metagRoot

F436467

General Info

Members	Datasets	Scaffolds	Average Seq Length
407	263	407	168

Family's Representative Sequence

Representative Sequence	3300013307\|Ga0157372_10444467\|Ga0157372_104444673
Length	191
Sequence	MRLLALIGALGILGAIAXAVFFFGGYYSISAIPDDPSIVAWALGHVRDASIGRHATDQPPMSLDDQTVIQAGAVAFNQRGCTQCHGGPGVDWAKFSEGLRPDPPDLKDVAKDTPANEIFWVVKNGINMTGMPSFAKAGADDKEIWTIAAFVKKLPSISEEDYKRWTAAAQPAPAKPETASAASTLTSFFRR

Samples

	Sample ID	Description	Type	Environment
1	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
2	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
3	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
4	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
13	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
14	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
25	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
39	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
40	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
41	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
42	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
43	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
44	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
54	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
55	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
56	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
57	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
58	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
59	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
60	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
61	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
62	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
63	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
64	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
65	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
66	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
70	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
71	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
72	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
73	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
78	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
79	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
80	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
81	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
82	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
83	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
84	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
85	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
88	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
89	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
90	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
91	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
140	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
141	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
142	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
143	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
144	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
145	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
146	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
147	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
148	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
149	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
150	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
151	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
152	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
153	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
154	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
155	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
156	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
157	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
158	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
159	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
160	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
161	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
162	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
163	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
164	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
165	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
166	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
167	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
168	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
169	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
170	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
172	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
173	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
174	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
175	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
176	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
177	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
178	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
179	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
180	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
181	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
182	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
183	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
184	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
185	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
186	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
187	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
188	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
189	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
190	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
191	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
192	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
193	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
194	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
195	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
196	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
197	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
198	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
199	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
200	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
201	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
202	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
203	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
204	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
205	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
206	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
207	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
208	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
209	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
210	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
211	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
212	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
213	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
214	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
215	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
216	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
217	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
218	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
219	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
220	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
221	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
222	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
223	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
224	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
225	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
226	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
227	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
228	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
229	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
230	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
231	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
232	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
233	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
234	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
235	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
236	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
237	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
238	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
239	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
240	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
241	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
242	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
243	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
248	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
249	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
250	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
251	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
252	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
253	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
254	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
255	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
256	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
257	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
258	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
259	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
260	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
261	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
262	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
263	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.51
Metatranscriptomes	0.49
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.46
Nodule	0
Rhizoplane	8.6
Rhizosphere	88.7
Stem	0
Stem Tuber	0
Unclassified	0.25

