F436469

General Info

Members Datasets Scaffolds Average Seq Length
407 244 814 334

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10170745|Ga0157377_101707451
Length 382
Sequence VQGGRPAPDAGPLTAGSAEPLAVEPDEPNQPLAAVALGGGHGLHATLSALRMLADRGVAGPVTAVVTVADDGGSSGRLRRELGVLPPGDLRMALAALAGEQLATGTASADRAATGDAPWIRLLQHRFGGTGALAGHAVGNLLLAGLMEVLDDPVTALDEVGVLVGARGRVLPMSCEPLDIEAEVTGLEDDDPHRAHRIRGQVAVASTPGRVRRVRLLPERPQACSPALAAVRSADLLLLGPGSWFTSVLPHLLVPELRDALVSSAARKVIVLNLAPEPGETAGFSPEQHLAVLAEHAPDLRVDAVLADTASVPVPDRLHRAAAALLAPGGRVHLAPIAAMDPTTPRHDPLALADALRGVLAGPDPAHTAAGVPAGAGGRRPT

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
227 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
228 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
229 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
230 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
231 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
232 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
233 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
234 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
235 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
236 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
237 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
238 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
239 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
240 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
241 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
242 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
243 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
244 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 6.63
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10170745 3300014745 Bacteria 1360
2 JGI25406J46586_10001456 3300003203 Bacteria 11158
3 rootH1_10136104 3300003316 Bacteria 1492
4 Ga0070658_10373531 3300005327 Bacteria 1222
5 Ga0070676_10069564 3300005328 Bacteria 2110
6 Ga0070690_100020742 3300005330 Bacteria 4007
7 Ga0068869_100049343 3300005334 Bacteria 3046
8 Ga0068869_100204407 3300005334 Bacteria 1559
9 Ga0070666_10004601 3300005335 Bacteria 8412
10 Ga0070680_100183212 3300005336 Bacteria 1764
11 Ga0070682_100034033 3300005337 Bacteria 3100
12 Ga0068868_100029438 3300005338 Bacteria 4205
13 Ga0068868_100136309 3300005338 Bacteria 2012
14 Ga0070660_100008059 3300005339 Bacteria 7361
15 Ga0070689_100033915 3300005340 Bacteria 3893
16 Ga0070689_100042850 3300005340 Bacteria 3476
17 Ga0070691_10009888 3300005341 Bacteria 4345
18 Ga0070692_10002741 3300005345 Bacteria 6926
19 Ga0070668_100002337 3300005347 Bacteria 13935
20 Ga0070668_100009449 3300005347 Bacteria 7234
21 Ga0070668_100314185 3300005347 Bacteria 1317
22 Ga0070669_100121249 3300005353 Bacteria 1995
23 Ga0070675_100044911 3300005354 Bacteria 3614
24 Ga0070675_100105498 3300005354 Bacteria 2378
25 Ga0070675_100289731 3300005354 Bacteria 1441
26 Ga0070671_100097045 3300005355 Bacteria 2472
27 Ga0070674_100008103 3300005356 Bacteria 6234
28 Ga0070674_100032492 3300005356 Bacteria 3466
29 Ga0070673_100054323 3300005364 Bacteria 3150
30 Ga0070673_100277137 3300005364 Bacteria 1470
31 Ga0070659_100061314 3300005366 Bacteria 2973
32 Ga0070667_100001540 3300005367 Bacteria 20661
33 Ga0070667_100189897 3300005367 Bacteria 1820
34 Ga0070709_10015994 3300005434 Bacteria 4275
35 Ga0070714_100015151 3300005435 Bacteria 6200
36 Ga0070714_100137978 3300005435 Bacteria 2186
37 Ga0070713_100028798 3300005436 Bacteria 4389
38 Ga0070710_10008590 3300005437 Bacteria 4973
39 Ga0070710_10019260 3300005437 Bacteria 3524
40 Ga0070711_100004048 3300005439 Bacteria 8621
41 Ga0070700_100099089 3300005441 Bacteria 1917
42 Ga0070694_100011138 3300005444 Bacteria 5569
43 Ga0070663_100010386 3300005455 Bacteria 5803
44 Ga0070663_100205184 3300005455 Bacteria 1540
45 Ga0070678_100040521 3300005456 Bacteria 3296
46 Ga0070685_10032171 3300005466 Bacteria 2937
47 Ga0070685_10052246 3300005466 Bacteria 2364
48 Ga0070707_100097665 3300005468 Bacteria 2845
