F436448

General Info

Members Datasets Scaffolds Average Seq Length
407 239 406 151

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10913529|Ga0111539_109135292
Length 171
Sequence VRNDPRIPAEKHVAAAQRLPKRTNLLPTVKRSSRVPYTTEQMFDLVNDIESYPKFLHWCRGARIDLTQGNTVEATLDIGVLGFHQSFRTRNTLKRPERIGIDLVSGPFRRLRGEWRFVAAPDRGSDISLTLAFEVTLSPFGAVFAKVFEELAAAQMTAFTDRAKKIYGAAT

Samples

Sample ID Description Type Environment
1 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
237 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 0
Rhizoplane 1.23
Rhizosphere 80.84
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000012 3300003215 Bacteria 308056
2 JGI25160J50197_1076936 3300003354 Bacteria 626
3 Ga0055531_10032953 3300003794 Bacteria 1680
4 Ga0065712_10017389 3300005290 Bacteria 2026
5 Ga0070658_10094305 3300005327 Bacteria 2469
6 Ga0070658_10380653 3300005327 Bacteria 1210
7 Ga0070658_10859534 3300005327 Bacteria 788
8 Ga0070683_100033618 3300005329 Bacteria 4677
9 Ga0070683_100045730 3300005329 Bacteria 4041
10 Ga0070683_100335794 3300005329 Bacteria 1439
11 Ga0070670_100006371 3300005331 Bacteria 9987
12 Ga0070670_100066728 3300005331 Bacteria 3088
13 Ga0070670_100452648 3300005331 Bacteria 1138
14 Ga0070666_10024584 3300005335 Bacteria 3925
15 Ga0070680_100276264 3300005336 Bacteria 1423
16 Ga0070680_100581587 3300005336 Bacteria 961
17 Ga0070680_101263490 3300005336 Bacteria 639
18 Ga0070682_100021189 3300005337 Bacteria 3831
19 Ga0070682_100435921 3300005337 Bacteria 1000
20 Ga0070682_100797983 3300005337 Bacteria 767
21 Ga0070682_101528710 3300005337 Bacteria 575
22 Ga0070660_100004349 3300005339 Bacteria 9784
23 Ga0070660_100006115 3300005339 Bacteria 8325
24 Ga0070689_100118841 3300005340 Bacteria 2110
25 Ga0070691_10428256 3300005341 Bacteria 751
26 Ga0070687_100290318 3300005343 Bacteria 1033
27 Ga0070661_100011466 3300005344 Bacteria 6174
28 Ga0070661_100092983 3300005344 Bacteria 2235
29 Ga0070661_100218959 3300005344 Bacteria 1460
30 Ga0070668_100013348 3300005347 Bacteria 6129
31 Ga0070669_100008049 3300005353 Bacteria 7527
32 Ga0070669_100885267 3300005353 Unclassified 762
33 Ga0070671_100026476 3300005355 Bacteria 4766
34 Ga0070674_100309858 3300005356 Bacteria 1262
35 Ga0070659_100005856 3300005366 Bacteria 8858
36 Ga0070659_100039627 3300005366 Bacteria 3678
37 Ga0070667_100043746 3300005367 Bacteria 3760
38 Ga0070714_101167109 3300005435 Bacteria 751
39 Ga0070701_10006604 3300005438 Bacteria 4893
40 Ga0070711_100729953 3300005439 Bacteria 836
41 Ga0070694_100728649 3300005444 Bacteria 808
42 Ga0070663_100097410 3300005455 Bacteria 2190
43 Ga0070663_100169462 3300005455 Bacteria 1686
44 Ga0070663_100298062 3300005455 Bacteria 1290
45 Ga0070662_100002114 3300005457 Bacteria 12181
46 Ga0070662_100347694 3300005457 Bacteria 1214
47 Ga0070681_10008301 3300005458 Bacteria 10168
48 Ga0070681_10386555 3300005458 Bacteria 1310
49 Ga0070681_10475941 3300005458 Bacteria 1161
50 Ga0068867_101081552 3300005459 Bacteria 731
51 Ga0070679_100005269 3300005530 Bacteria 11969
52 Ga0070679_100548523 3300005530 Bacteria 1100
53 Ga0070679_100635983 3300005530 Bacteria 1010
54 Ga0070684_100033539 3300005535 Bacteria 4385
55 Ga0070684_100080934 3300005535 Bacteria 2874
56 Ga0068853_100013086 3300005539 Bacteria 6768
57 Ga0068853_100112305 3300005539 Bacteria 2422
58 Ga0070672_100469348 3300005543 Bacteria 1086
59 Ga0070686_100171716 3300005544 Bacteria 1534
60 Ga0070696_100343425 3300005546 Bacteria 1154
61 Ga0070693_100215646 3300005547 Bacteria 1255
62 Ga0070693_100378402 3300005547 Bacteria 976
63 Ga0070665_100000804 3300005548 Bacteria 41010
64 Ga0070665_100429316 3300005548 Bacteria 1330
65 Ga0068855_100010764 3300005563 Bacteria 11042
66 Ga0068855_100012623 3300005563 Bacteria 10196
67 Ga0070664_100006018 3300005564 Bacteria 9809
68 Ga0070664_100025230 3300005564 Bacteria 4925
69 Ga0070664_100071376 3300005564 Bacteria 2976
70 Ga0070664_100519414 3300005564 Archaea 1099
71 Ga0068857_100073196 3300005577 Bacteria 3053
72 Ga0068857_100298422 3300005577 Bacteria 1485
73 Ga0068854_100322470 3300005578 Bacteria 1256
74 Ga0068854_100549921 3300005578 Bacteria 979
75 Ga0068854_101328169 3300005578 Bacteria 648
76 Ga0068856_100308623 3300005614 Bacteria 1600
77 Ga0070702_100048361 3300005615 Bacteria 2420
78 Ga0068852_100183620 3300005616 Bacteria 1968
79 Ga0068852_100953258 3300005616 Bacteria 876
80 Ga0068859_100564562 3300005617 Unclassified 1232
81 Ga0068864_100010270 3300005618 Bacteria 7732
82 Ga0068870_10400548 3300005840 Bacteria 893
83 Ga0068870_10718316 3300005840 Bacteria 691
84 Ga0068863_100004589 3300005841 Bacteria 13621
85 Ga0068863_100027514 3300005841 Bacteria 5424
86 Ga0068858_100007601 3300005842 Bacteria 10470
87 Ga0068858_100022471 3300005842 Bacteria 5886
88 Ga0068860_100009875 3300005843 Bacteria 9462
89 Ga0068862_100089614 3300005844 Bacteria 2677
90 Ga0068862_100100887 3300005844 Bacteria 2524
91 Ga0068862_100728410 3300005844 Bacteria 963
92 Ga0068862_101246944 3300005844 Bacteria 743
93 Ga0081455_10318320 3300005937 Bacteria 1109
94 Ga0081539_10274885 3300005985 Bacteria 736
95 Ga0081539_10293967 3300005985 Bacteria 701
96 Ga0075368_10001939 3300006042 Bacteria 6658
97 Ga0075364_10107109 3300006051 Bacteria 1863
98 Ga0070716_100055712 3300006173 Bacteria 2264
99 Ga0070716_100292002 3300006173 Bacteria 1130
100 Ga0097621_100016042 3300006237 Bacteria 5652
101 Ga0075433_10138593 3300006852 Bacteria 2162
102 Ga0075429_100008909 3300006880 Bacteria 8722
103 Ga0097620_100564565 3300006931 Unclassified 1232
104 Ga0099794_10238273 3300007265 Bacteria 937
105 Ga0105251_10001877 3300009011 Bacteria 17256
106 Ga0105240_11348484 3300009093 Bacteria 751
107 Ga0111539_10205682 3300009094 Bacteria 2294
108 Ga0111539_10913529 3300009094 Bacteria 1021