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24750J21931_1000962	3300002070	Bacteria	3820
2	JGI24738J21930_10036611	3300002075	Bacteria	998
3	JGI24744J21845_10003685	3300002077	Bacteria	3157
4	JGI24742J22300_10024036	3300002244	Bacteria	1050
5	Ga0070676_10069279	3300005328	Bacteria	2114
6	Ga0070683_100739278	3300005329	Unclassified	942
7	Ga0070690_100008795	3300005330	Bacteria	5831
8	Ga0068869_100242469	3300005334	Unclassified	1436
9	Ga0070666_10639660	3300005335	Unclassified	778
10	Ga0070680_100056660	3300005336	Bacteria	3203
11	Ga0070680_100201070	3300005336	Bacteria	1680
12	Ga0070680_100239922	3300005336	Bacteria	1532
13	Ga0068868_100077658	3300005338	Bacteria	2656
14	Ga0070687_100619815	3300005343	Bacteria	746
15	Ga0070661_101120315	3300005344	Unclassified	656
16	Ga0070668_100064107	3300005347	Bacteria	2848
17	Ga0070675_100043130	3300005354	Bacteria	3685
18	Ga0070674_100080853	3300005356	Bacteria	2321
19	Ga0070673_100095500	3300005364	Bacteria	2438
20	Ga0070673_100248409	3300005364	Bacteria	1550
21	Ga0070688_100020031	3300005365	Bacteria	3883
22	Ga0070659_100132967	3300005366	Bacteria	2021
23	Ga0070659_100256171	3300005366	Bacteria	1451
24	Ga0070667_100511336	3300005367	Bacteria	1101
25	Ga0070709_10510031	3300005434	Bacteria	915
26	Ga0070714_100023554	3300005435	Bacteria	5061
27	Ga0070714_100994670	3300005435	Bacteria	816
28	Ga0070714_101067103	3300005435	Bacteria	787
29	Ga0070713_100135200	3300005436	Bacteria	2178
30	Ga0070713_100166464	3300005436	Bacteria	1971
31	Ga0070710_10060086	3300005437	Bacteria	2161
32	Ga0070710_10107072	3300005437	Unclassified	1674
33	Ga0070701_10136906	3300005438	Bacteria	1396
34	Ga0070711_100024372	3300005439	Bacteria	3946
35	Ga0070705_100432782	3300005440	Bacteria	982
36	Ga0070700_100058398	3300005441	Bacteria	2423
37	Ga0070694_100511412	3300005444	Bacteria	957
38	Ga0070708_100136051	3300005445	Bacteria	2276
39	Ga0070663_100196225	3300005455	Bacteria	1573
40	Ga0070681_10158601	3300005458	Bacteria	2186
41	Ga0070681_10160461	3300005458	Bacteria	2172
42	Ga0070681_10404038	3300005458	Bacteria	1277
43	Ga0068867_100030893	3300005459	Bacteria	3865
44	Ga0070706_100798373	3300005467	Bacteria	874
45	Ga0070706_100847010	3300005467	Bacteria	845
46	Ga0070707_100161491	3300005468	Bacteria	2183
47	Ga0070698_100835827	3300005471	Bacteria	865
48	Ga0070699_100337746	3300005518	Bacteria	1355
49	Ga0070679_100072210	3300005530	Bacteria	3443
50	Ga0070679_100169110	3300005530	Bacteria	2159
51	Ga0070679_100179054	3300005530	Bacteria	2093
52	Ga0070679_100187900	3300005530	Bacteria	2036
53	Ga0070684_100545022	3300005535	Unclassified	1076
54	Ga0070697_100170416	3300005536	Bacteria	1842
55	Ga0070672_100059356	3300005543	Bacteria	3010
56	Ga0070686_100026086	3300005544	Bacteria	3523
57	Ga0070695_100756986	3300005545	Unclassified	775
58	Ga0070696_100580176	3300005546	Bacteria	902
59	Ga0070704_100020931	3300005549	Bacteria	4230
60	Ga0070704_100461636	3300005549	Bacteria	1096
61	Ga0068855_100135123	3300005563	Bacteria	2814
62	Ga0068855_100472518	3300005563	Unclassified	1366
63	Ga0070664_100289289	3300005564	Unclassified	1479
64	Ga0068857_100086489	3300005577	Bacteria	2803
65	Ga0068854_100219098	3300005578	Bacteria	1505
66	Ga0068856_100211699	3300005614	Bacteria	1954
67	Ga0068856_100614336	3300005614	Bacteria	1108
68	Ga0068852_100016183	3300005616	Bacteria	5807
69	Ga0068859_100952428	3300005617	Unclassified	942
70	Ga0068866_10050683	3300005718	Bacteria	2109
71	Ga0068863_100218984	3300005841	Bacteria	1834
72	Ga0068858_100298906	3300005842	Unclassified	1535
73	Ga0068858_100421320	3300005842	Bacteria	1284
74	Ga0068862_100361889	3300005844	Bacteria	1348
75	Ga0081455_10080048	3300005937	Bacteria	2680
76	Ga0070717_10250863	3300006028	Unclassified	1563
77	Ga0070717_10448585	3300006028	Bacteria	1162
78	Ga0075365_10019691	3300006038	Bacteria	4172
79	Ga0075365_10246788	3300006038	Bacteria	1254
80	Ga0070715_10064150	3300006163	Bacteria	1621
81	Ga0070715_10558309	3300006163	Bacteria	665
82	Ga0070716_100243594	3300006173	Bacteria	1221
83	Ga0070712_100125372	3300006175	Bacteria	1939
84	Ga0075367_10125047	3300006178	Bacteria	1587
85	Ga0075367_10291982	3300006178	Bacteria	1026
86	Ga0075428_100027757	3300006844	Bacteria	6262
87	Ga0075428_100037691	3300006844	Bacteria	5321
88	Ga0075428_100621699	3300006844	Bacteria	1153
89	Ga0075431_100104377	3300006847	Bacteria	2925
90	Ga0075431_101035764	3300006847	Bacteria	787
91	Ga0075434_100032761	3300006871	Bacteria	5125
92	Ga0075434_100511435	3300006871	Unclassified	1221
93	Ga0097620_100952456	3300006931	Unclassified	942
94	Ga0075435_100048052	3300007076	Bacteria	3427
95	Ga0099794_10049962	3300007265	Bacteria	2011
96	Ga0099794_10208889	3300007265	Unclassified	1001
97	Ga0099795_10114480	3300007788	Bacteria	1072
98	Ga0099795_10314335	3300007788	Unclassified	692
99	Ga0105250_10106342	3300009092	Unclassified	1147
100	Ga0105240_10108411	3300009093	Bacteria	3365
101	Ga0111539_10097244	3300009094	Bacteria	3458
102	Ga0111539_10386385	3300009094	Bacteria	1630
103	Ga0105245_10087464	3300009098	Bacteria	2860
104	Ga0105245_10335600	3300009098	Bacteria	1493
105	Ga0114129_10002838	3300009147	Bacteria	24198
106	Ga0114129_10341023	3300009147	Bacteria	1988
107	Ga0105243_10180397	3300009148	Bacteria	1836
108	Ga0105238_10099578	3300009551	Bacteria	2890
109	Ga0105249_10757476	3300009553	Unclassified	1033
110	Ga0099796_10050906	3300010159	Bacteria	1437
111	Ga0105246_10447267	3300011119	Bacteria	1085
112	Ga0157370_10104513	3300013104	Bacteria	2651
113	Ga0157370_10129287	3300013104	Bacteria	2357
114	Ga0157369_10003381	3300013105	Bacteria	18956
115	Ga0157369_10287650	3300013105	Bacteria	1711
116	Ga0157374_10080773	3300013296	Bacteria	3084
117	Ga0163162_10583618	3300013306	Unclassified	1244
118	Ga0157372_10151840	3300013307	Bacteria	2674
119	Ga0157372_10330248	3300013307	Bacteria	1776
120	Ga0157372_10444467	3300013307	Bacteria	1511
121	Ga0163163_10176326	3300014325	Bacteria	2184
122	Ga0163163_10282563	3300014325	Bacteria	1711
123	Ga0163163_10819838	3300014325	Bacteria	994
124	Ga0157380_10639917	3300014326	Unclassified	1059
125	Ga0182008_10014500	3300014497	Bacteria	4126
126	Ga0157379_10689368	3300014968	Unclassified	958
127	Ga0157379_10715685	3300014968	Bacteria	940
128	Ga0157376_10670256	3300014969	Bacteria	1040
129	Ga0206356_11517563	3300020070	Bacteria	798
130	Ga0207656_10003884	3300025321	Bacteria	5180
131	Ga0207653_10038534	3300025885	Bacteria	1562
132	Ga0207692_10590159	3300025898	Unclassified	713
133	Ga0207710_10105595	3300025900	Bacteria	1333
134	Ga0207680_10317908	3300025903	Unclassified	1088
135	Ga0207685_10081896	3300025905	Bacteria	1338
136	Ga0207685_10185595	3300025905	Bacteria	967
137	Ga0207685_10560362	3300025905	Bacteria	609
138	Ga0207643_10001022	3300025908	Bacteria	16596
139	Ga0207684_10556341	3300025910	Unclassified	981
140	Ga0207707_10548544	3300025912	Bacteria	982
141	Ga0207693_10033405	3300025915	Bacteria	4060
142	Ga0207663_10029177	3300025916	Bacteria	3237
143	Ga0207663_10427622	3300025916	Bacteria	1018
144	Ga0207663_10786130	3300025916	Bacteria	757
145	Ga0207660_10044172	3300025917	Bacteria	3135
146	Ga0207660_10202757	3300025917	Bacteria	1550
147	Ga0207662_10003326	3300025918	Bacteria	8249
148	Ga0207662_10187874	3300025918	Bacteria	1332
149	Ga0207657_10007651	3300025919	Bacteria	11055
150	Ga0207649_10217991	3300025920	Bacteria	1358
151	Ga0207652_10064095	3300025921	Bacteria	3179
152	Ga0207652_10128405	3300025921	Bacteria	2259
153	Ga0207652_10329719	3300025921	Bacteria	1378
154	Ga0207681_10088391	3300025923	Bacteria	2207