49 Ga0070698_100221133 3300005471 Bacteria 1827
50 Ga0070679_100217395 3300005530 Bacteria 1873
51 Ga0070684_100116761 3300005535 Bacteria 2397
52 Ga0070684_100240929 3300005535 Bacteria 1652
53 Ga0070697_100146634 3300005536 Bacteria 1987
54 Ga0070672_100087669 3300005543 Bacteria 2505
55 Ga0070672_100280927 3300005543 Bacteria 1407
56 Ga0070695_100021310 3300005545 Bacteria 3964
57 Ga0070696_100094233 3300005546 Bacteria 2136
58 Ga0070693_100002784 3300005547 Bacteria 8048
59 Ga0070693_100038643 3300005547 Bacteria 2669
60 Ga0070665_100001282 3300005548 Bacteria 30106
61 Ga0070665_100227665 3300005548 Bacteria 1864
62 Ga0068855_100003817 3300005563 Bacteria 18417
63 Ga0068855_100027721 3300005563 Bacteria 6777
64 Ga0070664_100157503 3300005564 Bacteria 2007
65 Ga0068857_100043614 3300005577 Bacteria 3978
66 Ga0068854_100052557 3300005578 Bacteria 2922
67 Ga0068854_100086871 3300005578 Bacteria 2319
68 Ga0068856_100077080 3300005614 Bacteria 3303
69 Ga0068856_100081879 3300005614 Bacteria 3203
70 Ga0068856_100093874 3300005614 Bacteria 2986
71 Ga0068856_100175641 3300005614 Bacteria 2154
72 Ga0068856_100263741 3300005614 Bacteria 1738
73 Ga0070702_100005340 3300005615 Bacteria 5968
74 Ga0068852_100016146 3300005616 Bacteria 5813
75 Ga0068852_100026040 3300005616 Bacteria 4748
76 Ga0068859_100065795 3300005617 Bacteria 3658
77 Ga0068859_100134957 3300005617 Bacteria 2540
78 Ga0068859_100174024 3300005617 Bacteria 2234
79 Ga0068864_100224024 3300005618 Bacteria 1736
80 Ga0068861_100022871 3300005719 Bacteria 4506
81 Ga0068851_10047189 3300005834 Bacteria 2181
82 Ga0068851_10111702 3300005834 Bacteria 1459
83 Ga0068870_10156007 3300005840 Bacteria 1349
84 Ga0068870_10175030 3300005840 Bacteria 1284
85 Ga0068863_100005154 3300005841 Bacteria 12894
86 Ga0068863_100101464 3300005841 Bacteria 2736
87 Ga0068863_100195486 3300005841 Bacteria 1944
88 Ga0068860_100013091 3300005843 Bacteria 8142
89 Ga0068860_100034562 3300005843 Bacteria 4850
90 Ga0068862_100141490 3300005844 Bacteria 2136
91 Ga0081540_1012308 3300005983 Bacteria 5647
92 Ga0081539_10000806 3300005985 Bacteria 61012
93 Ga0081539_10102034 3300005985 Bacteria 1460
94 Ga0070717_10030434 3300006028 Bacteria 4337
95 Ga0075365_10000677 3300006038 Bacteria 13683
96 Ga0075370_10005572 3300006353 Bacteria 6275
97 Ga0075433_10008341 3300006852 Bacteria 8263
98 Ga0075434_100009727 3300006871 Bacteria 8986
99 Ga0075436_100020497 3300006914 Bacteria 4537
100 Ga0097620_100065796 3300006931 Bacteria 3658
101 Ga0097620_100134962 3300006931 Bacteria 2540
102 Ga0097620_100174024 3300006931 Bacteria 2234
103 Ga0075435_100136475 3300007076 Bacteria 2055
104 Ga0105250_10106663 3300009092 Bacteria 1145
105 Ga0105240_10025567 3300009093 Bacteria 7754
106 Ga0105240_10040890 3300009093 Bacteria 5924
107 Ga0105240_10055844 3300009093 Bacteria 4944
108 Ga0111539_10116481 3300009094 Bacteria 3133
109 Ga0105245_10048474 3300009098 Bacteria 3800
110 Ga0105245_10140065 3300009098 Bacteria 2277
111 Ga0105245_10203934 3300009098 Bacteria 1900
112 Ga0105247_10008640 3300009101 Bacteria 6210
113 Ga0105247_10194523 3300009101 Bacteria 1359
114 Ga0105243_10003908 3300009148 Bacteria 11893
115 Ga0105243_10273062 3300009148 Bacteria 1519
116 Ga0105241_10110260 3300009174 Bacteria 2202
117 Ga0105242_10170399 3300009176 Bacteria 1913
118 Ga0105248_10039080 3300009177 Bacteria 5313
119 Ga0105237_10041538 3300009545 Bacteria 4637
120 Ga0105237_10053533 3300009545 Bacteria 4047
121 Ga0105237_10201255 3300009545 Bacteria 1992
122 Ga0105237_10327630 3300009545 Bacteria 1535
123 Ga0105238_10161807 3300009551 Bacteria 2214
124 Ga0105238_10189074 3300009551 Bacteria 2036
125 Ga0105238_10362034 3300009551 Bacteria 1440
126 Ga0105249_10015908 3300009553 Bacteria 6667
127 Ga0105239_10089389 3300010375 Bacteria 3396
128 Ga0105239_10165599 3300010375 Bacteria 2472
129 Ga0105239_10321348 3300010375 Bacteria 1745
130 Ga0105246_10064823 3300011119 Bacteria 2553
131 Ga0157370_10104036 3300013104 Bacteria 2658