109 Ga0111539_12636499 3300009094 Bacteria 583
110 Ga0105245_10228772 3300009098 Bacteria 1798
111 Ga0114129_11216896 3300009147 Unclassified 937
112 Ga0105243_10086608 3300009148 Bacteria 2570
113 Ga0105243_10162301 3300009148 Bacteria 1928
114 Ga0105241_10051255 3300009174 Bacteria 3147
115 Ga0105248_10021955 3300009177 Bacteria 7074
116 Ga0105238_11165206 3300009551 Bacteria 795
117 Ga0105238_12687654 3300009551 Bacteria 534
118 Ga0105239_11137362 3300010375 Bacteria 899
119 Ga0105246_10000413 3300011119 Bacteria 22881
120 Ga0157373_10004554 3300013100 Bacteria 10422
121 Ga0157373_10037635 3300013100 Bacteria 3468
122 Ga0157373_10652707 3300013100 Bacteria 768
123 Ga0157371_10019888 3300013102 Bacteria 4947
124 Ga0157371_10270738 3300013102 Bacteria 1226
125 Ga0157371_10291011 3300013102 Bacteria 1181
126 Ga0157370_10007270 3300013104 Bacteria 12087
127 Ga0157370_10487517 3300013104 Bacteria 1132
128 Ga0157370_10543440 3300013104 Bacteria 1065
129 Ga0157369_10005301 3300013105 Bacteria 15025
130 Ga0157369_10123841 3300013105 Bacteria 2742
131 Ga0157369_11640262 3300013105 Bacteria 654
132 Ga0163162_10241919 3300013306 Bacteria 1936
133 Ga0163162_12259631 3300013306 Bacteria 625
134 Ga0157372_10001391 3300013307 Bacteria 26086
135 Ga0157372_10046520 3300013307 Bacteria 4817
136 Ga0157372_11467595 3300013307 Bacteria 786
137 Ga0157375_10308103 3300013308 Bacteria 1748
138 Ga0163163_11167685 3300014325 Bacteria 832
139 Ga0157380_10118117 3300014326 Bacteria 2241
140 Ga0157380_10795902 3300014326 Bacteria 962
141 Ga0157380_11211655 3300014326 Bacteria 799
142 Ga0157380_12930546 3300014326 Bacteria 543
143 Ga0157377_10155908 3300014745 Bacteria 1416
144 Ga0163161_10037381 3300017792 Bacteria 3481
145 Ga0163161_10305308 3300017792 Bacteria 1254
146 Ga0209758_1000059 3300025297 Bacteria 328458
147 Ga0209758_1018576 3300025297 Bacteria 3398
148 Ga0209050_1026566 3300025298 Bacteria 1932
149 Ga0207426_1011208 3300025302 Bacteria 3433
150 Ga0209051_1093814 3300025303 Bacteria 827
151 Ga0209257_1000629 3300025304 Bacteria 56718
152 Ga0209257_1044594 3300025304 Bacteria 1293
153 Ga0207656_10419915 3300025321 Unclassified 674
154 Ga0207713_1002654 3300025735 Bacteria 12838
155 Ga0207645_10784618 3300025907 Bacteria 648
156 Ga0207705_10000868 3300025909 Bacteria 24791
157 Ga0207705_10013151 3300025909 Bacteria 5975
158 Ga0207705_10043922 3300025909 Bacteria 3210
159 Ga0207705_10211665 3300025909 Bacteria 1470
160 Ga0207705_10249528 3300025909 Bacteria 1353
161 Ga0207705_10826945 3300025909 Bacteria 718
162 Ga0207654_10330604 3300025911 Bacteria 1044
163 Ga0207707_10231215 3300025912 Bacteria 1609
164 Ga0207663_10582092 3300025916 Bacteria 878
165 Ga0207660_10196457 3300025917 Bacteria 1574
166 Ga0207660_10476922 3300025917 Bacteria 1011
167 Ga0207660_10572223 3300025917 Unclassified 919
168 Ga0207660_10996125 3300025917 Bacteria 683
169 Ga0207662_10339096 3300025918 Bacteria 1007
170 Ga0207657_10000289 3300025919 Bacteria 53536
171 Ga0207657_10119724 3300025919 Bacteria 2166
172 Ga0207657_10702416 3300025919 Bacteria 785
173 Ga0207649_10008582 3300025920 Bacteria 5576
174 Ga0207652_10002367 3300025921 Bacteria 15939
175 Ga0207652_10034958 3300025921 Bacteria 4239
176 Ga0207652_10067973 3300025921 Bacteria 3091
177 Ga0207652_10068212 3300025921 Bacteria 3085
178 Ga0207652_10541181 3300025921 Bacteria 1047
179 Ga0207652_10576211 3300025921 Bacteria 1010
180 Ga0207681_10023322 3300025923 Bacteria 3957
181 Ga0207650_10048538 3300025925 Bacteria 3131
182 Ga0207650_10172525 3300025925 Bacteria 1719
183 Ga0207659_10044232 3300025926 Bacteria 3132
184 Ga0207687_10165054 3300025927 Bacteria 1703
185 Ga0207644_10008255 3300025931 Bacteria 6822
186 Ga0207644_10135741 3300025931 Bacteria 1888
187 Ga0207690_10003840 3300025932 Bacteria 8889
188 Ga0207690_10045961 3300025932 Bacteria 2888
189 Ga0207690_10735126 3300025932 Bacteria 813
190 Ga0207706_10001928 3300025933 Bacteria 20368
191 Ga0207706_10002852 3300025933 Bacteria 16779
192 Ga0207706_10679111 3300025933 Bacteria 881
193 Ga0207686_10526644 3300025934 Bacteria 921
194 Ga0207670_10109721 3300025936 Bacteria 1986
195 Ga0207665_10143205 3300025939 Bacteria 1707
196 Ga0207691_10441857 3300025940 Bacteria 1107
197 Ga0207711_10000816 3300025941 Bacteria 30549
198 Ga0207711_10029556 3300025941 Bacteria 4624
199 Ga0207689_10060213 3300025942 Bacteria 3122
200 Ga0207661_10017633 3300025944 Bacteria 5289
201 Ga0207661_10076797 3300025944 Bacteria 2744
202 Ga0207679_10277245 3300025945 Bacteria 1436
203 Ga0207667_10004101 3300025949 Bacteria 17906
204 Ga0207667_10046157 3300025949 Bacteria 4613
205 Ga0207667_10261203 3300025949 Bacteria 1771
206 Ga0207712_10144803 3300025961 Bacteria 1828
207 Ga0207668_10008074 3300025972 Bacteria 6267
208 Ga0207640_10073483 3300025981 Bacteria 2311
209 Ga0207658_10015031 3300025986 Bacteria 5307
210 Ga0207677_10008829 3300026023 Bacteria 5648
211 Ga0207703_10014224 3300026035 Bacteria 6206
212 Ga0207639_10101912 3300026041 Bacteria 2322
213 Ga0207678_10029455 3300026067 Bacteria 4792
214 Ga0207678_10060037 3300026067 Bacteria 3271
215 Ga0207678_10082780 3300026067 Bacteria 2745
216 Ga0207678_10191789 3300026067 Bacteria 1746
217 Ga0207708_10042368 3300026075 Bacteria 3470
218 Ga0207708_10480809 3300026075 Bacteria 1038
219 Ga0207702_10022593 3300026078 Bacteria 5216
220 Ga0207702_10115015 3300026078 Bacteria 2398
221 Ga0207641_10020704 3300026088 Bacteria 5404
222 Ga0207674_10018494 3300026116 Bacteria 7574
223 Ga0207674_10322907 3300026116 Bacteria 1493
224 Ga0207675_100003877 3300026118 Bacteria 14538
225 Ga0207698_10548478 3300026142 Bacteria 1133
226 Ga0207698_10596791 3300026142 Bacteria 1088
227 Ga0207698_10825568 3300026142 Bacteria 931
228 Ga0209968_1026544 3300027526 Bacteria 958