155	Ga0207694_10066218	3300025924	Bacteria	2818
156	Ga0207650_10004087	3300025925	Bacteria	9967
157	Ga0207659_10093304	3300025926	Bacteria	2253
158	Ga0207700_10106579	3300025928	Bacteria	2247
159	Ga0207700_10205521	3300025928	Bacteria	1662
160	Ga0207700_10762986	3300025928	Bacteria	864
161	Ga0207700_11701801	3300025928	Bacteria	556
162	Ga0207644_10108431	3300025931	Bacteria	2096
163	Ga0207690_10053670	3300025932	Bacteria	2706
164	Ga0207706_10007759	3300025933	Bacteria	9905
165	Ga0207706_10714881	3300025933	Bacteria	855
166	Ga0207686_10054730	3300025934	Bacteria	2500
167	Ga0207709_10967439	3300025935	Unclassified	695
168	Ga0207670_10064576	3300025936	Bacteria	2509
169	Ga0207665_10038083	3300025939	Bacteria	3201
170	Ga0207665_10215498	3300025939	Bacteria	1405
171	Ga0207691_10029490	3300025940	Bacteria	5132
172	Ga0207689_10026581	3300025942	Bacteria	4848
173	Ga0207661_10045976	3300025944	Bacteria	3460
174	Ga0207679_10412069	3300025945	Unclassified	1191
175	Ga0207667_10191286	3300025949	Bacteria	2100
176	Ga0207667_10266182	3300025949	Bacteria	1753
177	Ga0207651_10044446	3300025960	Bacteria	2973
178	Ga0207651_11016789	3300025960	Unclassified	741
179	Ga0207640_10144938	3300025981	Bacteria	1737
180	Ga0207658_10429791	3300025986	Unclassified	1166
181	Ga0207703_10146022	3300026035	Bacteria	2057
182	Ga0207639_10588135	3300026041	Unclassified	1025
183	Ga0207639_11136598	3300026041	Bacteria	733
184	Ga0207678_10036458	3300026067	Bacteria	4280
185	Ga0207708_10019054	3300026075	Bacteria	5168
186	Ga0207702_10493064	3300026078	Bacteria	1193
187	Ga0207648_10009547	3300026089	Bacteria	9279
188	Ga0207676_10035692	3300026095	Bacteria	3776
189	Ga0207674_10089314	3300026116	Bacteria	3074
190	Ga0207674_10188632	3300026116	Bacteria	2012
191	Ga0207675_100007100	3300026118	Bacteria	10586
192	Ga0209179_1042521	3300027512	Bacteria	960
193	Ga0209588_1021973	3300027671	Bacteria	2006
194	Ga0209588_1088001	3300027671	Unclassified	1001
195	Ga0207428_10196470	3300027907	Unclassified	1519
196	Ga0265763_1025540	3300030763	Unclassified	646
197	Ga0265325_10087047	3300031241	Unclassified	1545
198	Ga0265340_10155305	3300031247	Unclassified	1041
199	Ga0265339_10182398	3300031249	Unclassified	1044
200	Ga0265331_10069560	3300031250	Unclassified	1648
201	Ga0265316_10475255	3300031344	Unclassified	895
202	Ga0265316_10572379	3300031344	Bacteria	803
203	Ga0265313_10004577	3300031595	Bacteria	10525
204	Ga0265314_10101610	3300031711	Unclassified	1847
205	Ga0373948_0174753	3300034817	Unclassified	548
206	Ga0373938_0070509	3300034957	Bacteria	834
207	Ga0373926_0087449	3300035083	Bacteria	1157
208	Ga0373934_0013435	3300035086	Bacteria	3097
209	Ga0373949_0183056	3300035090	Unclassified	621
210	Ga0373923_0001165	3300035111	Bacteria	7314
211	Ga0373932_0279741	3300035112	Bacteria	617
212	Ga0373936_0000103	3300035113	Bacteria	30865
213	Ga0373945_0002109	3300035116	Bacteria	6198
214	Ga0373953_0001968	3300035117	Bacteria	6109
215	Ga0373954_0000605	3300035118	Bacteria	13642
216	Ga0373954_0264017	3300035118	Bacteria	848
217	Ga0373956_0148605	3300035119	Bacteria	1102
218	Ga0373957_0011626	3300035120	Bacteria	2944
219	Ga0373943_0000924	3300035170	Bacteria	12939
220	Ga0373943_0039099	3300035170	Bacteria	2284
221	Ga0373946_0002388	3300035171	Bacteria	6639
222	Ga0373946_0439460	3300035171	Unclassified	663
223	Ga0373955_0004119	3300035172	Bacteria	6418
224	Ga0373924_0001114	3300035410	Bacteria	8608
225	Ga0373935_0000017	3300035692	Bacteria	70368
226	Ga0373935_0160803	3300035692	Bacteria	1531
227	Ga0373927_0018458	3300035695	Bacteria	4585
228	Ga0373927_0044856	3300035695	Bacteria	2860
229	Ga0373933_0019964	3300035724	Bacteria	3793
230	Ga0373933_0039488	3300035724	Bacteria	2777
231	Ga0373933_0356699	3300035724	Bacteria	950
232	Ga0373947_0000916	3300035725	Bacteria	17899
233	Ga0373947_0335651	3300035725	Bacteria	1012
234	Ga0373937_0000103	3300036401	Bacteria	80386
235	Ga0373937_0002750	3300036401	Bacteria	14678
236	Ga0373937_1110565	3300036401	Unclassified	739
237	Ga0373925_0000058	3300037068	Bacteria	122682
238	Ga0373925_0152785	3300037068	Bacteria	1814
239	Ga0395899_0017591	3300037312	Bacteria	5445
240	Ga0395899_0071034	3300037312	Bacteria	2548
241	Ga0395900_0005623	3300037418	Bacteria	13110
242	Ga0395900_0075121	3300037418	Bacteria	3474
243	Ga0395900_0095338	3300037418	Bacteria	3057
244	Ga0395900_0453215	3300037418	Bacteria	1239
245	Ga0395898_0009874	3300037466	Bacteria	10006
246	Ga0395898_0086992	3300037466	Bacteria	3011
247	Ga0395898_0113459	3300037466	Bacteria	2597
248	Ga0395901_0004287	3300038443	Bacteria	14389
249	Ga0395901_0010157	3300038443	Bacteria	9540
250	Ga0395901_0069913	3300038443	Bacteria	3657
251	Ga0395901_0292628	3300038443	Bacteria	1690
252	Ga0436365_0517727	3300039437	Bacteria	3408
253	Ga0436360_1311771	3300039438	Bacteria	646
254	Ga0436360_1372125	3300039438	Bacteria	1491
255	Ga0436361_0399548	3300039447	Bacteria	5132
256	Ga0436361_1087908	3300039447	Bacteria	5692
257	Ga0436361_1131748	3300039447	Bacteria	547
258	Ga0436362_1281407	3300039453	Unclassified	584
259	Ga0466963_0380102	3300044694	Bacteria	995
260	Ga0466963_0872322	3300044694	Bacteria	634
261	Ga0466964_0287415	3300044706	Bacteria	824
262	Ga0466957_0087474	3300044842	Bacteria	1948
263	Ga0466957_0204286	3300044842	Bacteria	1299
264	Ga0466958_0057214	3300045836	Bacteria	2370
265	Ga0466958_0094658	3300045836	Bacteria	1851
266	Ga0466967_0421435	3300045976	Unclassified	1301
267	Ga0495592_0000343	3300046454	Bacteria	38047
268	Ga0495629_0002223	3300046459	Bacteria	14968
269	Ga0495629_0117694	3300046459	Bacteria	1851
270	Ga0495641_0044672	3300046461	Bacteria	2043
271	Ga0495651_0002876	3300046462	Bacteria	13334
272	Ga0495651_0070617	3300046462	Bacteria	2657
273	Ga0495653_0000072	3300046463	Bacteria	85266
274	Ga0495653_0092190	3300046463	Bacteria	2213
275	Ga0495580_0405958	3300046472	Bacteria	918
276	Ga0495582_0048289	3300046473	Bacteria	2344
277	Ga0495582_0057135	3300046473	Bacteria	2151
278	Ga0495639_0572700	3300046475	Bacteria	579
279	Ga0495662_0008685	3300046476	Bacteria	4993
280	Ga0495664_0000009	3300046477	Bacteria	289534
281	Ga0495664_0002358	3300046477	Bacteria	10115
282	Ga0495608_0000608	3300046511	Bacteria	24628
283	Ga0495608_0048932	3300046511	Bacteria	2808
284	Ga0495618_0000061	3300046514	Bacteria	78337
285	Ga0495620_0156628	3300046515	Bacteria	886
286	Ga0495628_0000012	3300046516	Bacteria	224162
287	Ga0495628_0261631	3300046516	Unclassified	1289
288	Ga0495630_0000945	3300046517	Bacteria	20329
289	Ga0495652_0000021	3300046529	Bacteria	181454
290	Ga0495652_0796966	3300046529	Bacteria	629
291	Ga0495665_0371437	3300046531	Unclassified	727
292	Ga0495640_0000028	3300046533	Bacteria	79904
293	Ga0495586_0056614	3300046535	Bacteria	2127
294	Ga0495587_0000033	3300046536	Bacteria	123885
295	Ga0495587_0019309	3300046536	Bacteria	4220
296	Ga0495645_0000017	3300046543	Bacteria	156865
297	Ga0495667_0000515	3300046559	Bacteria	24734
298	Ga0495667_0010702	3300046559	Bacteria	6203
299	Ga0495667_0590468	3300046559	Unclassified	692
300	Ga0495668_0166710	3300046616	Unclassified	1206
301	Ga0495634_0001144	3300046642	Bacteria	24509
302	Ga0495635_0000019	3300046663	Bacteria	193402
303	Ga0495635_0044762	3300046663	Bacteria	3053
304	Ga0495659_0149910	3300046664	Bacteria	936
305	Ga0495657_0000982	3300046675	Bacteria	25117
306	Ga0495599_0000024	3300046678	Bacteria	121388
307	Ga0495599_0024350	3300046678	Bacteria	3786
308	Ga0495623_0000022	3300046679	Bacteria	98899
309	Ga0495623_0183168	3300046679	Bacteria	1215
310	Ga0495646_0000033	3300046680	Bacteria	83930