132 Ga0157369_10037484 3300013105 Bacteria 5308
133 Ga0157374_10024337 3300013296 Bacteria 5428
134 Ga0157378_10022284 3300013297 Bacteria 5576
135 Ga0163162_10010620 3300013306 Bacteria 8953
136 Ga0163162_10247475 3300013306 Bacteria 1914
137 Ga0157375_10116418 3300013308 Bacteria 2777
138 Ga0157375_10121103 3300013308 Bacteria 2726
139 Ga0157375_10206298 3300013308 Bacteria 2122
140 Ga0157375_10235506 3300013308 Bacteria 1990
141 Ga0163163_10010160 3300014325 Bacteria 8448
142 Ga0163163_10405166 3300014325 Bacteria 1422
143 Ga0157380_10008950 3300014326 Bacteria 7153
144 Ga0157380_10028299 3300014326 Bacteria 4271
145 Ga0157377_10113316 3300014745 Bacteria 1633
146 Ga0157379_10006873 3300014968 Bacteria 9836
147 Ga0163161_10008433 3300017792 Bacteria 7134
148 Ga0163161_10213405 3300017792 Bacteria 1492
149 Ga0213873_10000099 3300021358 Bacteria 16876
150 Ga0213875_10000073 3300021388 Bacteria 119027
151 Ga0213875_10038596 3300021388 Bacteria 2250
152 Ga0207692_10000319 3300025898 Bacteria 16677
153 Ga0207710_10158952 3300025900 Bacteria 1100
154 Ga0207688_10004622 3300025901 Bacteria 7502
155 Ga0207688_10034286 3300025901 Bacteria 2810
156 Ga0207688_10178558 3300025901 Bacteria 1265
157 Ga0207680_10023276 3300025903 Bacteria 3380
158 Ga0207647_10037047 3300025904 Bacteria 3095
159 Ga0207647_10042747 3300025904 Bacteria 2840
160 Ga0207645_10066231 3300025907 Bacteria 2309
161 Ga0207643_10010540 3300025908 Bacteria 4976
162 Ga0207643_10063003 3300025908 Bacteria 2119
163 Ga0207705_10043272 3300025909 Bacteria 3235
164 Ga0207695_10049388 3300025913 Bacteria 4435
165 Ga0207695_10435465 3300025913 Bacteria 1195
166 Ga0207671_10065055 3300025914 Bacteria 2711
167 Ga0207671_10109822 3300025914 Bacteria 2097
168 Ga0207671_10261524 3300025914 Bacteria 1362
169 Ga0207693_10000770 3300025915 Bacteria 28786
170 Ga0207663_10009835 3300025916 Bacteria 5061
171 Ga0207662_10030142 3300025918 Bacteria 3147
172 Ga0207657_10025888 3300025919 Bacteria 5402
173 Ga0207657_10063121 3300025919 Bacteria 3169
174 Ga0207694_10244150 3300025924 Bacteria 1468
175 Ga0207694_10389665 3300025924 Bacteria 1157
176 Ga0207687_10013245 3300025927 Bacteria 5384
177 Ga0207687_10023863 3300025927 Bacteria 4081
178 Ga0207687_10060113 3300025927 Bacteria 2679
179 Ga0207664_10005906 3300025929 Bacteria 8376
180 Ga0207644_10281528 3300025931 Bacteria 1335
181 Ga0207706_10041278 3300025933 Bacteria 4090
182 Ga0207686_10032820 3300025934 Bacteria 3093
183 Ga0207670_10052442 3300025936 Bacteria 2743
184 Ga0207669_10025009 3300025937 Bacteria 3219
185 Ga0207704_10038507 3300025938 Bacteria 2774
186 Ga0207665_10000093 3300025939 Bacteria 58107
187 Ga0207665_10171548 3300025939 Bacteria 1567
188 Ga0207691_10039510 3300025940 Bacteria 4365
189 Ga0207691_10053985 3300025940 Bacteria 3666
190 Ga0207689_10007599 3300025942 Bacteria 9495
191 Ga0207689_10016853 3300025942 Bacteria 6183
192 Ga0207679_10161444 3300025945 Bacteria 1835
193 Ga0207679_10165070 3300025945 Bacteria 1817
194 Ga0207667_10087653 3300025949 Bacteria 3219
195 Ga0207712_10017856 3300025961 Bacteria 4615
196 Ga0207712_10044431 3300025961 Bacteria 3071
197 Ga0207668_10017866 3300025972 Bacteria 4452
198 Ga0207668_10093341 3300025972 Bacteria 2217
199 Ga0207640_10070485 3300025981 Bacteria 2351
200 Ga0207658_10115114 3300025986 Bacteria 2133
201 Ga0207677_10035988 3300026023 Bacteria 3221
202 Ga0207639_10057232 3300026041 Bacteria 2992
203 Ga0207678_10001596 3300026067 Bacteria 20859
204 Ga0207678_10002275 3300026067 Bacteria 17389
205 Ga0207678_10055578 3300026067 Bacteria 3410
206 Ga0207678_10075685 3300026067 Bacteria 2884
207 Ga0207708_10032257 3300026075 Bacteria 3979
208 Ga0207708_10311127 3300026075 Bacteria 1283
209 Ga0207702_10015118 3300026078 Bacteria 6399
210 Ga0207702_10456305 3300026078 Bacteria 1241
211 Ga0207641_10013012 3300026088 Bacteria 6823
212 Ga0207648_10012383 3300026089 Bacteria 7986
213 Ga0207676_10243241 3300026095 Bacteria 1615
214 Ga0207674_10035010 3300026116 Bacteria 5243