229 Ga0209982_1066323 3300027552 Bacteria 590
230 Ga0209966_1036663 3300027695 Bacteria 1010
231 Ga0207428_10028578 3300027907 Bacteria 4632
232 Ga0268266_10000215 3300028379 Bacteria 100801
233 Ga0268266_10445734 3300028379 Bacteria 1230
234 Ga0268265_10012128 3300028380 Bacteria 5835
235 Ga0268265_10034562 3300028380 Bacteria 3686
236 Ga0268265_10066189 3300028380 Bacteria 2792
237 Ga0268265_10095098 3300028380 Bacteria 2391
238 Ga0268264_10090805 3300028381 Bacteria 2633
239 Ga0307517_10155623 3300028786 Bacteria 1552
240 Ga0307512_10213849 3300030522 Bacteria 1020
241 Ga0307513_10176261 3300031456 Bacteria 2008
242 Ga0307408_100030876 3300031548 Bacteria 3725
243 Ga0307405_10223445 3300031731 Bacteria 1383
244 Ga0307405_10547086 3300031731 Bacteria 936
245 Ga0307413_10057100 3300031824 Bacteria 2385
246 Ga0307413_10333499 3300031824 Bacteria 1164
247 Ga0307410_10091437 3300031852 Bacteria 2161
248 Ga0307410_10129803 3300031852 Bacteria 1850
249 Ga0307410_10532324 3300031852 Bacteria 971
250 Ga0307406_10004070 3300031901 Bacteria 7959
251 Ga0307406_10054190 3300031901 Bacteria 2559
252 Ga0307406_10065797 3300031901 Bacteria 2357
253 Ga0307407_10360784 3300031903 Bacteria 1032
254 Ga0307407_10565073 3300031903 Unclassified 843
255 Ga0307412_10006836 3300031911 Bacteria 6474
256 Ga0307412_10033630 3300031911 Bacteria 3260
257 Ga0307412_10141446 3300031911 Bacteria 1763
258 Ga0307412_10399545 3300031911 Bacteria 1118
259 Ga0307409_101300561 3300031995 Bacteria 752
260 Ga0307409_102481636 3300031995 Bacteria 547
261 Ga0307416_100005856 3300032002 Bacteria 7623
262 Ga0307414_10040341 3300032004 Bacteria 3152
263 Ga0307414_10130752 3300032004 Bacteria 1948
264 Ga0307414_10136036 3300032004 Bacteria 1916
265 Ga0307414_10201095 3300032004 Bacteria 1620
266 Ga0307411_10074692 3300032005 Bacteria 2311
267 Ga0307411_10098250 3300032005 Bacteria 2063
268 Ga0307411_10115910 3300032005 Bacteria 1928
269 Ga0307411_10454941 3300032005 Bacteria 1072
270 Ga0307415_100031013 3300032126 Bacteria 3439
271 Ga0307415_100761729 3300032126 Bacteria 880
272 Ga0307415_101001476 3300032126 Bacteria 777
273 Ga0307415_101524712 3300032126 Bacteria 640
274 Ga0307415_102003577 3300032126 Bacteria 564
275 Ga0316583_10021398 3300032133 Bacteria 2318
276 Ga0307510_10306054 3300033180 Bacteria 1050
277 Ga0316582_0029222 3300036647 Bacteria 3347
278 Ga0316584_0074443 3300036712 Bacteria 2546
279 Ga0316584_0150407 3300036712 Bacteria 1733
280 Ga0436365_0685432 3300039437 Bacteria 826
281 Ga0436363_0796162 3300039450 Bacteria 4143
282 Ga0451853_1632845 3300041512 Bacteria 1047
283 Ga0439431_0011332 3300041997 Bacteria 2036
284 Ga0450912_001572 3300042116 Bacteria 1417
285 Ga0450923_086049 3300042125 Unclassified 712
286 Ga0439435_0136314 3300042436 Bacteria 779
287 Ga0450893_0010510 3300042532 Bacteria 1522
288 Ga0450893_0082732 3300042532 Bacteria 636
289 Ga0466967_0276989 3300045976 Bacteria 1609
290 Ga0466967_0793093 3300045976 Bacteria 940
291 Ga0495643_0026420 3300046522 Bacteria 3277
292 Ga0495643_0338819 3300046522 Bacteria 676
293 Ga0495621_0003771 3300046539 Bacteria 4201
294 Ga0495686_0299699 3300047472 Bacteria 888
295 Ga0495615_0001718 3300048090 Bacteria 3334
296 Ga0496101_0265691 3300048904 Bacteria 1339
297 Ga0496102_0947533 3300048905 Bacteria 782
298 Ga0496103_0080345 3300048906 Bacteria 2050
299 Ga0496105_0663358 3300048908 Bacteria 804
300 Ga0496114_0030744 3300048917 Bacteria 4419
301 Ga0496116_0047336 3300048919 Bacteria 2895
302 Ga0496117_0013886 3300048920 Bacteria 6982
303 Ga0496117_0046710 3300048920 Bacteria 3112
304 Ga0496118_0055941 3300048921 Bacteria 2971
305 Ga0496118_0067640 3300048921 Bacteria 2599
306 Ga0496120_0160246 3300048923 Bacteria 1122
307 Ga0496121_0007007 3300048924 Bacteria 13691
308 Ga0496122_0000589 3300048925 Bacteria 74585
309 Ga0496123_0044926 3300048926 Bacteria 3015
310 Ga0496124_0242693 3300048927 Bacteria 1338
311 Ga0496124_0434296 3300048927 Bacteria 900
312 Ga0496126_0024591 3300048929 Bacteria 5812
313 Ga0496126_0184524 3300048929 Bacteria 1770
314 Ga0501032_0436081 3300049569 Bacteria 840
315 Ga0501033_0278230 3300049570 Bacteria 1182
316 Ga0501033_0488694 3300049570 Bacteria 852
317 Ga0501034_0108289 3300049571 Bacteria 2770
318 Ga0501034_0356210 3300049571 Bacteria 1391
319 Ga0501034_1577093 3300049571 Bacteria 530
320 Ga0501036_0157745 3300049572 Bacteria 1914
321 Ga0501037_0861373 3300049573 Bacteria 596
322 Ga0501038_0058501 3300049574 Bacteria 3305
323 Ga0501038_0194170 3300049574 Bacteria 1632
324 Ga0501039_0560451 3300049575 Bacteria 896
325 Ga0501042_0102117 3300049578 Bacteria 2063
326 Ga0501043_0240297 3300049579 Bacteria 1397
327 Ga0501043_0688803 3300049579 Bacteria 747
328 Ga0501046_0253394 3300049580 Bacteria 1295
329 Ga0501047_0002597 3300049581 Bacteria 17196
330 Ga0501047_0015408 3300049581 Bacteria 7283
331 Ga0501047_1096691 3300049581 Bacteria 609
332 Ga0501047_1108457 3300049581 Bacteria 605
333 Ga0501048_1293050 3300049582 Bacteria 524
334 Ga0501067_0127871 3300049583 Bacteria 1414
335 Ga0501068_0042749 3300049584 Bacteria 2725
336 Ga0501068_0602616 3300049584 Bacteria 716
337 Ga0501070_0154899 3300049586 Bacteria 1890
338 Ga0501071_0118089 3300049587 Bacteria 1965
339 Ga0501072_0547855 3300049588 Bacteria 914
340 Ga0501073_0025678 3300049589 Bacteria 4222
341 Ga0501076_0453229 3300049592 Bacteria 1056
342 Ga0501076_0853518 3300049592 Bacteria 751
343 Ga0501224_004788 3300049664 Bacteria 1930
344 Ga0501249_043389 3300049679 Bacteria 1023
345 Ga0501079_0096170 3300049741 Bacteria 2296
346 Ga0501080_0069960 3300049742 Bacteria 3264
347 Ga0501080_0223884 3300049742 Bacteria 1721
348 Ga0501035_0119027 3300049822 Bacteria 2310
349 Ga0501035_0242574 3300049822 Bacteria 1532