311	Ga0495646_0004824	3300046680	Bacteria	8517
312	Ga0495647_0159062	3300046681	Bacteria	972
313	Ga0495613_0059138	3300046689	Bacteria	2810
314	Ga0495613_0355505	3300046689	Unclassified	1005
315	Ga0495600_0000028	3300046809	Bacteria	90661
316	Ga0495581_0013694	3300047315	Bacteria	4702
317	Ga0495604_0000011	3300047317	Bacteria	292024
318	Ga0495604_0349063	3300047317	Bacteria	983
319	Ga0495674_0000015	3300047319	Bacteria	224071
320	Ga0495674_0026162	3300047319	Bacteria	5342
321	Ga0495674_0650211	3300047319	Unclassified	831
322	Ga0495676_0285420	3300047321	Bacteria	1116
323	Ga0495680_0001545	3300047322	Bacteria	24639
324	Ga0495680_0070271	3300047322	Bacteria	2670
325	Ga0495675_0001637	3300047444	Bacteria	13445
326	Ga0495684_0000036	3300047471	Bacteria	107181
327	Ga0495684_0296696	3300047471	Bacteria	1162
328	Ga0495684_0765827	3300047471	Bacteria	634
329	Ga0495593_0001316	3300047673	Bacteria	14553
330	Ga0495602_0000018	3300048088	Bacteria	183837
331	Ga0495602_0000131	3300048088	Bacteria	70438
332	Ga0495602_0355787	3300048088	Bacteria	1056
333	Ga0496100_0105748	3300048903	Bacteria	1947
334	Ga0496100_0394094	3300048903	Unclassified	1053
335	Ga0496101_0065844	3300048904	Bacteria	2641
336	Ga0496101_0117922	3300048904	Bacteria	2004
337	Ga0496102_0029728	3300048905	Bacteria	4889
338	Ga0496102_0042022	3300048905	Bacteria	4142
339	Ga0496103_0042608	3300048906	Bacteria	2794
340	Ga0496104_0009626	3300048907	Bacteria	8605
341	Ga0496104_0012788	3300048907	Bacteria	7560
342	Ga0496104_0059006	3300048907	Bacteria	3632
343	Ga0496104_0455209	3300048907	Bacteria	1191
344	Ga0496105_0001551	3300048908	Bacteria	16261
345	Ga0496105_0009971	3300048908	Bacteria	7453
346	Ga0496105_0011553	3300048908	Bacteria	6981
347	Ga0496106_0061862	3300048909	Bacteria	2841
348	Ga0496106_0183324	3300048909	Bacteria	1662
349	Ga0496107_0032780	3300048910	Bacteria	3714
350	Ga0496108_0004655	3300048911	Bacteria	11061
351	Ga0496108_0028399	3300048911	Bacteria	4628
352	Ga0496108_0283745	3300048911	Unclassified	1441
353	Ga0496109_0044764	3300048912	Bacteria	4015
354	Ga0496109_0067355	3300048912	Bacteria	3279
355	Ga0496110_0015601	3300048913	Bacteria	6326
356	Ga0496110_0138426	3300048913	Bacteria	2201
357	Ga0496111_0007321	3300048914	Bacteria	7222
358	Ga0496111_0279326	3300048914	Bacteria	1238
359	Ga0496112_0019628	3300048915	Bacteria	6383
360	Ga0496112_0066581	3300048915	Bacteria	3554
361	Ga0496113_0003778	3300048916	Bacteria	9145
362	Ga0496114_0201895	3300048917	Bacteria	1741
363	Ga0496114_0254079	3300048917	Bacteria	1547
364	Ga0496114_0426488	3300048917	Bacteria	1175
365	Ga0496115_0075932	3300048918	Bacteria	2731
366	Ga0496115_0181407	3300048918	Bacteria	1740
367	Ga0496115_0303874	3300048918	Bacteria	1307
368	Ga0501037_0007951	3300049573	Bacteria	7772
369	Ga0501038_0118776	3300049574	Bacteria	2183
370	Ga0501038_0497749	3300049574	Bacteria	932
371	Ga0501047_0218086	3300049581	Bacteria	1764
372	Ga0501047_0250442	3300049581	Bacteria	1620
373	Ga0501070_0036886	3300049586	Bacteria	4082
374	Ga0501080_0062873	3300049742	Bacteria	3455
375	Ga0501044_0094999	3300049823	Bacteria	3005
376	Ga0501044_0268053	3300049823	Bacteria	1644
377	nmdc:mga0yw44_200104_c1	3300050492	Bacteria	1319
378	nmdc:mga0yw44_581962_c1	3300050492	Unclassified	760
379	nmdc:mga06z11_335434_c1	3300050494	Bacteria	903
380	nmdc:mga04h51_46316_c1	3300050495	Bacteria	1441
381	nmdc:mga07m45_235582_c1	3300050496	Unclassified	1065
382	nmdc:mga05p37_139380_c1	3300050507	Bacteria	2972
383	nmdc:mga05p37_392682_c1	3300050507	Bacteria	1622
384	nmdc:mga06r32_185627_c1	3300050510	Bacteria	2066
385	nmdc:mga08y16_157860_c1	3300050511	Bacteria	2357
386	nmdc:mga0n895_212066_c1	3300050512	Bacteria	1967
387	nmdc:mga0n895_491621_c1	3300050512	Unclassified	1237
388	nmdc:mga0rr50_331264_c1	3300050513	Bacteria	1278
389	nmdc:mga08x19_714647_c1	3300050514	Unclassified	711
390	Ga0495601_0000024	3300053077	Bacteria	133160
391	Ga0495601_0000702	3300053077	Bacteria	17977
392	Ga0495601_0014795	3300053077	Bacteria	4708
393	Ga0495601_0146939	3300053077	Bacteria	1539
394	Ga0495601_0151617	3300053077	Bacteria	1513
395	Ga0495601_0382944	3300053077	Unclassified	913
396	Ga0495612_0000606	3300053078	Bacteria	14418
397	Ga0495612_0003278	3300053078	Bacteria	6712
398	Ga0495612_0083556	3300053078	Unclassified	1344
399	Ga0495655_0041758	3300053083	Bacteria	1174
400	Ga0495595_0000036	3300053084	Bacteria	79035
401	Ga0495595_0084416	3300053084	Bacteria	1517
402	Ga0495619_0000034	3300053085	Bacteria	129851
403	Ga0495619_0020156	3300053085	Bacteria	4244
404	Ga0495619_0091533	3300053085	Bacteria	2059
405	Ga0495619_0195831	3300053085	Bacteria	1399
406	Ga0495619_0325361	3300053085	Bacteria	1064
407	Ga0500642_0135862	3300053130	Bacteria	1153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300027512	Ga0209179_1042521	Ga0209179_10425211	140
2	3300034957	Ga0373938_0070509	Ga0373938_0070509_78_551	141
3	3300048907	Ga0496104_0455209	Ga0496104_0455209_45_518	141
4	3300035118	Ga0373954_0264017	Ga0373954_0264017_206_718	145
5	3300036401	Ga0373937_0002750	Ga0373937_0002750_3399_3911	145
6	3300046462	Ga0495651_0070617	Ga0495651_0070617_223_735	145
7	3300046477	Ga0495664_0002358	Ga0495664_0002358_521_1033	145
8	3300046511	Ga0495608_0048932	Ga0495608_0048932_71_583	145
9	3300046529	Ga0495652_0796966	Ga0495652_0796966_88_600	145
10	3300046536	Ga0495587_0019309	Ga0495587_0019309_260_772	145
11	3300046559	Ga0495667_0010702	Ga0495667_0010702_3141_3653	145
12	3300046663	Ga0495635_0044762	Ga0495635_0044762_971_1483	145
13	3300046678	Ga0495599_0024350	Ga0495599_0024350_2896_3408	145
14	3300046679	Ga0495623_0183168	Ga0495623_0183168_470_982	145
15	3300046680	Ga0495646_0004824	Ga0495646_0004824_1661_2173	145
16	3300047317	Ga0495604_0349063	Ga0495604_0349063_28_540	145
17	3300047319	Ga0495674_0026162	Ga0495674_0026162_2949_3461	145
18	3300047322	Ga0495680_0070271	Ga0495680_0070271_1737_2249	145
19	3300048088	Ga0495602_0000131	Ga0495602_0000131_1202_1714	145
20	3300053077	Ga0495601_0000702	Ga0495601_0000702_8852_9364	145
21	3300053078	Ga0495612_0003278	Ga0495612_0003278_5302_5814	145
22	3300053084	Ga0495595_0084416	Ga0495595_0084416_152_664	145
23	3300053085	Ga0495619_0091533	Ga0495619_0091533_1339_1851	145
24	3300035112	Ga0373932_0279741	Ga0373932_0279741_103_594	147
25	3300035724	Ga0373933_0039488	Ga0373933_0039488_227_739	147
26	3300037312	Ga0395899_0017591	Ga0395899_0017591_1972_2577	149
27	3300037418	Ga0395900_0005623	Ga0395900_0005623_6015_6620	149
28	3300038443	Ga0395901_0004287	Ga0395901_0004287_8530_9132	149
29	3300048917	Ga0496114_0426488	Ga0496114_0426488_275_817	151
30	3300036401	Ga0373937_1110565	Ga0373937_1110565_121_657	152
31	3300010159	Ga0099796_10050906	Ga0099796_100509063	153
32	3300005343	Ga0070687_100619815	Ga0070687_1006198151	154
33	3300005458	Ga0070681_10158601	Ga0070681_101586013	154
34	3300005467	Ga0070706_100798373	Ga0070706_1007983731	154
35	3300035170	Ga0373943_0039099	Ga0373943_0039099_1146_1685	154
36	3300035695	Ga0373927_0044856	Ga0373927_0044856_297_836	154
37	3300007265	Ga0099794_10208889	Ga0099794_102088891	155
38	3300025912	Ga0207707_10548544	Ga0207707_105485442	155
39	3300027671	Ga0209588_1088001	Ga0209588_10880011	155
40	3300037418	Ga0395900_0453215	Ga0395900_0453215_431_988	155
41	3300044706	Ga0466964_0287415	Ga0466964_0287415_288_791	155
42	3300005436	Ga0070713_100166464	Ga0070713_1001664642	156
43	3300007788	Ga0099795_10314335	Ga0099795_103143351	156
44	3300014325	Ga0163163_10819838	Ga0163163_108198381	156
45	3300014968	Ga0157379_10689368	Ga0157379_106893681	156