215 Ga0207674_10254473 3300026116 Bacteria 1703
216 Ga0207675_100004063 3300026118 Bacteria 14170
217 Ga0207675_100009917 3300026118 Bacteria 8914
218 Ga0207683_10016591 3300026121 Bacteria 6269
219 Ga0207683_10093523 3300026121 Bacteria 2679
220 Ga0207698_10078260 3300026142 Bacteria 2654
221 Ga0207698_10143317 3300026142 Bacteria 2062
222 Ga0207698_10281494 3300026142 Bacteria 1538
223 Ga0207428_10058840 3300027907 Bacteria 3048
224 Ga0268266_10016283 3300028379 Bacteria 6355
225 Ga0268266_10110818 3300028379 Bacteria 2431
226 Ga0268265_10125983 3300028380 Bacteria 2119
227 Ga0268264_10007919 3300028381 Bacteria 8841
228 Ga0268264_10072003 3300028381 Bacteria 2930
229 Ga0307515_10135627 3300028794 Bacteria 2679
230 Ga0316177_1192103 3300030731 Bacteria 1308
231 Ga0314311_1165269 3300030733 Bacteria 1627
232 Ga0307513_10122961 3300031456 Bacteria 2558
233 Ga0307508_10107805 3300031616 Bacteria 2385
234 Ga0307413_10000161 3300031824 Bacteria 18416
235 Ga0307415_100053657 3300032126 Bacteria 2748
236 Ga0307507_10006894 3300033179 Bacteria 16944
237 Ga0307507_10008648 3300033179 Bacteria 13959
238 Ga0307507_10107671 3300033179 Bacteria 2296
239 Ga0307510_10042254 3300033180 Bacteria 4969
240 Ga0373929_0022267 3300035085 Bacteria 1292
241 Ga0373951_0004932 3300035091 Bacteria 3130
242 Ga0373952_0018306 3300035092 Bacteria 1448
243 Ga0373932_0001936 3300035112 Bacteria 5495
244 Ga0373939_0003890 3300035114 Bacteria 3514
245 Ga0373939_0060219 3300035114 Bacteria 1206
246 Ga0395905_0055029 3300037471 Bacteria 3724
247 Ga0436364_0110150 3300037853 Bacteria 14914
248 Ga0436364_0290389 3300037853 Bacteria 159315
249 Ga0436364_0528089 3300037853 Bacteria 2984
250 Ga0436365_1680286 3300039437 Bacteria 1111
251 Ga0436362_0839166 3300039453 Bacteria 12721
252 Ga0451789_0190650 3300041443 Bacteria 2199
253 Ga0451791_1709196 3300041451 Bacteria 1970
254 Ga0451797_0100677 3300041453 Bacteria 2171
255 Ga0451837_1592345 3300041494 Bacteria 2502
256 Ga0451843_1600774 3300041509 Bacteria 4440
257 Ga0451853_1705149 3300041512 Bacteria 2507
258 Ga0466969_0008659 3300044656 Bacteria 5395
259 Ga0466969_0065700 3300044656 Bacteria 1753
260 Ga0466969_0089140 3300044656 Bacteria 1464
261 Ga0466972_0000279 3300044658 Bacteria 31998
262 Ga0466972_0004539 3300044658 Bacteria 6953
263 Ga0466972_0042961 3300044658 Bacteria 2196
264 Ga0466972_0053591 3300044658 Bacteria 1942
265 Ga0466972_0067097 3300044658 Bacteria 1714
266 Ga0466972_0085730 3300044658 Bacteria 1497
267 Ga0466972_0146054 3300044658 Bacteria 1113
268 Ga0466965_0004487 3300044683 Bacteria 6211
269 Ga0466965_0021527 3300044683 Bacteria 3104
270 Ga0466965_0070786 3300044683 Bacteria 1754
271 Ga0466965_0145713 3300044683 Bacteria 1235
272 Ga0466966_0007642 3300044684 Bacteria 7164
273 Ga0466966_0012862 3300044684 Bacteria 5542
274 Ga0466966_0025884 3300044684 Bacteria 3832
275 Ga0466966_0028623 3300044684 Bacteria 3627
276 Ga0466966_0147906 3300044684 Bacteria 1434
277 Ga0466966_0175558 3300044684 Bacteria 1301
278 Ga0466966_0194029 3300044684 Bacteria 1230
279 Ga0466961_0003837 3300044693 Bacteria 9405
280 Ga0466961_0018314 3300044693 Bacteria 4503
281 Ga0466961_0041672 3300044693 Bacteria 2944
282 Ga0466961_0096875 3300044693 Bacteria 1860
283 Ga0466961_0100191 3300044693 Bacteria 1825
284 Ga0466961_0149459 3300044693 Bacteria 1459
285 Ga0466963_0002502 3300044694 Bacteria 10285
286 Ga0466963_0007851 3300044694 Bacteria 6386
287 Ga0466963_0016826 3300044694 Bacteria 4552
288 Ga0466963_0027732 3300044694 Bacteria 3629
289 Ga0466963_0060841 3300044694 Bacteria 2523
290 Ga0466963_0098276 3300044694 Bacteria 2001
291 Ga0466963_0106515 3300044694 Bacteria 1922
292 Ga0466963_0217076 3300044694 Bacteria 1339
293 Ga0466964_0057769 3300044706 Bacteria 1607
294 Ga0466971_0001602 3300044719 Bacteria 9553
295 Ga0466971_0080187 3300044719 Bacteria 1488
296 Ga0466968_0034692 3300044735 Bacteria 2107
297 Ga0466968_0047836 3300044735 Bacteria 1819
298 Ga0466970_0019920 3300044765 Bacteria 3481
299 Ga0466970_0035713 3300044765 Bacteria 2633