350 Ga0501035_0301183 3300049822 Bacteria 1351
351 Ga0501035_0400118 3300049822 Bacteria 1143
352 Ga0501035_0428689 3300049822 Bacteria 1097
353 Ga0501035_0512910 3300049822 Bacteria 986
354 Ga0501035_0745185 3300049822 Bacteria 787
355 Ga0501044_0000608 3300049823 Bacteria 43410
356 Ga0501044_0001011 3300049823 Bacteria 33784
357 Ga0501044_0008988 3300049823 Bacteria 10925
358 Ga0501044_0048956 3300049823 Bacteria 4363
359 Ga0501044_0070680 3300049823 Bacteria 3550
360 Ga0501044_0138834 3300049823 Bacteria 2420
361 nmdc:mga00v17_195394_c1 3300050491 Bacteria 1307
362 nmdc:mga08y16_568037_c1 3300050511 Bacteria 1146
363 nmdc:mga08y16_862214_c1 3300050511 Bacteria 894
364 nmdc:mga0a205_193562_c1 3300050515 Bacteria 1925
365 Ga0500578_0243798 3300053086 Bacteria 1085
366 Ga0500643_000004 3300053087 Bacteria 857484
367 Ga0500643_019851 3300053087 Bacteria 2207
368 Ga0500651_0001510 3300053093 Bacteria 11751
369 Ga0500566_0048554 3300053094 Bacteria 2433
370 Ga0500641_0001477 3300053096 Bacteria 8377
371 Ga0500641_0033438 3300053096 Bacteria 2041
372 Ga0500641_0081394 3300053096 Bacteria 1374
373 Ga0500641_0120588 3300053096 Bacteria 1130
374 Ga0500555_003460 3300053103 Bacteria 4499
375 Ga0500594_0087075 3300053118 Bacteria 943
376 Ga0500594_0171032 3300053118 Bacteria 706
377 Ga0500595_019079 3300053119 Bacteria 2494
378 Ga0500607_005219 3300053121 Bacteria 8564
379 Ga0500608_268849 3300053122 Bacteria 653
380 Ga0500614_056089 3300053123 Bacteria 1047
381 Ga0500642_0014722 3300053130 Bacteria 2919
382 Ga0500642_0041427 3300053130 Bacteria 1991
383 Ga0500642_0505291 3300053130 Bacteria 510
384 Ga0500658_0033977 3300053134 Bacteria 2009
385 Ga0500658_0095872 3300053134 Bacteria 1289
386 Ga0500559_0340595 3300053136 Bacteria 702
387 Ga0500568_0004479 3300053139 Bacteria 7453
388 Ga0500568_0102775 3300053139 Bacteria 1071
389 Ga0500577_0111940 3300053142 Bacteria 1128
390 Ga0500577_0319705 3300053142 Bacteria 678
391 Ga0500588_0001322 3300053146 Bacteria 4662
392 Ga0500588_0087161 3300053146 Bacteria 1055
393 Ga0500588_0096875 3300053146 Bacteria 1011
394 Ga0500604_0003444 3300053151 Bacteria 4261
395 Ga0500604_0013690 3300053151 Bacteria 2200
396 Ga0500604_0099449 3300053151 Bacteria 958
397 Ga0500616_0000625 3300053153 Bacteria 42967
398 Ga0500619_040974 3300053154 Bacteria 1463
399 Ga0500622_0122815 3300053156 Bacteria 1258
400 Ga0500645_022856 3300053730 Bacteria 1919
401 Ga0500609_000040 3300053731 Bacteria 17340
402 Ga0500599_013439 3300053736 Bacteria 1107
403 Ga0500587_013776 3300053739 Bacteria 1023
404 Ga0501084_0062299 3300054114 Bacteria 3122
405 Ga0501082_0053406 3300060353 Bacteria 3483
406 Ga0501082_1190149 3300060353 Bacteria 666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0685432 Ga0436365_0685432_21_434 126
2 3300046522 Ga0495643_0338819 Ga0495643_0338819_246_659 126
3 3300049571 Ga0501034_1577093 Ga0501034_1577093_103_498 127
4 3300049582 Ga0501048_1293050 Ga0501048_1293050_21_404 127
5 3300053096 Ga0500641_0120588 Ga0500641_0120588_729_1112 127
6 3300053130 Ga0500642_0505291 Ga0500642_0505291_46_429 127
7 3300053142 Ga0500577_0319705 Ga0500577_0319705_148_639 127
8 3300053739 Ga0500587_013776 Ga0500587_013776_20_418 127
9 3300036647 Ga0316582_0029222 Ga0316582_0029222_1209_1643 133
10 3300036712 Ga0316584_0150407 Ga0316584_0150407_856_1290 133
11 iso_pu_bacteria 2848297114 2848298973 138
12 3300009094 Ga0111539_12636499 Ga0111539_126364991 139
13 3300009148 Ga0105243_10086608 Ga0105243_100866082 139
14 3300049587 Ga0501071_0118089 Ga0501071_0118089_661_1086 139
15 3300049592 Ga0501076_0453229 Ga0501076_0453229_191_616 139
16 3300049822 Ga0501035_0428689 Ga0501035_0428689_79_504 139
17 3300050511 nmdc:mga08y16_568037_c1 nmdc:mga08y16_568037_c1_676_1107 139
18 3300005331 Ga0070670_100066728 Ga0070670_1000667282 141
19 3300005336 Ga0070680_100276264 Ga0070680_1002762641 141
20 3300005336 Ga0070680_100581587 Ga0070680_1005815872 141
21 3300005347 Ga0070668_100013348 Ga0070668_1000133483 141
22 3300005353 Ga0070669_100008049 Ga0070669_1000080495 141
23 3300005355 Ga0070671_100026476 Ga0070671_1000264762 141
24 3300005367 Ga0070667_100043746 Ga0070667_1000437462 141
25 3300005439 Ga0070711_100729953 Ga0070711_1007299531 141
26 3300005458 Ga0070681_10386555 Ga0070681_103865552 141
27 3300005458 Ga0070681_10475941 Ga0070681_104759412 141
28 3300005548 Ga0070665_100000804 Ga0070665_10000080416 141
29 3300005841 Ga0068863_100027514 Ga0068863_1000275146 141
30 3300005842 Ga0068858_100022471 Ga0068858_1000224714 141
31 3300005843 Ga0068860_100009875 Ga0068860_1000098755 141
32 3300006173 Ga0070716_100055712 Ga0070716_1000557122 141
33 3300006173 Ga0070716_100292002 Ga0070716_1002920022 141
34 3300006880 Ga0075429_100008909 Ga0075429_1000089096 141
35 3300007265 Ga0099794_10238273 Ga0099794_102382732 141
36 3300009011 Ga0105251_10001877 Ga0105251_100018777 141
37 3300009093 Ga0105240_11348484 Ga0105240_113484841 141
38 3300009177 Ga0105248_10021955 Ga0105248_100219552 141
39 3300013104 Ga0157370_10543440 Ga0157370_105434402 141
40 3300013306 Ga0163162_10241919 Ga0163162_102419193 141
41 3300013306 Ga0163162_12259631 Ga0163162_122596312 141
42 3300017792 Ga0163161_10037381 Ga0163161_100373815 141
43 3300025735 Ga0207713_1002654 Ga0207713_10026547 141
44 3300025912 Ga0207707_10231215 Ga0207707_102312152 141
45 3300025916 Ga0207663_10582092 Ga0207663_105820922 141
46 3300025917 Ga0207660_10196457 Ga0207660_101964572 141
47 3300025921 Ga0207652_10541181 Ga0207652_105411811 141
48 3300025923 Ga0207681_10023322 Ga0207681_100233222 141
49 3300025925 Ga0207650_10172525 Ga0207650_101725252 141
50 3300025931 Ga0207644_10008255 Ga0207644_100082554 141
51 3300025939 Ga0207665_10143205 Ga0207665_101432051 141
52 3300025941 Ga0207711_10000816 Ga0207711_1000081626 141