46	3300025915	Ga0207693_10033405	Ga0207693_100334055	156
47	3300005444	Ga0070694_100511412	Ga0070694_1005114121	157
48	3300005549	Ga0070704_100020931	Ga0070704_1000209313	157
49	3300006175	Ga0070712_100125372	Ga0070712_1001253722	157
50	3300025916	Ga0207663_10786130	Ga0207663_107861301	157
51	3300025933	Ga0207706_10714881	Ga0207706_107148812	157
52	3300037466	Ga0395898_0113459	Ga0395898_0113459_1503_2015	157
53	3300038443	Ga0395901_0069913	Ga0395901_0069913_218_730	157
54	3300038443	Ga0395901_0292628	Ga0395901_0292628_248_760	157
55	3300039438	Ga0436360_1311771	Ga0436360_1311771_82_594	157
56	3300044694	Ga0466963_0380102	Ga0466963_0380102_348_932	157
57	3300046664	Ga0495659_0149910	Ga0495659_0149910_362_853	157
58	3300005435	Ga0070714_100994670	Ga0070714_1009946701	158
59	3300005445	Ga0070708_100136051	Ga0070708_1001360512	158
60	3300005467	Ga0070706_100847010	Ga0070706_1008470102	158
61	3300005468	Ga0070707_100161491	Ga0070707_1001614911	158
62	3300005471	Ga0070698_100835827	Ga0070698_1008358272	158
63	3300005518	Ga0070699_100337746	Ga0070699_1003377462	158
64	3300005536	Ga0070697_100170416	Ga0070697_1001704162	158
65	3300006028	Ga0070717_10448585	Ga0070717_104485852	158
66	3300006871	Ga0075434_100511435	Ga0075434_1005114353	158
67	3300007265	Ga0099794_10049962	Ga0099794_100499622	158
68	3300009147	Ga0114129_10341023	Ga0114129_103410234	158
69	3300025885	Ga0207653_10038534	Ga0207653_100385342	158
70	3300025910	Ga0207684_10556341	Ga0207684_105563412	158
71	3300025928	Ga0207700_10762986	Ga0207700_107629862	158
72	3300027671	Ga0209588_1021973	Ga0209588_10219733	158
73	3300039438	Ga0436360_1372125	Ga0436360_1372125_308_826	158
74	3300039447	Ga0436361_1087908	Ga0436361_1087908_2252_2770	158
75	3300039453	Ga0436362_1281407	Ga0436362_1281407_32_550	158
76	3300048913	Ga0496110_0138426	Ga0496110_0138426_986_1504	158
77	3300050507	nmdc:mga05p37_392682_c1	nmdc:mga05p37_392682_c1_989_1507	158
78	3300050512	nmdc:mga0n895_212066_c1	nmdc:mga0n895_212066_c1_962_1480	158
79	3300050514	nmdc:mga08x19_714647_c1	nmdc:mga08x19_714647_c1_62_580	158
80	3300025905	Ga0207685_10185595	Ga0207685_101855952	160
81	3300044842	Ga0466957_0087474	Ga0466957_0087474_230_853	160
82	3300045836	Ga0466958_0094658	Ga0466958_0094658_565_1188	160
83	3300048908	Ga0496105_0011553	Ga0496105_0011553_6141_6671	160
84	3300048918	Ga0496115_0075932	Ga0496115_0075932_1983_2513	160
85	3300005530	Ga0070679_100187900	Ga0070679_1001879003	161
86	3300013105	Ga0157369_10287650	Ga0157369_102876502	161
87	3300014497	Ga0182008_10014500	Ga0182008_100145003	161
88	3300039447	Ga0436361_0399548	Ga0436361_0399548_52_564	161
89	3300047471	Ga0495684_0765827	Ga0495684_0765827_29_553	161
90	3300053085	Ga0495619_0325361	Ga0495619_0325361_163_786	161
91	3300006844	Ga0075428_100027757	Ga0075428_1000277575	162
92	3300006847	Ga0075431_100104377	Ga0075431_1001043775	162
93	3300005336	Ga0070680_100239922	Ga0070680_1002399222	163
94	3300014968	Ga0157379_10715685	Ga0157379_107156852	163
95	3300026041	Ga0207639_11136598	Ga0207639_111365982	163
96	3300031344	Ga0265316_10572379	Ga0265316_105723791	163
97	3300039447	Ga0436361_1131748	Ga0436361_1131748_13_504	163
98	3300044694	Ga0466963_0872322	Ga0466963_0872322_22_576	163
99	3300045976	Ga0466967_0421435	Ga0466967_0421435_153_725	163
100	3300048918	Ga0496115_0181407	Ga0496115_0181407_734_1288	163
101	3300005344	Ga0070661_101120315	Ga0070661_1011203151	166
102	3300005364	Ga0070673_100248409	Ga0070673_1002484091	166
103	3300005535	Ga0070684_100545022	Ga0070684_1005450222	166
104	3300005564	Ga0070664_100289289	Ga0070664_1002892892	166
105	3300005617	Ga0068859_100952428	Ga0068859_1009524282	166
106	3300005842	Ga0068858_100421320	Ga0068858_1004213202	166
107	3300006038	Ga0075365_10246788	Ga0075365_102467881	166
108	3300006844	Ga0075428_100037691	Ga0075428_1000376914	166
109	3300006871	Ga0075434_100032761	Ga0075434_1000327617	166
110	3300006931	Ga0097620_100952456	Ga0097620_1009524562	166
111	3300007076	Ga0075435_100048052	Ga0075435_1000480525	166
112	3300009094	Ga0111539_10386385	Ga0111539_103863852	166
113	3300009098	Ga0105245_10335600	Ga0105245_103356002	166
114	3300009147	Ga0114129_10002838	Ga0114129_100028387	166
115	3300009553	Ga0105249_10757476	Ga0105249_107574762	166
116	3300013306	Ga0163162_10583618	Ga0163162_105836182	166
117	3300014325	Ga0163163_10176326	Ga0163163_101763262	166
118	3300025918	Ga0207662_10187874	Ga0207662_101878743	166
119	3300025920	Ga0207649_10217991	Ga0207649_102179911	166
120	3300025925	Ga0207650_10004087	Ga0207650_1000408711	166
121	3300025945	Ga0207679_10412069	Ga0207679_104120692	166
122	3300025960	Ga0207651_11016789	Ga0207651_110167891	166
123	3300025986	Ga0207658_10429791	Ga0207658_104297912	166
124	3300027907	Ga0207428_10196470	Ga0207428_101964702	166
125	3300035692	Ga0373935_0160803	Ga0373935_0160803_1000_1518	166
126	3300035725	Ga0373947_0335651	Ga0373947_0335651_159_677	166
127	3300037068	Ga0373925_0152785	Ga0373925_0152785_481_999	166
128	3300046459	Ga0495629_0117694	Ga0495629_0117694_1269_1787	166
129	3300046461	Ga0495641_0044672	Ga0495641_0044672_74_592	166
130	3300046473	Ga0495582_0057135	Ga0495582_0057135_1161_1679	166
131	3300046531	Ga0495665_0371437	Ga0495665_0371437_163_681	166
132	3300047319	Ga0495674_0650211	Ga0495674_0650211_295_813	166
133	3300048904	Ga0496101_0117922	Ga0496101_0117922_989_1507	166
134	3300048905	Ga0496102_0042022	Ga0496102_0042022_1371_1889	166
135	3300048906	Ga0496103_0042608	Ga0496103_0042608_1534_2052	166
136	3300048907	Ga0496104_0059006	Ga0496104_0059006_1297_1815	166
137	3300048908	Ga0496105_0001551	Ga0496105_0001551_13894_14412	166
138	3300048909	Ga0496106_0061862	Ga0496106_0061862_822_1340	166
139	3300048910	Ga0496107_0032780	Ga0496107_0032780_975_1493	166
140	3300048911	Ga0496108_0004655	Ga0496108_0004655_6490_7008	166
141	3300048912	Ga0496109_0044764	Ga0496109_0044764_1700_2218	166
142	3300048913	Ga0496110_0015601	Ga0496110_0015601_5318_5836	166
143	3300048914	Ga0496111_0007321	Ga0496111_0007321_2015_2533	166
144	3300048915	Ga0496112_0019628	Ga0496112_0019628_2366_2884	166
145	3300048916	Ga0496113_0003778	Ga0496113_0003778_2628_3146	166
146	3300048917	Ga0496114_0201895	Ga0496114_0201895_211_729	166
147	3300048918	Ga0496115_0303874	Ga0496115_0303874_696_1214	166
148	3300050492	nmdc:mga0yw44_581962_c1	nmdc:mga0yw44_581962_c1_211_729	166
149	3300050512	nmdc:mga0n895_491621_c1	nmdc:mga0n895_491621_c1_612_1130	166
150	3300050513	nmdc:mga0rr50_331264_c1	nmdc:mga0rr50_331264_c1_636_1154	166
151	3300005435	Ga0070714_101067103	Ga0070714_1010671031	167
152	3300005530	Ga0070679_100179054	Ga0070679_1001790542	167
153	3300006163	Ga0070715_10558309	Ga0070715_105583091	167
154	3300025905	Ga0207685_10560362	Ga0207685_105603621	167
155	3300025921	Ga0207652_10329719	Ga0207652_103297192	167
156	3300025939	Ga0207665_10038083	Ga0207665_100380832	167
157	3300035083	Ga0373926_0087449	Ga0373926_0087449_513_1022	167
158	3300035086	Ga0373934_0013435	Ga0373934_0013435_2197_2706	167
159	3300035111	Ga0373923_0001165	Ga0373923_0001165_4018_4527	167
160	3300035113	Ga0373936_0000103	Ga0373936_0000103_5013_5522	167
161	3300035116	Ga0373945_0002109	Ga0373945_0002109_3348_3857	167
162	3300035117	Ga0373953_0001968	Ga0373953_0001968_3416_3925	167
163	3300035118	Ga0373954_0000605	Ga0373954_0000605_3029_3538	167
164	3300035119	Ga0373956_0148605	Ga0373956_0148605_210_719	167
165	3300035120	Ga0373957_0011626	Ga0373957_0011626_2202_2711	167
166	3300035170	Ga0373943_0000924	Ga0373943_0000924_6314_6823	167