300 Ga0466970_0051693 3300044765 Bacteria 2193
301 Ga0466970_0225641 3300044765 Bacteria 1046
302 Ga0466957_0024020 3300044842 Bacteria 3608
303 Ga0466960_0004610 3300044901 Bacteria 5403
304 Ga0466960_0036011 3300044901 Bacteria 2316
305 Ga0466960_0106719 3300044901 Bacteria 1449
306 Ga0466959_0009906 3300045049 Bacteria 6792
307 Ga0466959_0038822 3300045049 Bacteria 3518
308 Ga0466959_0045409 3300045049 Bacteria 3235
309 Ga0466959_0123346 3300045049 Bacteria 1840
310 Ga0466958_0010422 3300045836 Bacteria 5205
311 Ga0466958_0013885 3300045836 Bacteria 4594
312 Ga0466958_0017236 3300045836 Bacteria 4172
313 Ga0466958_0033373 3300045836 Bacteria 3067
314 Ga0466958_0035417 3300045836 Bacteria 2982
315 Ga0466958_0058229 3300045836 Bacteria 2349
316 Ga0466967_0003364 3300045976 Bacteria 10406
317 Ga0466967_0003892 3300045976 Bacteria 9906
318 Ga0466967_0010628 3300045976 Bacteria 6917
319 Ga0466967_0041061 3300045976 Bacteria 3986
320 Ga0466967_0051163 3300045976 Bacteria 3619
321 Ga0466967_0055827 3300045976 Bacteria 3480
322 Ga0466967_0056780 3300045976 Bacteria 3453
323 Ga0466967_0085617 3300045976 Bacteria 2854
324 Ga0466967_0096534 3300045976 Bacteria 2696
325 Ga0466967_0166413 3300045976 Bacteria 2072
326 Ga0466967_0197136 3300045976 Bacteria 1905
327 Ga0466967_0261146 3300045976 Bacteria 1657
328 Ga0466967_0349230 3300045976 Bacteria 1431
329 Ga0495650_0012258 3300046471 Bacteria 4623
330 Ga0495652_0251116 3300046529 Bacteria 1311
331 Ga0495658_0082258 3300046683 Bacteria 1892
332 Ga0496100_0000912 3300048903 Bacteria 14084
333 Ga0496101_0001084 3300048904 Bacteria 16133
334 Ga0496101_0003938 3300048904 Bacteria 9282
335 Ga0496102_0000046 3300048905 Bacteria 184899
336 Ga0496103_0000547 3300048906 Bacteria 30035
337 Ga0496104_0188889 3300048907 Bacteria 1971
338 Ga0496104_0294077 3300048907 Bacteria 1537
339 Ga0496105_0064318 3300048908 Bacteria 3027
340 Ga0496105_0179700 3300048908 Bacteria 1733
341 Ga0496105_0184090 3300048908 Bacteria 1709
342 Ga0496106_0013433 3300048909 Bacteria 6045
343 Ga0496107_0034470 3300048910 Bacteria 3626
344 Ga0496108_0101340 3300048911 Bacteria 2456
345 Ga0496108_0198949 3300048911 Bacteria 1739
346 Ga0496109_0040102 3300048912 Bacteria 4241
347 Ga0496109_0056142 3300048912 Bacteria 3593
348 Ga0496109_0138099 3300048912 Bacteria 2279
349 Ga0496109_0210980 3300048912 Bacteria 1826
350 Ga0496110_0175048 3300048913 Bacteria 1947
351 Ga0496110_0268461 3300048913 Bacteria 1553
352 Ga0496113_0048421 3300048916 Bacteria 3162
353 Ga0496114_0058612 3300048917 Bacteria 3215
354 Ga0496114_0443076 3300048917 Bacteria 1150
355 Ga0496115_0009220 3300048918 Bacteria 7326
356 Ga0496116_0001888 3300048919 Bacteria 22637
357 Ga0496117_0000109 3300048920 Bacteria 184635
358 Ga0496118_0000132 3300048921 Bacteria 131401
359 Ga0496119_0000061 3300048922 Bacteria 171442
360 Ga0496119_0000964 3300048922 Bacteria 36896
361 Ga0496120_0003908 3300048923 Bacteria 13020
362 Ga0496120_0007535 3300048923 Bacteria 8079
363 Ga0496121_0008751 3300048924 Bacteria 11807
364 Ga0496124_0060229 3300048927 Bacteria 3185
365 Ga0496126_0002772 3300048929 Bacteria 23096
366 Ga0496126_0341766 3300048929 Bacteria 1226
367 Ga0501033_0029533 3300049570 Bacteria 4120
368 Ga0501036_0005083 3300049572 Bacteria 10646
369 Ga0501038_0000969 3300049574 Bacteria 25734
370 Ga0501042_0012636 3300049578 Bacteria 5728
371 Ga0501046_0070512 3300049580 Bacteria 2717
372 Ga0501047_0005656 3300049581 Bacteria 11768
373 Ga0501047_0179323 3300049581 Bacteria 1985
374 Ga0501035_0001333 3300049822 Bacteria 25473
375 Ga0501044_0099241 3300049823 Bacteria 2931
376 Ga0501045_0115319 3300049824 Bacteria 1993
377 nmdc:mga03683_24102_c1 3300050489 Bacteria 2378
378 nmdc:mga03n38_53971_c1 3300050490 Bacteria 1805
379 nmdc:mga0yw44_20807_c1 3300050492 Bacteria 3648
380 nmdc:mga06z11_224140_c1 3300050494 Bacteria 1099
381 nmdc:mga06z11_907_c1 3300050494 Bacteria 10772
382 nmdc:mga0n895_355060_c1 3300050512 Bacteria 1485