53 3300025972 Ga0207668_10008074 Ga0207668_100080745 141
54 3300025986 Ga0207658_10015031 Ga0207658_100150314 141
55 3300026035 Ga0207703_10014224 Ga0207703_100142246 141
56 3300026088 Ga0207641_10020704 Ga0207641_100207043 141
57 3300027907 Ga0207428_10028578 Ga0207428_100285786 141
58 3300028379 Ga0268266_10000215 Ga0268266_1000021585 141
59 3300028380 Ga0268265_10012128 Ga0268265_100121284 141
60 3300028380 Ga0268265_10095098 Ga0268265_100950984 141
61 3300028381 Ga0268264_10090805 Ga0268264_100908052 141
62 3300031852 Ga0307410_10091437 Ga0307410_100914374 141
63 3300031903 Ga0307407_10360784 Ga0307407_103607841 141
64 3300039450 Ga0436363_0796162 Ga0436363_0796162_474_989 141
65 3300048904 Ga0496101_0265691 Ga0496101_0265691_677_1135 141
66 3300048905 Ga0496102_0947533 Ga0496102_0947533_243_701 141
67 3300048906 Ga0496103_0080345 Ga0496103_0080345_431_889 141
68 3300048908 Ga0496105_0663358 Ga0496105_0663358_282_740 141
69 3300048919 Ga0496116_0047336 Ga0496116_0047336_2118_2576 141
70 3300048920 Ga0496117_0013886 Ga0496117_0013886_229_687 141
71 3300048920 Ga0496117_0046710 Ga0496117_0046710_2488_2946 141
72 3300048921 Ga0496118_0055941 Ga0496118_0055941_177_635 141
73 3300048921 Ga0496118_0067640 Ga0496118_0067640_1919_2377 141
74 3300048923 Ga0496120_0160246 Ga0496120_0160246_433_891 141
75 3300048924 Ga0496121_0007007 Ga0496121_0007007_13157_13615 141
76 3300048926 Ga0496123_0044926 Ga0496123_0044926_2031_2489 141
77 3300048927 Ga0496124_0242693 Ga0496124_0242693_251_709 141
78 3300048927 Ga0496124_0434296 Ga0496124_0434296_251_709 141
79 3300048929 Ga0496126_0024591 Ga0496126_0024591_3661_4119 141
80 3300050491 nmdc:mga00v17_195394_c1 nmdc:mga00v17_195394_c1_151_609 141
81 3300005290 Ga0065712_10017389 Ga0065712_100173893 142
82 3300005327 Ga0070658_10094305 Ga0070658_100943051 142
83 3300005327 Ga0070658_10380653 Ga0070658_103806532 142
84 3300005327 Ga0070658_10859534 Ga0070658_108595341 142
85 3300005329 Ga0070683_100033618 Ga0070683_1000336184 142
86 3300005329 Ga0070683_100045730 Ga0070683_1000457302 142
87 3300005329 Ga0070683_100335794 Ga0070683_1003357943 142
88 3300005331 Ga0070670_100006371 Ga0070670_1000063718 142
89 3300005331 Ga0070670_100452648 Ga0070670_1004526481 142
90 3300005335 Ga0070666_10024584 Ga0070666_100245843 142
91 3300005336 Ga0070680_101263490 Ga0070680_1012634901 142
92 3300005337 Ga0070682_100435921 Ga0070682_1004359211 142
93 3300005337 Ga0070682_100797983 Ga0070682_1007979832 142
94 3300005337 Ga0070682_101528710 Ga0070682_1015287101 142
95 3300005339 Ga0070660_100004349 Ga0070660_1000043493 142
96 3300005339 Ga0070660_100006115 Ga0070660_1000061157 142
97 3300005340 Ga0070689_100118841 Ga0070689_1001188413 142
98 3300005341 Ga0070691_10428256 Ga0070691_104282562 142
99 3300005343 Ga0070687_100290318 Ga0070687_1002903182 142
100 3300005344 Ga0070661_100011466 Ga0070661_1000114667 142
101 3300005344 Ga0070661_100092983 Ga0070661_1000929831 142
102 3300005344 Ga0070661_100218959 Ga0070661_1002189592 142
103 3300005353 Ga0070669_100885267 Ga0070669_1008852672 142
104 3300005366 Ga0070659_100005856 Ga0070659_1000058567 142
105 3300005366 Ga0070659_100039627 Ga0070659_1000396274 142
106 3300005435 Ga0070714_101167109 Ga0070714_1011671092 142
107 3300005438 Ga0070701_10006604 Ga0070701_100066045 142
108 3300005444 Ga0070694_100728649 Ga0070694_1007286492 142
109 3300005455 Ga0070663_100097410 Ga0070663_1000974103 142
110 3300005455 Ga0070663_100169462 Ga0070663_1001694624 142
111 3300005455 Ga0070663_100298062 Ga0070663_1002980622 142
112 3300005457 Ga0070662_100002114 Ga0070662_1000021149 142
113 3300005457 Ga0070662_100347694 Ga0070662_1003476942 142
114 3300005458 Ga0070681_10008301 Ga0070681_100083015 142
115 3300005459 Ga0068867_101081552 Ga0068867_1010815522 142
116 3300005530 Ga0070679_100005269 Ga0070679_1000052694 142
117 3300005530 Ga0070679_100548523 Ga0070679_1005485232 142
118 3300005530 Ga0070679_100635983 Ga0070679_1006359832 142
119 3300005535 Ga0070684_100033539 Ga0070684_1000335395 142
120 3300005535 Ga0070684_100080934 Ga0070684_1000809344 142
121 3300005539 Ga0068853_100013086 Ga0068853_1000130867 142
122 3300005539 Ga0068853_100112305 Ga0068853_1001123052 142
123 3300005543 Ga0070672_100469348 Ga0070672_1004693481 142
124 3300005544 Ga0070686_100171716 Ga0070686_1001717163 142
125 3300005547 Ga0070693_100215646 Ga0070693_1002156463 142
126 3300005563 Ga0068855_100010764 Ga0068855_10001076411 142
127 3300005563 Ga0068855_100012623 Ga0068855_10001262310 142
128 3300005564 Ga0070664_100006018 Ga0070664_1000060187 142
129 3300005564 Ga0070664_100025230 Ga0070664_1000252307 142
130 3300005564 Ga0070664_100071376 Ga0070664_1000713762 142
131 3300005564 Ga0070664_100519414 Ga0070664_1005194141 142
132 3300005577 Ga0068857_100073196 Ga0068857_1000731963 142
133 3300005577 Ga0068857_100298422 Ga0068857_1002984223 142
134 3300005578 Ga0068854_100322470 Ga0068854_1003224702 142
135 3300005578 Ga0068854_100549921 Ga0068854_1005499212 142
136 3300005578 Ga0068854_101328169 Ga0068854_1013281692 142
137 3300005614 Ga0068856_100308623 Ga0068856_1003086233 142
138 3300005615 Ga0070702_100048361 Ga0070702_1000483612 142
139 3300005616 Ga0068852_100183620 Ga0068852_1001836202 142
140 3300005616 Ga0068852_100953258 Ga0068852_1009532582 142
141 3300005617 Ga0068859_100564562 Ga0068859_1005645623 142
142 3300005618 Ga0068864_100010270 Ga0068864_1000102704 142
143 3300005840 Ga0068870_10400548 Ga0068870_104005482 142
144 3300005840 Ga0068870_10718316 Ga0068870_107183162 142
145 3300005841 Ga0068863_100004589 Ga0068863_1000045897 142
146 3300005842 Ga0068858_100007601 Ga0068858_10000760110 142
147 3300005844 Ga0068862_100100887 Ga0068862_1001008872 142
148 3300005844 Ga0068862_100728410 Ga0068862_1007284102 142