167	3300035171	Ga0373946_0002388	Ga0373946_0002388_5656_6165	167
168	3300035172	Ga0373955_0004119	Ga0373955_0004119_740_1249	167
169	3300035410	Ga0373924_0001114	Ga0373924_0001114_646_1155	167
170	3300035692	Ga0373935_0000017	Ga0373935_0000017_11277_11786	167
171	3300035695	Ga0373927_0018458	Ga0373927_0018458_1695_2204	167
172	3300035724	Ga0373933_0019964	Ga0373933_0019964_2500_3009	167
173	3300035725	Ga0373947_0000916	Ga0373947_0000916_6121_6630	167
174	3300036401	Ga0373937_0000103	Ga0373937_0000103_11206_11715	167
175	3300037068	Ga0373925_0000058	Ga0373925_0000058_54031_54540	167
176	3300039437	Ga0436365_0517727	Ga0436365_0517727_2890_3396	167
177	3300046454	Ga0495592_0000343	Ga0495592_0000343_11145_11654	167
178	3300046459	Ga0495629_0002223	Ga0495629_0002223_5079_5588	167
179	3300046462	Ga0495651_0002876	Ga0495651_0002876_1692_2201	167
180	3300046463	Ga0495653_0000072	Ga0495653_0000072_73688_74197	167
181	3300046472	Ga0495580_0405958	Ga0495580_0405958_202_714	167
182	3300046473	Ga0495582_0048289	Ga0495582_0048289_431_940	167
183	3300046475	Ga0495639_0572700	Ga0495639_0572700_25_534	167
184	3300046476	Ga0495662_0008685	Ga0495662_0008685_1683_2192	167
185	3300046477	Ga0495664_0000009	Ga0495664_0000009_235268_235777	167
186	3300046511	Ga0495608_0000608	Ga0495608_0000608_11173_11682	167
187	3300046514	Ga0495618_0000061	Ga0495618_0000061_11190_11699	167
188	3300046516	Ga0495628_0000012	Ga0495628_0000012_53870_54379	167
189	3300046517	Ga0495630_0000945	Ga0495630_0000945_16308_16817	167
190	3300046529	Ga0495652_0000021	Ga0495652_0000021_169750_170259	167
191	3300046533	Ga0495640_0000028	Ga0495640_0000028_4985_5494	167
192	3300046535	Ga0495586_0056614	Ga0495586_0056614_211_720	167
193	3300046536	Ga0495587_0000033	Ga0495587_0000033_69606_70115	167
194	3300046543	Ga0495645_0000017	Ga0495645_0000017_65995_66504	167
195	3300046559	Ga0495667_0000515	Ga0495667_0000515_11261_11770	167
196	3300046642	Ga0495634_0001144	Ga0495634_0001144_11156_11665	167
197	3300046663	Ga0495635_0000019	Ga0495635_0000019_106119_106628	167
198	3300046675	Ga0495657_0000982	Ga0495657_0000982_13418_13927	167
199	3300046678	Ga0495599_0000024	Ga0495599_0000024_53695_54204	167
200	3300046679	Ga0495623_0000022	Ga0495623_0000022_87237_87746	167
201	3300046680	Ga0495646_0000033	Ga0495646_0000033_72134_72643	167
202	3300046681	Ga0495647_0159062	Ga0495647_0159062_51_560	167
203	3300046689	Ga0495613_0059138	Ga0495613_0059138_2130_2639	167
204	3300046809	Ga0495600_0000028	Ga0495600_0000028_78944_79453	167
205	3300047315	Ga0495581_0013694	Ga0495581_0013694_2915_3424	167
206	3300047317	Ga0495604_0000011	Ga0495604_0000011_280360_280869	167
207	3300047319	Ga0495674_0000015	Ga0495674_0000015_53875_54384	167
208	3300047322	Ga0495680_0001545	Ga0495680_0001545_11121_11630	167
209	3300047444	Ga0495675_0001637	Ga0495675_0001637_11284_11793	167
210	3300047471	Ga0495684_0000036	Ga0495684_0000036_95367_95876	167
211	3300047673	Ga0495593_0001316	Ga0495593_0001316_10377_10886	167
212	3300048088	Ga0495602_0000018	Ga0495602_0000018_11152_11661	167
213	3300053077	Ga0495601_0000024	Ga0495601_0000024_66019_66528	167
214	3300053078	Ga0495612_0000606	Ga0495612_0000606_11278_11787	167
215	3300053084	Ga0495595_0000036	Ga0495595_0000036_67339_67848	167
216	3300053085	Ga0495619_0000034	Ga0495619_0000034_53835_54344	167
217	3300005336	Ga0070680_100056660	Ga0070680_1000566604	168
218	3300005336	Ga0070680_100201070	Ga0070680_1002010703	168
219	3300005435	Ga0070714_100023554	Ga0070714_1000235546	168
220	3300005437	Ga0070710_10060086	Ga0070710_100600862	168
221	3300005458	Ga0070681_10160461	Ga0070681_101604612	168
222	3300005458	Ga0070681_10404038	Ga0070681_104040382	168
223	3300005530	Ga0070679_100072210	Ga0070679_1000722103	168
224	3300005578	Ga0068854_100219098	Ga0068854_1002190982	168
225	3300005937	Ga0081455_10080048	Ga0081455_100800483	168
226	3300006163	Ga0070715_10064150	Ga0070715_100641502	168
227	3300006173	Ga0070716_100243594	Ga0070716_1002435942	168
228	3300006844	Ga0075428_100621699	Ga0075428_1006216992	168
229	3300006847	Ga0075431_101035764	Ga0075431_1010357641	168
230	3300009093	Ga0105240_10108411	Ga0105240_101084113	168
231	3300013104	Ga0157370_10129287	Ga0157370_101292872	168
232	3300013307	Ga0157372_10330248	Ga0157372_103302483	168
233	3300025905	Ga0207685_10081896	Ga0207685_100818961	168
234	3300025916	Ga0207663_10427622	Ga0207663_104276222	168
235	3300025917	Ga0207660_10044172	Ga0207660_100441722	168
236	3300025921	Ga0207652_10064095	Ga0207652_100640954	168
237	3300025921	Ga0207652_10128405	Ga0207652_101284053	168
238	3300025928	Ga0207700_11701801	Ga0207700_117018011	168
239	3300025939	Ga0207665_10215498	Ga0207665_102154982	168
240	3300025981	Ga0207640_10144938	Ga0207640_101449381	168
241	3300044842	Ga0466957_0204286	Ga0466957_0204286_352_945	168
242	3300045836	Ga0466958_0057214	Ga0466958_0057214_1325_1918	168
243	3300050510	nmdc:mga06r32_185627_c1	nmdc:mga06r32_185627_c1_1511_2020	168
244	3300005366	Ga0070659_100256171	Ga0070659_1002561711	169
245	3300005434	Ga0070709_10510031	Ga0070709_105100311	169
246	3300005436	Ga0070713_100135200	Ga0070713_1001352004	169
247	3300005530	Ga0070679_100169110	Ga0070679_1001691102	169
248	3300005563	Ga0068855_100135123	Ga0068855_1001351235	169
249	3300005577	Ga0068857_100086489	Ga0068857_1000864893	169
250	3300005614	Ga0068856_100614336	Ga0068856_1006143362	169
251	3300006178	Ga0075367_10291982	Ga0075367_102919821	169
252	3300009551	Ga0105238_10099578	Ga0105238_100995784	169
253	3300013104	Ga0157370_10104513	Ga0157370_101045135	169
254	3300013105	Ga0157369_10003381	Ga0157369_1000338112	169
255	3300013307	Ga0157372_10151840	Ga0157372_101518402	169
256	3300013307	Ga0157372_10444467	Ga0157372_104444673	169
257	3300020070	Ga0206356_11517563	Ga0206356_115175631	169
258	3300025917	Ga0207660_10202757	Ga0207660_102027572	169
259	3300025924	Ga0207694_10066218	Ga0207694_100662184	169
260	3300025928	Ga0207700_10205521	Ga0207700_102055212	169
261	3300025932	Ga0207690_10053670	Ga0207690_100536701	169
262	3300025949	Ga0207667_10191286	Ga0207667_101912862	169
263	3300026078	Ga0207702_10493064	Ga0207702_104930642	169
264	3300026116	Ga0207674_10188632	Ga0207674_101886321	169
265	3300030763	Ga0265763_1025540	Ga0265763_10255401	169
266	3300031241	Ga0265325_10087047	Ga0265325_100870471	169
267	3300031247	Ga0265340_10155305	Ga0265340_101553052	169
268	3300031249	Ga0265339_10182398	Ga0265339_101823981	169
269	3300031250	Ga0265331_10069560	Ga0265331_100695601	169
270	3300031344	Ga0265316_10475255	Ga0265316_104752552	169
271	3300031595	Ga0265313_10004577	Ga0265313_100045771	169
272	3300031711	Ga0265314_10101610	Ga0265314_101016101	169
273	3300035724	Ga0373933_0356699	Ga0373933_0356699_55_645	169
274	3300037312	Ga0395899_0071034	Ga0395899_0071034_137_733	169
275	3300037418	Ga0395900_0075121	Ga0395900_0075121_525_1121	169
276	3300037418	Ga0395900_0095338	Ga0395900_0095338_497_1093	169
277	3300037466	Ga0395898_0009874	Ga0395898_0009874_5050_5646	169
278	3300037466	Ga0395898_0086992	Ga0395898_0086992_73_684	169
279	3300038443	Ga0395901_0010157	Ga0395901_0010157_8894_9490	169
280	3300048903	Ga0496100_0105748	Ga0496100_0105748_29_595	169
281	3300048907	Ga0496104_0009626	Ga0496104_0009626_7152_7718	169
282	3300048917	Ga0496114_0254079	Ga0496114_0254079_23_589	169
283	3300049573	Ga0501037_0007951	Ga0501037_0007951_4733_5245	169
284	3300049574	Ga0501038_0118776	Ga0501038_0118776_731_1243	169
285	3300049574	Ga0501038_0497749	Ga0501038_0497749_38_616	169
286	3300049581	Ga0501047_0218086	Ga0501047_0218086_390_950	169
