F436430

General Info

Members Datasets Scaffolds Average Seq Length
407 243 815 290

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100023493|Ga0075363_1000234932
Length 325
Sequence MAGPGAHWSVGRVPDCGVMQMRSRFRSDRRLTVRMTVTLFLLGLLYVAFFAALIVLLKSWLMVVALIAVMFVAQFWFSDKIAMFAMRGRVVGPVEYPELHAVVDRLCAIADMPKPVVAVSTMDMPNAFATGRNPDNAVVCVTTGLLDRLEPAELEGVLAHELSHVAHKDVAVITIASFLGVIAGLIVRFAFYSQLFSGRKDQNTAMLFAGVMGVSAAVYALSFLLIRALSRYRELAADRAAAHLTGRPSALASALTKVSGELARIPTKDLRTAQAFNAFYFTPATGKEPGIERYFSTHPSLEQRLEQLGRISAELGEPLEPGKAG

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
31 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
32 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
50 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
51 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
55 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
56 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
159 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
167 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
168 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
169 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
170 2643221548 Streptomyces sp. Root55 Isolate Unclassified
171 2643221578 Streptomyces sp. Root63 Isolate Unclassified
172 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
173 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
174 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
175 2643221647 Streptomyces sp. Root369 Isolate Unclassified
176 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
177 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
178 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
179 2643221714 Streptomyces sp. Root264 Isolate Unclassified
180 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
181 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
182 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
183 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
184 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
185 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
186 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
187 2808606448 Streptomyces sp. 193411 Isolate Unclassified
188 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
189 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
190 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
191 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
192 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
193 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
194 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
195 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
196 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
197 2867369537 Streptomyces sp. Z26 Isolate Unclassified
198 2867428634 Streptomyces sp. RP5T Isolate Unclassified
199 2867475112 Streptomyces sp. TM32 Isolate Unclassified
200 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
201 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
202 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
203 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
204 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
205 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
206 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
207 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
208 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
209 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
210 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
211 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
212 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