149 3300005844 Ga0068862_101246944 Ga0068862_1012469442 142
150 3300006042 Ga0075368_10001939 Ga0075368_100019396 142
151 3300006051 Ga0075364_10107109 Ga0075364_101071093 142
152 3300006237 Ga0097621_100016042 Ga0097621_1000160422 142
153 3300006931 Ga0097620_100564565 Ga0097620_1005645653 142
154 3300009148 Ga0105243_10162301 Ga0105243_101623013 142
155 3300009174 Ga0105241_10051255 Ga0105241_100512552 142
156 3300009551 Ga0105238_11165206 Ga0105238_111652062 142
157 3300010375 Ga0105239_11137362 Ga0105239_111373622 142
158 3300011119 Ga0105246_10000413 Ga0105246_1000041316 142
159 3300013100 Ga0157373_10004554 Ga0157373_100045544 142
160 3300013100 Ga0157373_10037635 Ga0157373_100376352 142
161 3300013100 Ga0157373_10652707 Ga0157373_106527072 142
162 3300013102 Ga0157371_10019888 Ga0157371_100198887 142
163 3300013102 Ga0157371_10270738 Ga0157371_102707382 142
164 3300013102 Ga0157371_10291011 Ga0157371_102910113 142
165 3300013104 Ga0157370_10007270 Ga0157370_1000727011 142
166 3300013104 Ga0157370_10487517 Ga0157370_104875172 142
167 3300013105 Ga0157369_10005301 Ga0157369_100053018 142
168 3300013105 Ga0157369_10123841 Ga0157369_101238414 142
169 3300013105 Ga0157369_11640262 Ga0157369_116402622 142
170 3300013307 Ga0157372_10001391 Ga0157372_100013919 142
171 3300013307 Ga0157372_10046520 Ga0157372_100465204 142
172 3300013307 Ga0157372_11467595 Ga0157372_114675952 142
173 3300013308 Ga0157375_10308103 Ga0157375_103081032 142
174 3300014325 Ga0163163_11167685 Ga0163163_111676852 142
175 3300014326 Ga0157380_10795902 Ga0157380_107959022 142
176 3300014326 Ga0157380_11211655 Ga0157380_112116552 142
177 3300014326 Ga0157380_12930546 Ga0157380_129305461 142
178 3300017792 Ga0163161_10305308 Ga0163161_103053082 142
179 3300025321 Ga0207656_10419915 Ga0207656_104199151 142
180 3300025907 Ga0207645_10784618 Ga0207645_107846182 142
181 3300025909 Ga0207705_10000868 Ga0207705_1000086821 142
182 3300025909 Ga0207705_10013151 Ga0207705_100131512 142
183 3300025909 Ga0207705_10043922 Ga0207705_100439221 142
184 3300025909 Ga0207705_10211665 Ga0207705_102116652 142
185 3300025909 Ga0207705_10249528 Ga0207705_102495282 142
186 3300025909 Ga0207705_10826945 Ga0207705_108269452 142
187 3300025911 Ga0207654_10330604 Ga0207654_103306042 142
188 3300025917 Ga0207660_10476922 Ga0207660_104769222 142
189 3300025917 Ga0207660_10572223 Ga0207660_105722232 142
190 3300025917 Ga0207660_10996125 Ga0207660_109961251 142
191 3300025918 Ga0207662_10339096 Ga0207662_103390962 142
192 3300025919 Ga0207657_10000289 Ga0207657_1000028941 142
193 3300025919 Ga0207657_10119724 Ga0207657_101197242 142
194 3300025919 Ga0207657_10702416 Ga0207657_107024162 142
195 3300025920 Ga0207649_10008582 Ga0207649_100085828 142
196 3300025921 Ga0207652_10002367 Ga0207652_100023676 142
197 3300025921 Ga0207652_10034958 Ga0207652_100349584 142
198 3300025921 Ga0207652_10067973 Ga0207652_100679734 142
199 3300025921 Ga0207652_10068212 Ga0207652_100682122 142
200 3300025921 Ga0207652_10576211 Ga0207652_105762112 142
201 3300025925 Ga0207650_10048538 Ga0207650_100485384 142
202 3300025931 Ga0207644_10135741 Ga0207644_101357411 142
203 3300025932 Ga0207690_10003840 Ga0207690_100038405 142
204 3300025932 Ga0207690_10045961 Ga0207690_100459614 142
205 3300025932 Ga0207690_10735126 Ga0207690_107351262 142
206 3300025933 Ga0207706_10001928 Ga0207706_100019287 142
207 3300025933 Ga0207706_10002852 Ga0207706_1000285213 142
208 3300025933 Ga0207706_10679111 Ga0207706_106791112 142
209 3300025934 Ga0207686_10526644 Ga0207686_105266443 142
210 3300025936 Ga0207670_10109721 Ga0207670_101097212 142
211 3300025940 Ga0207691_10441857 Ga0207691_104418572 142
212 3300025941 Ga0207711_10029556 Ga0207711_100295562 142
213 3300025942 Ga0207689_10060213 Ga0207689_100602133 142
214 3300025944 Ga0207661_10017633 Ga0207661_100176334 142
215 3300025944 Ga0207661_10076797 Ga0207661_100767974 142
216 3300025945 Ga0207679_10277245 Ga0207679_102772452 142
217 3300025949 Ga0207667_10004101 Ga0207667_1000410112 142
218 3300025949 Ga0207667_10046157 Ga0207667_100461572 142
219 3300025949 Ga0207667_10261203 Ga0207667_102612034 142
220 3300025961 Ga0207712_10144803 Ga0207712_101448032 142
221 3300025981 Ga0207640_10073483 Ga0207640_100734834 142
222 3300026023 Ga0207677_10008829 Ga0207677_100088292 142
223 3300026041 Ga0207639_10101912 Ga0207639_101019122 142
224 3300026067 Ga0207678_10029455 Ga0207678_100294556 142
225 3300026067 Ga0207678_10060037 Ga0207678_100600372 142
226 3300026067 Ga0207678_10082780 Ga0207678_100827802 142
227 3300026067 Ga0207678_10191789 Ga0207678_101917894 142
228 3300026075 Ga0207708_10042368 Ga0207708_100423683 142
229 3300026075 Ga0207708_10480809 Ga0207708_104808092 142
230 3300026078 Ga0207702_10022593 Ga0207702_100225932 142
231 3300026078 Ga0207702_10115015 Ga0207702_101150152 142
232 3300026116 Ga0207674_10018494 Ga0207674_100184946 142
233 3300026116 Ga0207674_10322907 Ga0207674_103229073 142
234 3300026118 Ga0207675_100003877 Ga0207675_10000387714 142
235 3300026142 Ga0207698_10548478 Ga0207698_105484782 142
236 3300026142 Ga0207698_10596791 Ga0207698_105967912 142
237 3300026142 Ga0207698_10825568 Ga0207698_108255682 142
238 3300027526 Ga0209968_1026544 Ga0209968_10265441 142
239 3300027552 Ga0209982_1066323 Ga0209982_10663232 142
240 3300027695 Ga0209966_1036663 Ga0209966_10366632 142
241 3300028380 Ga0268265_10034562 Ga0268265_100345624 142
242 3300031548 Ga0307408_100030876 Ga0307408_1000308764 142
243 3300031731 Ga0307405_10223445 Ga0307405_102234453 142
244 3300031731 Ga0307405_10547086 Ga0307405_105470862 142
245 3300031824 Ga0307413_10057100 Ga0307413_100571002 142
246 3300031824 Ga0307413_10333499 Ga0307413_103334992 142