383 nmdc:mga0rr50_26156_c1 3300050513 Bacteria 4067
384 nmdc:mga0a205_17031_c1 3300050515 Bacteria 6803
385 Ga0500644_0000047 3300053088 Bacteria 73844
386 Ga0501082_0473530 3300060353 Bacteria 1094
387 Ga0466962_0041985 3300061719 Bacteria 2188
388 Ga0466962_0140566 3300061719 Bacteria 1169
389 2558908422 2558860112 Bacteria 9931328
390 2753073965 2751185734 Bacteria 8863695
391 2774392110 2773857762 Bacteria 5971770
392 2791909933 2791354901 Bacteria 8322202
393 2795782667 2795385470 Bacteria 8317180
394 2809195898 2808606439 Bacteria 5952208
395 2812351954 2811994878 Bacteria 5992952
396 2816510435 2816332139 Bacteria 9138787
397 2870725767 2870721527 Bacteria 9689237
398 2870785278 2870782633 Bacteria 9624083
399 2891970402 2891968417 Bacteria 5821697
400 2915363120 2915358134 Bacteria 6050864
401 2915770331 2915768154 Bacteria 8424322
402 2932399135 2932398195 Bacteria 3847976
403 2984580250 2984576629 Bacteria 4248407
404 2990259100 2990256926 Bacteria 4252839
405 8003323898 8003314358 Bacteria 10575343
406 8047716887 8047710418 Bacteria 11023148
407 8054473965 8054472261 Bacteria 7464355
408 Ga0157377_10170745
409 JGI25406J46586_10001456
410 rootH1_10136104
411 Ga0070658_10373531
412 Ga0070676_10069564
413 Ga0070690_100020742
414 Ga0068869_100049343
415 Ga0068869_100204407
416 Ga0070666_10004601
417 Ga0070680_100183212
418 Ga0070682_100034033
419 Ga0068868_100029438
420 Ga0068868_100136309
421 Ga0070660_100008059
422 Ga0070689_100033915
423 Ga0070689_100042850
424 Ga0070691_10009888
425 Ga0070692_10002741
426 Ga0070668_100002337
427 Ga0070668_100009449
428 Ga0070668_100314185
429 Ga0070669_100121249
430 Ga0070675_100044911
431 Ga0070675_100105498
432 Ga0070675_100289731
433 Ga0070671_100097045
434 Ga0070674_100008103
435 Ga0070674_100032492
436 Ga0070673_100054323
437 Ga0070673_100277137
438 Ga0070659_100061314
439 Ga0070667_100001540
440 Ga0070667_100189897
441 Ga0070709_10015994
442 Ga0070714_100015151
443 Ga0070714_100137978
444 Ga0070713_100028798
445 Ga0070710_10008590
446 Ga0070710_10019260
447 Ga0070711_100004048
448 Ga0070700_100099089
449 Ga0070694_100011138
450 Ga0070663_100010386
451 Ga0070663_100205184
452 Ga0070678_100040521
453 Ga0070685_10032171
454 Ga0070685_10052246
455 Ga0070707_100097665
456 Ga0070698_100221133
457 Ga0070679_100217395
458 Ga0070684_100116761
459 Ga0070684_100240929
460 Ga0070697_100146634
461 Ga0070672_100087669
462 Ga0070672_100280927
463 Ga0070695_100021310
464 Ga0070696_100094233
465 Ga0070693_100002784
466 Ga0070693_100038643
467 Ga0070665_100001282
468 Ga0070665_100227665
469 Ga0068855_100003817
470 Ga0068855_100027721
471 Ga0070664_100157503
472 Ga0068857_100043614
473 Ga0068854_100052557
474 Ga0068854_100086871
475 Ga0068856_100077080
476 Ga0068856_100081879
477 Ga0068856_100093874
478 Ga0068856_100175641
479 Ga0068856_100263741
480 Ga0070702_100005340
481 Ga0068852_100016146
482 Ga0068852_100026040
483 Ga0068859_100065795
484 Ga0068859_100134957
485 Ga0068859_100174024
486 Ga0068864_100224024
487 Ga0068861_100022871
488 Ga0068851_10047189
489 Ga0068851_10111702
490 Ga0068870_10156007
491 Ga0068870_10175030
492 Ga0068863_100005154
493 Ga0068863_100101464
494 Ga0068863_100195486
495 Ga0068860_100013091
496 Ga0068860_100034562
497 Ga0068862_100141490
498 Ga0081540_1012308
499 Ga0081539_10000806
500 Ga0081539_10102034
501 Ga0070717_10030434
502 Ga0075365_10000677
503 Ga0075370_10005572
504 Ga0075433_10008341
505 Ga0075434_100009727
506 Ga0075436_100020497
507 Ga0097620_100065796
508 Ga0097620_100134962
509 Ga0097620_100174024
510 Ga0075435_100136475
511 Ga0105250_10106663
512 Ga0105240_10025567
513 Ga0105240_10040890
514 Ga0105240_10055844
515 Ga0111539_10116481
516 Ga0105245_10048474
517 Ga0105245_10140065
518 Ga0105245_10203934
519 Ga0105247_10008640
520 Ga0105247_10194523
521 Ga0105243_10003908
522 Ga0105243_10273062
523 Ga0105241_10110260
524 Ga0105242_10170399
525 Ga0105248_10039080
526 Ga0105237_10041538
527 Ga0105237_10053533
528 Ga0105237_10201255
529 Ga0105237_10327630
530 Ga0105238_10161807