213 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
214 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
215 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
216 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
217 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
218 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
219 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
220 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
221 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
222 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
223 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
224 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
225 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
226 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
227 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
228 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
229 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
230 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
231 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
232 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
233 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
234 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
235 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
236 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
237 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
238 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
239 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
240 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
241 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
242 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
243 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.62
Metatranscriptomes 1.72
Isolates 19.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 0
Rhizoplane 0.49
Rhizosphere 83.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100023493 3300006048 Bacteria 3125
2 JGI25153J46596_10023562 3300003215 Bacteria 2240
3 rootH1_10007390 3300003316 Bacteria 7002
4 rootH2_10051476 3300003320 Bacteria 7771
5 rootH1_10020609 3300003316 Bacteria 1294
6 rootH1_10020609 3300003323 Bacteria 6283
7 rootH1_10037813 3300003323 Bacteria 3074
8 Ga0058863_11822532 3300004799 Bacteria 986
9 Ga0070714_100000007 3300005435 Bacteria 285654
10 Ga0070714_100003760 3300005435 Bacteria 11386
11 Ga0068853_100063779 3300005539 Bacteria 3192
12 Ga0075365_10026911 3300006038 Bacteria 3654
13 Ga0075367_10003049 3300006178 Bacteria 7850
14 Ga0075370_10085413 3300006353 Bacteria 1817
15 Ga0105243_10131651 3300009148 Bacteria 2122
16 Ga0157369_10549217 3300013105 Bacteria 1194
17 Ga0157372_10173716 3300013307 Bacteria 2493
18 Ga0182008_10000719 3300014497 Bacteria 23643
19 Ga0182007_10002002 3300015262 Bacteria 10504
20 Ga0183367_1009 3300015688 Bacteria 484598
21 Ga0197907_10513251 3300020069 Bacteria 1925
22 Ga0197907_10763782 3300020069 Bacteria 3084
23 Ga0206356_11431549 3300020070 Bacteria 2325
24 Ga0206352_11034122 3300020078 Bacteria 957
25 Ga0224712_10066093 3300022467 Bacteria 1455
26 Ga0209758_1003928 3300025297 Bacteria 12960
27 Ga0207426_1000755 3300025302 Bacteria 36197
28 Ga0207426_1001873 3300025302 Bacteria 15425
29 Ga0207647_10028647 3300025904 Bacteria 3614
30 Ga0207705_10119887 3300025909 Bacteria 1951
31 Ga0207664_10000014 3300025929 Bacteria 249865
32 Ga0207664_10027935 3300025929 Bacteria 4283
33 Ga0207664_10170134 3300025929 Bacteria 1864
34 Ga0207639_10145233 3300026041 Bacteria 1981
35 Ga0209371_1021873 3300027312 Bacteria 1541
36 Ga0209371_1030385 3300027312 Bacteria 1184