247 3300031852 Ga0307410_10129803 Ga0307410_101298033 142
248 3300031852 Ga0307410_10532324 Ga0307410_105323242 142
249 3300031901 Ga0307406_10004070 Ga0307406_100040707 142
250 3300031901 Ga0307406_10054190 Ga0307406_100541902 142
251 3300031901 Ga0307406_10065797 Ga0307406_100657972 142
252 3300031911 Ga0307412_10006836 Ga0307412_100068367 142
253 3300031911 Ga0307412_10033630 Ga0307412_100336304 142
254 3300031911 Ga0307412_10399545 Ga0307412_103995452 142
255 3300031995 Ga0307409_101300561 Ga0307409_1013005611 142
256 3300031995 Ga0307409_102481636 Ga0307409_1024816361 142
257 3300032002 Ga0307416_100005856 Ga0307416_1000058564 142
258 3300032004 Ga0307414_10040341 Ga0307414_100403413 142
259 3300032004 Ga0307414_10130752 Ga0307414_101307524 142
260 3300032004 Ga0307414_10136036 Ga0307414_101360362 142
261 3300032004 Ga0307414_10201095 Ga0307414_102010952 142
262 3300032005 Ga0307411_10074692 Ga0307411_100746924 142
263 3300032005 Ga0307411_10098250 Ga0307411_100982503 142
264 3300032005 Ga0307411_10115910 Ga0307411_101159103 142
265 3300032005 Ga0307411_10454941 Ga0307411_104549412 142
266 3300032126 Ga0307415_100031013 Ga0307415_1000310132 142
267 3300032126 Ga0307415_100761729 Ga0307415_1007617292 142
268 3300032126 Ga0307415_101001476 Ga0307415_1010014761 142
269 3300032126 Ga0307415_101524712 Ga0307415_1015247122 142
270 3300032126 Ga0307415_102003577 Ga0307415_1020035771 142
271 3300032133 Ga0316583_10021398 Ga0316583_100213982 142
272 3300033180 Ga0307510_10306054 Ga0307510_103060542 142
273 3300036712 Ga0316584_0074443 Ga0316584_0074443_945_1406 142
274 3300041512 Ga0451853_1632845 Ga0451853_1632845_418_879 142
275 3300041997 Ga0439431_0011332 Ga0439431_0011332_556_1017 142
276 3300042116 Ga0450912_001572 Ga0450912_001572_144_605 142
277 3300042125 Ga0450923_086049 Ga0450923_086049_170_610 142
278 3300042436 Ga0439435_0136314 Ga0439435_0136314_128_589 142
279 3300042532 Ga0450893_0010510 Ga0450893_0010510_1037_1498 142
280 3300042532 Ga0450893_0082732 Ga0450893_0082732_124_585 142
281 3300045976 Ga0466967_0276989 Ga0466967_0276989_80_547 142
282 3300046522 Ga0495643_0026420 Ga0495643_0026420_1372_1833 142
283 3300046539 Ga0495621_0003771 Ga0495621_0003771_97_558 142
284 3300048090 Ga0495615_0001718 Ga0495615_0001718_2091_2552 142
285 3300048917 Ga0496114_0030744 Ga0496114_0030744_1109_1570 142
286 3300048925 Ga0496122_0000589 Ga0496122_0000589_50193_50669 142
287 3300048929 Ga0496126_0184524 Ga0496126_0184524_741_1217 142
288 3300049571 Ga0501034_0356210 Ga0501034_0356210_295_756 142
289 3300049575 Ga0501039_0560451 Ga0501039_0560451_361_822 142
290 3300049581 Ga0501047_1108457 Ga0501047_1108457_112_573 142
291 3300049664 Ga0501224_004788 Ga0501224_004788_905_1366 142
292 3300049679 Ga0501249_043389 Ga0501249_043389_252_713 142
293 3300049822 Ga0501035_0301183 Ga0501035_0301183_154_615 142
294 3300049822 Ga0501035_0400118 Ga0501035_0400118_218_679 142
295 3300049822 Ga0501035_0512910 Ga0501035_0512910_329_790 142
296 3300049823 Ga0501044_0000608 Ga0501044_0000608_38455_38916 142
297 3300049823 Ga0501044_0070680 Ga0501044_0070680_173_634 142
298 3300049823 Ga0501044_0138834 Ga0501044_0138834_1604_2065 142
299 3300053087 Ga0500643_000004 Ga0500643_000004_837202_837663 142
300 3300053096 Ga0500641_0033438 Ga0500641_0033438_588_1049 142
301 3300053118 Ga0500594_0171032 Ga0500594_0171032_118_579 142
302 3300053121 Ga0500607_005219 Ga0500607_005219_6303_6770 142
303 3300053122 Ga0500608_268849 Ga0500608_268849_179_622 142
304 3300053136 Ga0500559_0340595 Ga0500559_0340595_141_584 142
305 3300053146 Ga0500588_0087161 Ga0500588_0087161_306_767 142
306 3300053151 Ga0500604_0099449 Ga0500604_0099449_89_550 142
307 3300053153 Ga0500616_0000625 Ga0500616_0000625_19391_19852 142
308 3300053154 Ga0500619_040974 Ga0500619_040974_646_1089 142
309 3300053730 Ga0500645_022856 Ga0500645_022856_1358_1828 142
310 3300003794 Ga0055531_10032953 Ga0055531_100329532 143
311 3300005546 Ga0070696_100343425 Ga0070696_1003434253 143
312 3300005985 Ga0081539_10274885 Ga0081539_102748852 143
313 3300006852 Ga0075433_10138593 Ga0075433_101385933 143
314 3300009147 Ga0114129_11216896 Ga0114129_112168962 143
315 3300025298 Ga0209050_1026566 Ga0209050_10265664 143
316 3300025303 Ga0209051_1093814 Ga0209051_10938141 143
317 3300025304 Ga0209257_1000629 Ga0209257_100062930 143
318 3300050515 nmdc:mga0a205_193562_c1 nmdc:mga0a205_193562_c1_639_1130 143
319 3300005337 Ga0070682_100021189 Ga0070682_1000211892 144
320 3300005356 Ga0070674_100309858 Ga0070674_1003098583 144
321 3300005548 Ga0070665_100429316 Ga0070665_1004293162 144
322 3300005985 Ga0081539_10293967 Ga0081539_102939672 144
323 3300009094 Ga0111539_10205682 Ga0111539_102056822 144
324 3300009094 Ga0111539_10913529 Ga0111539_109135292 144
325 3300009098 Ga0105245_10228772 Ga0105245_102287723 144
326 3300014326 Ga0157380_10118117 Ga0157380_101181172 144
327 3300014745 Ga0157377_10155908 Ga0157377_101559081 144
328 3300025926 Ga0207659_10044232 Ga0207659_100442325 144
329 3300025927 Ga0207687_10165054 Ga0207687_101650543 144
330 3300028379 Ga0268266_10445734 Ga0268266_104457342 144
331 3300031903 Ga0307407_10565073 Ga0307407_105650732 144
332 3300031911 Ga0307412_10141446 Ga0307412_101414462 144
333 3300045976 Ga0466967_0793093 Ga0466967_0793093_10_549 144
334 3300049570 Ga0501033_0488694 Ga0501033_0488694_74_511 144
335 3300049572 Ga0501036_0157745 Ga0501036_0157745_1203_1700 144
336 3300049574 Ga0501038_0194170 Ga0501038_0194170_201_638 144
337 3300049578 Ga0501042_0102117 Ga0501042_0102117_799_1296 144
338 3300049581 Ga0501047_0015408 Ga0501047_0015408_3886_4323 144
339 3300049822 Ga0501035_0119027 Ga0501035_0119027_1358_1795 144
340 3300049823 Ga0501044_0001011 Ga0501044_0001011_20509_20946 144