531 Ga0105238_10189074
532 Ga0105238_10362034
533 Ga0105249_10015908
534 Ga0105239_10089389
535 Ga0105239_10165599
536 Ga0105239_10321348
537 Ga0105246_10064823
538 Ga0157370_10104036
539 Ga0157369_10037484
540 Ga0157374_10024337
541 Ga0157378_10022284
542 Ga0163162_10010620
543 Ga0163162_10247475
544 Ga0157375_10116418
545 Ga0157375_10121103
546 Ga0157375_10206298
547 Ga0157375_10235506
548 Ga0163163_10010160
549 Ga0163163_10405166
550 Ga0157380_10008950
551 Ga0157380_10028299
552 Ga0157377_10113316
553 Ga0157379_10006873
554 Ga0163161_10008433
555 Ga0163161_10213405
556 Ga0213873_10000099
557 Ga0213875_10000073
558 Ga0213875_10038596
559 Ga0207692_10000319
560 Ga0207710_10158952
561 Ga0207688_10004622
562 Ga0207688_10034286
563 Ga0207688_10178558
564 Ga0207680_10023276
565 Ga0207647_10037047
566 Ga0207647_10042747
567 Ga0207645_10066231
568 Ga0207643_10010540
569 Ga0207643_10063003
570 Ga0207705_10043272
571 Ga0207695_10049388
572 Ga0207695_10435465
573 Ga0207671_10065055
574 Ga0207671_10109822
575 Ga0207671_10261524
576 Ga0207693_10000770
577 Ga0207663_10009835
578 Ga0207662_10030142
579 Ga0207657_10025888
580 Ga0207657_10063121
581 Ga0207694_10244150
582 Ga0207694_10389665
583 Ga0207687_10013245
584 Ga0207687_10023863
585 Ga0207687_10060113
586 Ga0207664_10005906
587 Ga0207644_10281528
588 Ga0207706_10041278
589 Ga0207686_10032820
590 Ga0207670_10052442
591 Ga0207669_10025009
592 Ga0207704_10038507
593 Ga0207665_10000093
594 Ga0207665_10171548
595 Ga0207691_10039510
596 Ga0207691_10053985
597 Ga0207689_10007599
598 Ga0207689_10016853
599 Ga0207679_10161444
600 Ga0207679_10165070
601 Ga0207667_10087653
602 Ga0207712_10017856
603 Ga0207712_10044431
604 Ga0207668_10017866
605 Ga0207668_10093341
606 Ga0207640_10070485
607 Ga0207658_10115114
608 Ga0207677_10035988
609 Ga0207639_10057232
610 Ga0207678_10001596
611 Ga0207678_10002275
612 Ga0207678_10055578
613 Ga0207678_10075685
614 Ga0207708_10032257
615 Ga0207708_10311127
616 Ga0207702_10015118
617 Ga0207702_10456305
618 Ga0207641_10013012
619 Ga0207648_10012383
620 Ga0207676_10243241
621 Ga0207674_10035010
622 Ga0207674_10254473
623 Ga0207675_100004063
624 Ga0207675_100009917
625 Ga0207683_10016591
626 Ga0207683_10093523
627 Ga0207698_10078260
628 Ga0207698_10143317
629 Ga0207698_10281494
630 Ga0207428_10058840
631 Ga0268266_10016283
632 Ga0268266_10110818
633 Ga0268265_10125983
634 Ga0268264_10007919
635 Ga0268264_10072003
636 Ga0307515_10135627
637 Ga0316177_1192103
638 Ga0314311_1165269
639 Ga0307513_10122961
640 Ga0307508_10107805
641 Ga0307413_10000161
642 Ga0307415_100053657
643 Ga0307507_10006894
644 Ga0307507_10008648
645 Ga0307507_10107671
646 Ga0307510_10042254
647 Ga0373929_0022267
648 Ga0373951_0004932
649 Ga0373952_0018306
650 Ga0373932_0001936
651 Ga0373939_0003890
652 Ga0373939_0060219
653 Ga0395905_0055029
654 Ga0436364_0110150
655 Ga0436364_0290389
656 Ga0436364_0528089
657 Ga0436365_1680286
658 Ga0436362_0839166
659 Ga0451789_0190650
660 Ga0451791_1709196
661 Ga0451797_0100677
662 Ga0451837_1592345
663 Ga0451843_1600774
664 Ga0451853_1705149
665 Ga0466969_0008659
666 Ga0466969_0065700
667 Ga0466969_0089140
668 Ga0466972_0000279
669 Ga0466972_0004539
670 Ga0466972_0042961
671 Ga0466972_0053591
672 Ga0466972_0067097
673 Ga0466972_0085730
674 Ga0466972_0146054
675 Ga0466965_0004487
676 Ga0466965_0021527
677 Ga0466965_0070786
678 Ga0466965_0145713
679 Ga0466966_0007642
680 Ga0466966_0012862
681 Ga0466966_0025884
682 Ga0466966_0028623
683 Ga0466966_0147906
684 Ga0466966_0175558
685 Ga0466966_0194029
686 Ga0466961_0003837
687 Ga0466961_0018314
688 Ga0466961_0041672
689 Ga0466961_0096875
690 Ga0466961_0100191
691 Ga0466961_0149459
692 Ga0466963_0002502
693 Ga0466963_0007851
694 Ga0466963_0016826
695 Ga0466963_0027732
696 Ga0466963_0060841
697 Ga0466963_0098276
698 Ga0466963_0106515
699 Ga0466963_0217076
700 Ga0466964_0057769
701 Ga0466971_0001602
702 Ga0466971_0080187
703 Ga0466968_0034692
704 Ga0466968_0047836
705 Ga0466970_0019920
706 Ga0466970_0035713