37 Ga0307515_10229548 3300028794 Bacteria 1652
38 Ga0268256_1016516 3300030500 Bacteria 2113
39 Ga0268256_1024807 3300030500 Bacteria 1533
40 Ga0307511_10000609 3300030521 Bacteria 38325
41 Ga0307511_10016293 3300030521 Bacteria 7166
42 Ga0307512_10001818 3300030522 Bacteria 28729
43 Ga0307513_10059083 3300031456 Bacteria 4071
44 Ga0307509_10017106 3300031507 Bacteria 8358
45 Ga0307508_10002360 3300031616 Bacteria 19966
46 Ga0307508_10037228 3300031616 Bacteria 4377
47 Ga0307508_10286399 3300031616 Bacteria 1241
48 Ga0307514_10001909 3300031649 Bacteria 22901
49 Ga0307514_10189069 3300031649 Bacteria 1314
50 Ga0307516_10022009 3300031730 Bacteria 6550
51 Ga0307410_10238208 3300031852 Bacteria 1409
52 Ga0307507_10000011 3300033179 Bacteria 261849
53 Ga0307507_10038578 3300033179 Bacteria 4838
54 Ga0307510_10016735 3300033180 Bacteria 8653
55 Ga0307510_10051722 3300033180 Bacteria 4342
56 Ga0395899_0020067 3300037312 Bacteria 5070
57 Ga0395900_0216596 3300037418 Bacteria 1932
58 Ga0395898_0014408 3300037466 Bacteria 8123
59 Ga0395898_0070515 3300037466 Bacteria 3378
60 Ga0395901_0098440 3300038443 Bacteria 3067
61 Ga0395901_0128561 3300038443 Bacteria 2663
62 Ga0439439_0002242 3300041406 Bacteria 4068
63 Ga0451802_0674031 3300041460 Bacteria 1571
64 Ga0451853_0478795 3300041512 Bacteria 3683
65 Ga0439433_0004691 3300041999 Bacteria 2937
66 Ga0439442_028091 3300042002 Bacteria 1172
67 Ga0439448_0011264 3300042005 Bacteria 2664
68 Ga0439448_0020318 3300042005 Bacteria 2053
69 Ga0439449_0000259 3300042007 Bacteria 19011
70 Ga0439457_001584 3300042014 Bacteria 6797
71 Ga0439462_0000278 3300042015 Bacteria 9401
72 Ga0450903_002338 3300042138 Bacteria 3383
73 Ga0450906_023648 3300042145 Bacteria 1094
74 Ga0439458_0000224 3300042157 Bacteria 13388
75 Ga0439458_0000645 3300042157 Bacteria 9004
76 Ga0466969_0003757 3300044656 Bacteria 8068
77 Ga0466969_0004587 3300044656 Bacteria 7360
78 Ga0466969_0034632 3300044656 Bacteria 2558
79 Ga0466972_0021565 3300044658 Bacteria 3210
80 Ga0466965_0002288 3300044683 Bacteria 8071
81 Ga0466965_0275832 3300044683 Bacteria 907
82 Ga0466966_0020829 3300044684 Bacteria 4310
83 Ga0466966_0024126 3300044684 Bacteria 3980
84 Ga0466966_0037534 3300044684 Bacteria 3124
85 Ga0466966_0101130 3300044684 Bacteria 1783
86 Ga0466961_0001367 3300044693 Bacteria 15056
87 Ga0466961_0008989 3300044693 Bacteria 6373
88 Ga0466961_0047742 3300044693 Bacteria 2737
89 Ga0466963_0026775 3300044694 Bacteria 3689
90 Ga0466964_0010151 3300044706 Bacteria 3550
91 Ga0466971_0001106 3300044719 Bacteria 11194
92 Ga0466971_0003014 3300044719 Bacteria 7156
93 Ga0466971_0010127 3300044719 Bacteria 4117
94 Ga0466971_0037662 3300044719 Bacteria 2168
95 Ga0466968_0092022 3300044735 Bacteria 1345
96 Ga0466970_0002188 3300044765 Bacteria 9445
97 Ga0466970_0010857 3300044765 Bacteria 4631
98 Ga0466957_0004300 3300044842 Bacteria 7905
99 Ga0466960_0156299 3300044901 Bacteria 1221
100 Ga0466959_0007131 3300045049 Bacteria 7821
101 Ga0466959_0011005 3300045049 Bacteria 6491
102 Ga0466959_0062928 3300045049 Bacteria 2695
103 Ga0466958_0004407 3300045836 Bacteria 7431
104 Ga0466958_0063820 3300045836 Bacteria 2246
105 Ga0466967_0025736 3300045976 Bacteria 4856
106 Ga0466967_0039304 3300045976 Bacteria 4066
107 Ga0466967_0345134 3300045976 Bacteria 1440
108 Ga0495592_0003559 3300046454 Bacteria 11193
109 Ga0495592_0018858 3300046454 Bacteria 5254
110 Ga0495592_0035128 3300046454 Bacteria 3777
111 Ga0495603_0001403 3300046455 Bacteria 14018
112 Ga0495603_0004273 3300046455 Bacteria 8510
113 Ga0495629_0001374 3300046459 Bacteria 19185
114 Ga0495629_0002942 3300046459 Bacteria 12981
115 Ga0495629_0007941 3300046459 Bacteria 7807