287	3300049581	Ga0501047_0250442	Ga0501047_0250442_53_565	169
288	3300049586	Ga0501070_0036886	Ga0501070_0036886_505_1080	169
289	3300049742	Ga0501080_0062873	Ga0501080_0062873_1139_1714	169
290	3300049823	Ga0501044_0094999	Ga0501044_0094999_2120_2680	169
291	3300049823	Ga0501044_0268053	Ga0501044_0268053_318_830	169
292	3300050494	nmdc:mga06z11_335434_c1	nmdc:mga06z11_335434_c1_109_648	169
293	3300050507	nmdc:mga05p37_139380_c1	nmdc:mga05p37_139380_c1_1909_2454	169
294	3300053077	Ga0495601_0146939	Ga0495601_0146939_171_710	169
295	3300053077	Ga0495601_0382944	Ga0495601_0382944_314_823	169
296	3300053085	Ga0495619_0195831	Ga0495619_0195831_703_1242	169
297	3300053130	Ga0500642_0135862	Ga0500642_0135862_535_1065	170
298	3300002070	JGI24750J21931_1000962	JGI24750J21931_10009624	172
299	3300002075	JGI24738J21930_10036611	JGI24738J21930_100366111	172
300	3300002077	JGI24744J21845_10003685	JGI24744J21845_100036853	172
301	3300002244	JGI24742J22300_10024036	JGI24742J22300_100240362	172
302	3300005328	Ga0070676_10069279	Ga0070676_100692794	172
303	3300005329	Ga0070683_100739278	Ga0070683_1007392781	172
304	3300005330	Ga0070690_100008795	Ga0070690_1000087959	172
305	3300005334	Ga0068869_100242469	Ga0068869_1002424693	172
306	3300005335	Ga0070666_10639660	Ga0070666_106396601	172
307	3300005338	Ga0068868_100077658	Ga0068868_1000776581	172
308	3300005347	Ga0070668_100064107	Ga0070668_1000641073	172
309	3300005354	Ga0070675_100043130	Ga0070675_1000431304	172
310	3300005356	Ga0070674_100080853	Ga0070674_1000808535	172
311	3300005364	Ga0070673_100095500	Ga0070673_1000955004	172
312	3300005365	Ga0070688_100020031	Ga0070688_1000200313	172
313	3300005366	Ga0070659_100132967	Ga0070659_1001329673	172
314	3300005367	Ga0070667_100511336	Ga0070667_1005113361	172
315	3300005437	Ga0070710_10107072	Ga0070710_101070723	172
316	3300005438	Ga0070701_10136906	Ga0070701_101369063	172
317	3300005439	Ga0070711_100024372	Ga0070711_1000243727	172
318	3300005440	Ga0070705_100432782	Ga0070705_1004327821	172
319	3300005441	Ga0070700_100058398	Ga0070700_1000583984	172
320	3300005455	Ga0070663_100196225	Ga0070663_1001962252	172
321	3300005459	Ga0068867_100030893	Ga0068867_1000308932	172
322	3300005543	Ga0070672_100059356	Ga0070672_1000593562	172
323	3300005544	Ga0070686_100026086	Ga0070686_1000260866	172
324	3300005545	Ga0070695_100756986	Ga0070695_1007569861	172
325	3300005546	Ga0070696_100580176	Ga0070696_1005801761	172
326	3300005549	Ga0070704_100461636	Ga0070704_1004616363	172
327	3300005563	Ga0068855_100472518	Ga0068855_1004725182	172
328	3300005614	Ga0068856_100211699	Ga0068856_1002116994	172
329	3300005616	Ga0068852_100016183	Ga0068852_1000161836	172
330	3300005718	Ga0068866_10050683	Ga0068866_100506832	172
331	3300005841	Ga0068863_100218984	Ga0068863_1002189843	172
332	3300005842	Ga0068858_100298906	Ga0068858_1002989061	172
333	3300005844	Ga0068862_100361889	Ga0068862_1003618891	172
334	3300006028	Ga0070717_10250863	Ga0070717_102508632	172
335	3300006038	Ga0075365_10019691	Ga0075365_100196913	172
336	3300006178	Ga0075367_10125047	Ga0075367_101250473	172
337	3300007788	Ga0099795_10114480	Ga0099795_101144802	172
338	3300009092	Ga0105250_10106342	Ga0105250_101063422	172
339	3300009094	Ga0111539_10097244	Ga0111539_100972444	172
340	3300009098	Ga0105245_10087464	Ga0105245_100874643	172
341	3300009148	Ga0105243_10180397	Ga0105243_101803972	172
342	3300011119	Ga0105246_10447267	Ga0105246_104472671	172
343	3300013296	Ga0157374_10080773	Ga0157374_100807734	172
344	3300014325	Ga0163163_10282563	Ga0163163_102825632	172
345	3300014326	Ga0157380_10639917	Ga0157380_106399172	172
346	3300014969	Ga0157376_10670256	Ga0157376_106702561	172
347	3300025321	Ga0207656_10003884	Ga0207656_100038841	172
348	3300025898	Ga0207692_10590159	Ga0207692_105901591	172
349	3300025900	Ga0207710_10105595	Ga0207710_101055952	172
350	3300025903	Ga0207680_10317908	Ga0207680_103179082	172
351	3300025908	Ga0207643_10001022	Ga0207643_1000102216	172
352	3300025916	Ga0207663_10029177	Ga0207663_100291776	172
353	3300025918	Ga0207662_10003326	Ga0207662_100033264	172
354	3300025919	Ga0207657_10007651	Ga0207657_1000765111	172
355	3300025923	Ga0207681_10088391	Ga0207681_100883912	172
356	3300025926	Ga0207659_10093304	Ga0207659_100933044	172
357	3300025928	Ga0207700_10106579	Ga0207700_101065794	172
358	3300025931	Ga0207644_10108431	Ga0207644_101084314	172
359	3300025933	Ga0207706_10007759	Ga0207706_100077593	172
360	3300025934	Ga0207686_10054730	Ga0207686_100547303	172
361	3300025935	Ga0207709_10967439	Ga0207709_109674391	172
362	3300025936	Ga0207670_10064576	Ga0207670_100645764	172
363	3300025940	Ga0207691_10029490	Ga0207691_100294905	172
364	3300025942	Ga0207689_10026581	Ga0207689_100265817	172
365	3300025944	Ga0207661_10045976	Ga0207661_100459763	172
366	3300025949	Ga0207667_10266182	Ga0207667_102661823	172
367	3300025960	Ga0207651_10044446	Ga0207651_100444464	172
368	3300026035	Ga0207703_10146022	Ga0207703_101460222	172
369	3300026041	Ga0207639_10588135	Ga0207639_105881351	172
370	3300026067	Ga0207678_10036458	Ga0207678_100364586	172
371	3300026075	Ga0207708_10019054	Ga0207708_100190545	172
372	3300026089	Ga0207648_10009547	Ga0207648_100095475	172
373	3300026095	Ga0207676_10035692	Ga0207676_100356923	172
374	3300026116	Ga0207674_10089314	Ga0207674_100893142	172
375	3300026118	Ga0207675_100007100	Ga0207675_10000710010	172
376	3300034817	Ga0373948_0174753	Ga0373948_0174753_14_532	172
377	3300035090	Ga0373949_0183056	Ga0373949_0183056_24_596	172
378	3300035171	Ga0373946_0439460	Ga0373946_0439460_24_542	172
379	3300046463	Ga0495653_0092190	Ga0495653_0092190_923_1441	172
380	3300046515	Ga0495620_0156628	Ga0495620_0156628_24_542	172
381	3300046516	Ga0495628_0261631	Ga0495628_0261631_343_861	172
382	3300046559	Ga0495667_0590468	Ga0495667_0590468_26_544	172
383	3300046616	Ga0495668_0166710	Ga0495668_0166710_280_798	172
384	3300046689	Ga0495613_0355505	Ga0495613_0355505_440_958	172
385	3300047321	Ga0495676_0285420	Ga0495676_0285420_98_616	172
386	3300047471	Ga0495684_0296696	Ga0495684_0296696_251_769	172
387	3300048088	Ga0495602_0355787	Ga0495602_0355787_148_666	172
388	3300048903	Ga0496100_0394094	Ga0496100_0394094_387_959	172
389	3300048904	Ga0496101_0065844	Ga0496101_0065844_856_1428	172
390	3300048905	Ga0496102_0029728	Ga0496102_0029728_2100_2672	172
391	3300048907	Ga0496104_0012788	Ga0496104_0012788_3227_3799	172
392	3300048908	Ga0496105_0009971	Ga0496105_0009971_6205_6777	172
393	3300048909	Ga0496106_0183324	Ga0496106_0183324_1066_1638	172
394	3300048911	Ga0496108_0028399	Ga0496108_0028399_1647_2219	172
395	3300048911	Ga0496108_0283745	Ga0496108_0283745_911_1429	172
396	3300048912	Ga0496109_0067355	Ga0496109_0067355_2438_3010	172
397	3300048914	Ga0496111_0279326	Ga0496111_0279326_644_1216	172
398	3300048915	Ga0496112_0066581	Ga0496112_0066581_95_667	172
399	3300050492	nmdc:mga0yw44_200104_c1	nmdc:mga0yw44_200104_c1_509_1027	172
400	3300050495	nmdc:mga04h51_46316_c1	nmdc:mga04h51_46316_c1_654_1172	172
401	3300050496	nmdc:mga07m45_235582_c1	nmdc:mga07m45_235582_c1_17_535	172
402	3300050511	nmdc:mga08y16_157860_c1	nmdc:mga08y16_157860_c1_127_645	172
403	3300053077	Ga0495601_0014795	Ga0495601_0014795_406_978	172
404	3300053077	Ga0495601_0151617	Ga0495601_0151617_388_906	172
405	3300053078	Ga0495612_0083556	Ga0495612_0083556_24_542	172
406	3300053083	Ga0495655_0041758	Ga0495655_0041758_53_625	172
407	3300053085	Ga0495619_0020156	Ga0495619_0020156_2868_3386	172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