707 Ga0466970_0051693
708 Ga0466970_0225641
709 Ga0466957_0024020
710 Ga0466960_0004610
711 Ga0466960_0036011
712 Ga0466960_0106719
713 Ga0466959_0009906
714 Ga0466959_0038822
715 Ga0466959_0045409
716 Ga0466959_0123346
717 Ga0466958_0010422
718 Ga0466958_0013885
719 Ga0466958_0017236
720 Ga0466958_0033373
721 Ga0466958_0035417
722 Ga0466958_0058229
723 Ga0466967_0003364
724 Ga0466967_0003892
725 Ga0466967_0010628
726 Ga0466967_0041061
727 Ga0466967_0051163
728 Ga0466967_0055827
729 Ga0466967_0056780
730 Ga0466967_0085617
731 Ga0466967_0096534
732 Ga0466967_0166413
733 Ga0466967_0197136
734 Ga0466967_0261146
735 Ga0466967_0349230
736 Ga0495650_0012258
737 Ga0495652_0251116
738 Ga0495658_0082258
739 Ga0496100_0000912
740 Ga0496101_0001084
741 Ga0496101_0003938
742 Ga0496102_0000046
743 Ga0496103_0000547
744 Ga0496104_0188889
745 Ga0496104_0294077
746 Ga0496105_0064318
747 Ga0496105_0179700
748 Ga0496105_0184090
749 Ga0496106_0013433
750 Ga0496107_0034470
751 Ga0496108_0101340
752 Ga0496108_0198949
753 Ga0496109_0040102
754 Ga0496109_0056142
755 Ga0496109_0138099
756 Ga0496109_0210980
757 Ga0496110_0175048
758 Ga0496110_0268461
759 Ga0496113_0048421
760 Ga0496114_0058612
761 Ga0496114_0443076
762 Ga0496115_0009220
763 Ga0496116_0001888
764 Ga0496117_0000109
765 Ga0496118_0000132
766 Ga0496119_0000061
767 Ga0496119_0000964
768 Ga0496120_0003908
769 Ga0496120_0007535
770 Ga0496121_0008751
771 Ga0496124_0060229
772 Ga0496126_0002772
773 Ga0496126_0341766
774 Ga0501033_0029533
775 Ga0501036_0005083
776 Ga0501038_0000969
777 Ga0501042_0012636
778 Ga0501046_0070512
779 Ga0501047_0005656
780 Ga0501047_0179323
781 Ga0501035_0001333
782 Ga0501044_0099241
783 Ga0501045_0115319
784 nmdc:mga03683_24102_c1
785 nmdc:mga03n38_53971_c1
786 nmdc:mga0yw44_20807_c1
787 nmdc:mga06z11_224140_c1
788 nmdc:mga06z11_907_c1
789 nmdc:mga0n895_355060_c1
790 nmdc:mga0rr50_26156_c1
791 nmdc:mga0a205_17031_c1
792 Ga0500644_0000047
793 Ga0501082_0473530
794 Ga0466962_0041985
795 Ga0466962_0140566
796 2558908422
797 2753073965
798 2774392110
799 2791909933
800 2795782667
801 2809195898
802 2812351954
803 2816510435
804 2870725767
805 2870785278
806 2891970402
807 2915363120
808 2915770331
809 2932399135
810 2984580250
811 2990259100
812 8003323898
813 8047716887
814 8054473965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01933

CofD

2-phospho-L-lactate transferase CofD

34

327

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzb-assembly2.cif.gz_D x-ray crystal structure of protein bh3568 from bacillus halodurans. northeast structural genomics consortium bhr60. 0.8705 3 289
2o2z-assembly1.cif.gz_B crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.8598 3 298
2o2z-assembly1.cif.gz_A crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.8579 3 298
2o2z-assembly2.cif.gz_C crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.8572 3 296
2o2z-assembly2.cif.gz_D crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 a resolution 0.8537 3 298
ID Description Score Start End Superfamily
af_P9WMU5_2_314_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.9492 3 303 3.40.50.10680
af_P9WMU5_2_314_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.94 3 303 3.40.50.10680
af_P75767_9_300_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.8646 2 303 3.40.50.10680
af_P75767_9_300_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.8564 2 303 3.40.50.10680
af_P53980_2_429_3.40.50.10680 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.8529 3 289 3.40.50.10680
ID Description Score Start End GO Terms
AF-A0A349AY74-F1-model_v4 Gluconeogenesis factor 0.9855 1 129 GO:0005737
GO:0043743
AF-A0A853EQT2-F1-model_v4 YvcK family protein 0.9823 1 167 GO:0005737
GO:0043743
AF-A0A1Y5Y0X0-F1-model_v4 Putative gluconeogenesis factor 0.9793 2 302 GO:0005737
GO:0008360
GO:0043743
AF-A0A1Q8CYW3-F1-model_v4 Putative gluconeogenesis factor 0.9792 1 302 GO:0005737
GO:0008360
GO:0043743
AF-A0A7V8Y4W8-F1-model_v4 YvcK family protein 0.9766 1 98 GO:0005737
GO:0043743

Map