116 Ga0495629_0019151 3300046459 Bacteria 4893
117 Ga0495629_0021960 3300046459 Bacteria 4553
118 Ga0495638_0104128 3300046460 Bacteria 1693
119 Ga0495651_0008828 3300046462 Bacteria 7732
120 Ga0495651_0009640 3300046462 Bacteria 7423
121 Ga0495651_0009765 3300046462 Bacteria 7379
122 Ga0495651_0048938 3300046462 Bacteria 3264
123 Ga0495582_0121734 3300046473 Bacteria 1470
124 Ga0495662_0004042 3300046476 Bacteria 7387
125 Ga0495662_0030631 3300046476 Bacteria 2597
126 Ga0495662_0035164 3300046476 Bacteria 2418
127 Ga0495662_0068442 3300046476 Bacteria 1719
128 Ga0495664_0012366 3300046477 Bacteria 4833
129 Ga0495664_0030446 3300046477 Bacteria 3161
130 Ga0495585_0036056 3300046492 Bacteria 2793
131 Ga0495594_0002834 3300046499 Bacteria 9014
132 Ga0495594_0116006 3300046499 Bacteria 1512
133 Ga0495583_0111490 3300046506 Bacteria 1159
134 Ga0495608_0007079 3300046511 Bacteria 7938
135 Ga0495618_0054428 3300046514 Bacteria 2532
136 Ga0495628_0005917 3300046516 Bacteria 10706
137 Ga0495628_0015006 3300046516 Bacteria 6473
138 Ga0495628_0040560 3300046516 Bacteria 3720
139 Ga0495628_0125677 3300046516 Bacteria 1965
140 Ga0495630_0026192 3300046517 Bacteria 4316
141 Ga0495666_0099150 3300046526 Bacteria 1373
142 Ga0495652_0001944 3300046529 Bacteria 21961
143 Ga0495652_0035994 3300046529 Bacteria 4306
144 Ga0495652_0043833 3300046529 Bacteria 3854
145 Ga0495665_0007134 3300046531 Bacteria 6032
146 Ga0495640_0011689 3300046533 Bacteria 6739
147 Ga0495640_0045710 3300046533 Bacteria 3038
148 Ga0495640_0137455 3300046533 Bacteria 1577
149 Ga0495586_0192466 3300046535 Bacteria 1155
150 Ga0495587_0015630 3300046536 Bacteria 4734
151 Ga0495587_0090502 3300046536 Bacteria 1767
152 Ga0495645_0157498 3300046543 Bacteria 1572
153 Ga0495622_0004511 3300046557 Bacteria 6447
154 Ga0495667_0019102 3300046559 Bacteria 4625
155 Ga0495667_0044910 3300046559 Bacteria 2926
156 Ga0495634_0001444 3300046642 Bacteria 21145
157 Ga0495634_0014678 3300046642 Bacteria 5639
158 Ga0495634_0053762 3300046642 Bacteria 2696
159 Ga0495625_0011990 3300046660 Bacteria 7036
160 Ga0495635_0000778 3300046663 Bacteria 20772
161 Ga0495635_0002406 3300046663 Bacteria 12749
162 Ga0495588_0010810 3300046674 Bacteria 4262
163 Ga0495588_0039775 3300046674 Bacteria 2396
164 Ga0495657_0059117 3300046675 Bacteria 2543
165 Ga0495657_0073810 3300046675 Bacteria 2220
166 Ga0495599_0170217 3300046678 Bacteria 1344
167 Ga0495599_0176688 3300046678 Bacteria 1316
168 Ga0495623_0008937 3300046679 Bacteria 6504
169 Ga0495623_0060983 3300046679 Bacteria 2366
170 Ga0495623_0084026 3300046679 Bacteria 1965
171 Ga0495623_0151037 3300046679 Bacteria 1373
172 Ga0495646_0005393 3300046680 Bacteria 8074
173 Ga0495646_0011246 3300046680 Bacteria 5683
174 Ga0495613_0001429 3300046689 Bacteria 18220
175 Ga0495613_0027434 3300046689 Bacteria 4237
176 Ga0495613_0050954 3300046689 Bacteria 3052
177 Ga0495624_0129275 3300046690 Bacteria 1549
178 Ga0495624_0168740 3300046690 Bacteria 1335
179 Ga0495671_0015542 3300046692 Bacteria 4076
180 Ga0495589_0057826 3300046794 Bacteria 1907
181 Ga0495600_0004971 3300046809 Bacteria 7984
182 Ga0495600_0058081 3300046809 Bacteria 2527
183 Ga0495581_0024171 3300047315 Bacteria 3521
184 Ga0495581_0083684 3300047315 Bacteria 1848
185 Ga0495604_0000574 3300047317 Bacteria 32248
186 Ga0495604_0002140 3300047317 Bacteria 15891
187 Ga0495604_0007993 3300047317 Bacteria 8378
188 Ga0495604_0158801 3300047317 Bacteria 1599
189 Ga0495604_0170236 3300047317 Bacteria 1532
190 Ga0495636_0006008 3300047318 Bacteria 4764
191 Ga0495636_0033643 3300047318 Bacteria 2107
192 Ga0495636_0051473 3300047318 Bacteria 1726
