89

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

125

225

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wy9-assembly1.cif.gz_A-2 tcur3481-tcur3483 steroid acad g363a variant 0.7601 11 386
6wy9-assembly1.cif.gz_A-2 tcur3481-tcur3483 steroid acad g363a variant 0.7513 11 386
4x28-assembly1.cif.gz_A crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.7449 5 386
4x28-assembly1.cif.gz_B crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.7424 5 386
6wy8-assembly1.cif.gz_D tcur3481-tcur3483 steroid acad 0.7408 7 386
ID Description Score Start End Superfamily
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9311 121 227 2.40.110.10
af_P96855_462_572_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9265 124 232 2.40.110.10
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9141 121 227 2.40.110.10
2pg0A02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9066 124 227 2.40.110.10
af_Q6NWF0_171_282_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9054 124 232 2.40.110.10
ID Description Score Start End GO Terms
AF-A0A6B3I0N9-F1-model_v4 Acyl-CoA dehydrogenase 0.9702 140 240 GO:0005886
GO:0016627
AF-A0A498Q7W6-F1-model_v4 Acyl-CoA dehydrogenase FadE29 (EC 1.3.99.-) 0.9579 1 194 GO:0005886
GO:0016627
GO:0050660
AF-A0A1Z4EC23-F1-model_v4 Acyl-CoA dehydrogenase 0.9568 1 117 GO:0016627
GO:0050660
AF-A0A6G3UZU5-F1-model_v4 deleted 0.9437 1 176
AF-A0A6G3UZU5-F1-model_v4 deleted 0.9385 1 176

Map