67

151

0.85 PF00034

Cytochrom_C

Cytochrome c

69

155

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6onq-assembly1.cif.gz_A	crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1	0.7617	71	156
1n90-assembly1.cif.gz_A	following the c heme reduction in nitrite reductase from pseudomonas aeruginosa	0.7192	59	155
6loe-assembly1.cif.gz_E	cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii	0.7147	63	156
1gdv-assembly1.cif.gz_A	crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution	0.7097	71	158
1ls9-assembly1.cif.gz_A	structure of the cytochrome c6 from the green alga cladophora glomerata	0.7053	68	156

ID	Description	Score	Start	End	Superfamily
1h9yB01	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.7523	70	155	1.10.760.10
1h9yA01	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.7445	68	155	1.10.760.10
1ls9A00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.7053	68	156	1.10.760.10
1k3gA00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.7052	76	156	1.10.760.10
1hzuA01	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.6953	59	155	1.10.760.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1F5J4M6-F1-model_v4	Cytochrome c domain-containing protein	0.8453	38	166	GO:0009055 GO:0020037 GO:0046872
AF-A0A844L6J7-F1-model_v4	deleted	0.8301	42	168
AF-A0A537NXL5-F1-model_v4	Cytochrome c	0.8285	59	167	GO:0009055 GO:0020037 GO:0046872
AF-A0A2E9AKT7-F1-model_v4	Cytochrome c domain-containing protein	0.8273	67	167	GO:0009055 GO:0020037 GO:0046872
AF-A0A3C1NHV7-F1-model_v4	Cytochrome C	0.8225	30	167	GO:0009055 GO:0020037 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
83.13	0.71	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436467

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

67

151

0.85

PF00034

Cytochrom_C

Cytochrome c

69

155

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map