193 Ga0495674_0012801 3300047319 Bacteria 7899
194 Ga0495674_0369191 3300047319 Bacteria 1162
195 Ga0495676_0025655 3300047321 Bacteria 5085
196 Ga0495676_0028993 3300047321 Bacteria 4718
197 Ga0495676_0031407 3300047321 Bacteria 4492
198 Ga0495676_0032339 3300047321 Bacteria 4417
199 Ga0495676_0053948 3300047321 Bacteria 3199
200 Ga0495683_0131856 3300047323 Bacteria 1178
201 Ga0495687_005990 3300047443 Bacteria 7578
202 Ga0495675_0011227 3300047444 Bacteria 5619
203 Ga0495675_0037222 3300047444 Bacteria 3098
204 Ga0495675_0097605 3300047444 Bacteria 1841
205 Ga0495681_0000943 3300047470 Bacteria 22360
206 Ga0495686_0162506 3300047472 Bacteria 1304
207 Ga0495593_0024837 3300047673 Bacteria 3317
208 Ga0495602_0039241 3300048088 Bacteria 4364
209 Ga0495602_0078994 3300048088 Bacteria 2777
210 Ga0495602_0128654 3300048088 Bacteria 2023
211 Ga0495614_0002005 3300048089 Bacteria 8957
212 Ga0495614_0011855 3300048089 Bacteria 3831
213 Ga0495614_0034990 3300048089 Bacteria 2158
214 Ga0496126_0150267 3300048929 Bacteria 1997
215 Ga0501031_0013765 3300049568 Bacteria 5273
216 Ga0501031_0026766 3300049568 Bacteria 3760
217 Ga0501031_0053056 3300049568 Bacteria 2641
218 Ga0501031_0063489 3300049568 Bacteria 2406
219 Ga0501031_0153051 3300049568 Bacteria 1507
220 Ga0501031_0171564 3300049568 Bacteria 1417
221 Ga0501032_0002157 3300049569 Bacteria 15505
222 Ga0501032_0028281 3300049569 Bacteria 3852
223 Ga0501032_0064750 3300049569 Bacteria 2446
224 Ga0501033_0001008 3300049570 Bacteria 25590
225 Ga0501033_0019145 3300049570 Bacteria 5176
226 Ga0501033_0029993 3300049570 Bacteria 4087
227 Ga0501033_0035959 3300049570 Bacteria 3713
228 Ga0501033_0112942 3300049570 Bacteria 1976
229 Ga0501033_0123761 3300049570 Bacteria 1875
230 Ga0501033_0179226 3300049570 Bacteria 1519
231 Ga0501034_0002464 3300049571 Bacteria 22311
232 Ga0501034_0009005 3300049571 Bacteria 10484
233 Ga0501034_0037215 3300049571 Bacteria 4927
234 Ga0501034_0043102 3300049571 Bacteria 4567
235 Ga0501034_0164818 3300049571 Bacteria 2185
236 Ga0501034_0198976 3300049571 Bacteria 1962
237 Ga0501034_0211534 3300049571 Bacteria 1894
238 Ga0501036_0017828 3300049572 Bacteria 5942
239 Ga0501036_0030117 3300049572 Bacteria 4585
240 Ga0501036_0052038 3300049572 Bacteria 3468
241 Ga0501037_0004888 3300049573 Bacteria 9746
242 Ga0501037_0023684 3300049573 Bacteria 4539
243 Ga0501037_0184605 3300049573 Bacteria 1479
244 Ga0501037_0186811 3300049573 Bacteria 1468
245 Ga0501037_0245317 3300049573 Bacteria 1254
246 Ga0501038_0012698 3300049574 Bacteria 7698
247 Ga0501038_0022596 3300049574 Bacteria 5633
248 Ga0501038_0033572 3300049574 Bacteria 4519
249 Ga0501038_0036163 3300049574 Bacteria 4334
250 Ga0501038_0063743 3300049574 Bacteria 3145
251 Ga0501038_0064561 3300049574 Bacteria 3121
252 Ga0501038_0193769 3300049574 Bacteria 1634
253 Ga0501039_0001589 3300049575 Bacteria 16715
254 Ga0501039_0052276 3300049575 Bacteria 3161
255 Ga0501040_0006671 3300049576 Bacteria 7492
256 Ga0501041_0009101 3300049577 Bacteria 5843
257 Ga0501042_0037421 3300049578 Bacteria 3443
258 Ga0501042_0069184 3300049578 Bacteria 2525
259 Ga0501043_0000952 3300049579 Bacteria 25679
260 Ga0501043_0022239 3300049579 Bacteria 4974
261 Ga0501043_0029759 3300049579 Bacteria 4291
262 Ga0501043_0115316 3300049579 Bacteria 2108
263 Ga0501043_0338779 3300049579 Bacteria 1144
264 Ga0501046_0008376 3300049580 Bacteria 9013
265 Ga0501046_0048426 3300049580 Bacteria 3365
266 Ga0501046_0161099 3300049580 Bacteria 1687
267 Ga0501046_0215210 3300049580 Bacteria 1425
268 Ga0501046_0227756 3300049580 Bacteria 1378
269 Ga0501047_0000547 3300049581 Bacteria 40575