341 3300050511 nmdc:mga08y16_862214_c1 nmdc:mga08y16_862214_c1_100_615 144
342 3300053096 Ga0500641_0001477 Ga0500641_0001477_6239_6736 144
343 3300003215 JGI25153J46596_10000012 JGI25153J46596_1000001298 145
344 3300003354 JGI25160J50197_1076936 JGI25160J50197_10769361 145
345 3300005547 Ga0070693_100378402 Ga0070693_1003784022 145
346 3300005844 Ga0068862_100089614 Ga0068862_1000896143 145
347 3300005937 Ga0081455_10318320 Ga0081455_103183202 145
348 3300009551 Ga0105238_12687654 Ga0105238_126876541 145
349 3300025297 Ga0209758_1000059 Ga0209758_1000059189 145
350 3300025297 Ga0209758_1018576 Ga0209758_10185764 145
351 3300025302 Ga0207426_1011208 Ga0207426_10112084 145
352 3300025304 Ga0209257_1044594 Ga0209257_10445942 145
353 3300028380 Ga0268265_10066189 Ga0268265_100661892 145
354 3300028786 Ga0307517_10155623 Ga0307517_101556232 145
355 3300030522 Ga0307512_10213849 Ga0307512_102138492 145
356 3300031456 Ga0307513_10176261 Ga0307513_101762611 145
357 3300047472 Ga0495686_0299699 Ga0495686_0299699_129_566 145
358 3300049569 Ga0501032_0436081 Ga0501032_0436081_112_549 145
359 3300049570 Ga0501033_0278230 Ga0501033_0278230_691_1128 145
360 3300049571 Ga0501034_0108289 Ga0501034_0108289_2309_2746 145
361 3300049573 Ga0501037_0861373 Ga0501037_0861373_132_569 145
362 3300049574 Ga0501038_0058501 Ga0501038_0058501_2245_2682 145
363 3300049579 Ga0501043_0240297 Ga0501043_0240297_240_689 145
364 3300049579 Ga0501043_0688803 Ga0501043_0688803_71_508 145
365 3300049580 Ga0501046_0253394 Ga0501046_0253394_444_881 145
366 3300049581 Ga0501047_0002597 Ga0501047_0002597_14989_15426 145
367 3300049581 Ga0501047_1096691 Ga0501047_1096691_12_461 145
368 3300049583 Ga0501067_0127871 Ga0501067_0127871_585_1022 145
369 3300049584 Ga0501068_0042749 Ga0501068_0042749_2001_2438 145
370 3300049584 Ga0501068_0602616 Ga0501068_0602616_87_536 145
371 3300049586 Ga0501070_0154899 Ga0501070_0154899_1378_1827 145
372 3300049588 Ga0501072_0547855 Ga0501072_0547855_179_628 145
373 3300049589 Ga0501073_0025678 Ga0501073_0025678_998_1435 145
374 3300049592 Ga0501076_0853518 Ga0501076_0853518_181_618 145
375 3300049741 Ga0501079_0096170 Ga0501079_0096170_1097_1534 145
376 3300049742 Ga0501080_0069960 Ga0501080_0069960_2524_2961 145
377 3300049742 Ga0501080_0223884 Ga0501080_0223884_1122_1571 145
378 3300049822 Ga0501035_0242574 Ga0501035_0242574_343_792 145
379 3300049822 Ga0501035_0745185 Ga0501035_0745185_196_645 145
380 3300049823 Ga0501044_0008988 Ga0501044_0008988_3829_4266 145
381 3300049823 Ga0501044_0048956 Ga0501044_0048956_2925_3374 145
382 3300053086 Ga0500578_0243798 Ga0500578_0243798_362_817 145
383 3300053087 Ga0500643_019851 Ga0500643_019851_1686_2138 145
384 3300053093 Ga0500651_0001510 Ga0500651_0001510_5614_6051 145
385 3300053094 Ga0500566_0048554 Ga0500566_0048554_1802_2239 145
386 3300053096 Ga0500641_0081394 Ga0500641_0081394_210_647 145
387 3300053103 Ga0500555_003460 Ga0500555_003460_1960_2397 145
388 3300053118 Ga0500594_0087075 Ga0500594_0087075_153_605 145
389 3300053119 Ga0500595_019079 Ga0500595_019079_1158_1595 145
390 3300053123 Ga0500614_056089 Ga0500614_056089_117_554 145
391 3300053130 Ga0500642_0014722 Ga0500642_0014722_1667_2119 145
392 3300053130 Ga0500642_0041427 Ga0500642_0041427_80_532 145
393 3300053134 Ga0500658_0033977 Ga0500658_0033977_1397_1834 145
394 3300053134 Ga0500658_0095872 Ga0500658_0095872_593_1030 145
395 3300053139 Ga0500568_0004479 Ga0500568_0004479_3602_4054 145
396 3300053139 Ga0500568_0102775 Ga0500568_0102775_256_708 145
397 3300053142 Ga0500577_0111940 Ga0500577_0111940_576_1028 145
398 3300053146 Ga0500588_0001322 Ga0500588_0001322_110_565 145
399 3300053146 Ga0500588_0096875 Ga0500588_0096875_481_918 145
400 3300053151 Ga0500604_0003444 Ga0500604_0003444_2202_2639 145
401 3300053151 Ga0500604_0013690 Ga0500604_0013690_460_912 145
402 3300053156 Ga0500622_0122815 Ga0500622_0122815_505_942 145
403 3300053731 Ga0500609_000040 Ga0500609_000040_15250_15702 145
404 3300053736 Ga0500599_013439 Ga0500599_013439_537_989 145
405 3300054114 Ga0501084_0062299 Ga0501084_0062299_2659_3096 145
406 3300060353 Ga0501082_0053406 Ga0501082_0053406_2034_2471 145
407 3300060353 Ga0501082_1190149 Ga0501082_1190149_36_485 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

35

160

0.95

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

27

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8741 2 142
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8649 4 145
3tl1-assembly2.cif.gz_B crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase 0.856 5 143
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8467 2 142
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.843 4 145
ID Description Score Start End Superfamily
af_Q304F0_1_147_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9361 4 145 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9234 4 145 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9156 2 144 3.30.530.20
af_Q304F0_1_147_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9114 4 145 3.30.530.20
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9029 4 145 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3B9TV51-F1-model_v4 Ubiquinone-binding protein 0.9775 6 101 GO:0045333
GO:0048039
AF-A0A2E2YHM3-F1-model_v4 Type II toxin-antitoxin system RatA family toxin (Ubiquinone-binding protein) 0.9739 4 144 GO:0045333
GO:0048039
AF-W6K9C5-F1-model_v4 Coenzyme Q-binding protein COQ10 START domain-containing protein 0.9722 4 145 GO:0045333
GO:0048039
AF-A0A2E8T7S0-F1-model_v4 Ubiquinone-binding protein 0.967 4 145 GO:0045333
GO:0048039
AF-A0A2E6U2D2-F1-model_v4 Ubiquinone-binding protein 0.9663 4 145 GO:0045333
GO:0048039

Feature Viewer

pLDDT pTM Quality
95.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map