270 Ga0501047_0022783 3300049581 Bacteria 6013
271 Ga0501047_0029622 3300049581 Bacteria 5278
272 Ga0501047_0036940 3300049581 Bacteria 4721
273 Ga0501047_0058535 3300049581 Bacteria 3722
274 Ga0501047_0140842 3300049581 Bacteria 2290
275 Ga0501047_0170708 3300049581 Bacteria 2044
276 Ga0501047_0182571 3300049581 Bacteria 1964
277 Ga0501048_0010519 3300049582 Bacteria 6905
278 Ga0501048_0036839 3300049582 Bacteria 3514
279 Ga0501048_0049567 3300049582 Bacteria 2992
280 Ga0501048_0272566 3300049582 Bacteria 1203
281 Ga0501067_0001659 3300049583 Bacteria 12224
282 Ga0501068_0001603 3300049584 Bacteria 12047
283 Ga0501070_0005097 3300049586 Bacteria 11198
284 Ga0501070_0054657 3300049586 Bacteria 3311
285 Ga0501070_0060556 3300049586 Bacteria 3137
286 Ga0501070_0196841 3300049586 Bacteria 1655
287 Ga0501071_0009745 3300049587 Bacteria 6409
288 Ga0501072_0028700 3300049588 Bacteria 4343
289 Ga0501073_0216689 3300049589 Bacteria 1323
290 Ga0501074_0048581 3300049590 Bacteria 3065
291 Ga0501076_0118156 3300049592 Bacteria 2146
292 Ga0501077_0026114 3300049593 Bacteria 3706
293 Ga0501079_0012317 3300049741 Bacteria 6524
294 Ga0501083_0014025 3300049744 Bacteria 5601
295 Ga0501035_0003878 3300049822 Bacteria 14268
296 Ga0501035_0022599 3300049822 Bacteria 5777
297 Ga0501035_0026680 3300049822 Bacteria 5284
298 Ga0501035_0032973 3300049822 Bacteria 4710
299 Ga0501035_0051333 3300049822 Bacteria 3693
300 Ga0501035_0092773 3300049822 Bacteria 2656
301 Ga0501035_0232374 3300049822 Bacteria 1571
302 Ga0501044_0000886 3300049823 Bacteria 36088
303 Ga0501044_0017091 3300049823 Bacteria 7784
304 Ga0501044_0025554 3300049823 Bacteria 6260
305 Ga0501044_0033587 3300049823 Bacteria 5389
306 Ga0501044_0053594 3300049823 Bacteria 4149
307 Ga0501044_0054337 3300049823 Bacteria 4117
308 Ga0501044_0106880 3300049823 Bacteria 2810
309 Ga0501044_0110610 3300049823 Bacteria 2756
310 Ga0501044_0117124 3300049823 Bacteria 2668
311 Ga0501045_0079613 3300049824 Bacteria 2415
312 nmdc:mga03n38_51657_c1 3300050490 Bacteria 1836
313 nmdc:mga06z11_2632_c1 3300050494 Bacteria 6878
314 Ga0495601_0073398 3300053077 Bacteria 2187
315 Ga0495612_0006456 3300053078 Bacteria 4816
316 Ga0495612_0050036 3300053078 Bacteria 1716
317 Ga0495655_0015051 3300053083 Bacteria 1636
318 Ga0495655_0019349 3300053083 Bacteria 1511
319 Ga0495619_0090446 3300053085 Bacteria 2072
320 Ga0500640_016054 3300053095 Bacteria 3151
321 Ga0500560_001019 3300053107 Bacteria 4518
322 Ga0500573_0035126 3300053140 Bacteria 2892
323 Ga0501084_0041706 3300054114 Bacteria 3839
324 Ga0587071_030280 3300060344 Bacteria 1039
325 Ga0501082_0039192 3300060353 Bacteria 4088
326 Ga0466962_0000886 3300061719 Bacteria 13603
327 Ga0466962_0002436 3300061719 Bacteria 8824
328 Ga0530510_0080035 3300061734 Bacteria 2377
329 2515850714 2515154155 Bacteria 7985436
330 2585299383 2582581312 Bacteria 7308206
331 2585306912 2582581313 Bacteria 10042643
332 2616902090 2616644941 Bacteria 8510691
333 2643764888 2643221548 Bacteria 8053412
334 2643902745 2643221578 Bacteria 9213798
335 2643944307 2643221587 Bacteria 7586415
336 2644018747 2643221601 Bacteria 7493239
337 2644179882 2643221631 Bacteria 8168043
338 2644265451 2643221647 Bacteria 10741251
339 2644404746 2643221673 Bacteria 9196637
340 2644435866 2643221678 Bacteria 9540101
341 2644461272 2643221682 Bacteria 6743283
342 2644632245 2643221714 Bacteria 9015452
343 2768644413 2767802112 Bacteria 6465194
344 2785368023 2784746768 Bacteria 10036182
345 2786669077 2786546132 Bacteria 10419719
346 2793976054 2791355406 Bacteria 11364898
347 2804843459 2802429296 Bacteria 7227771
348 2808840678 2808606359 Bacteria 9866990
349 2808919269 2808606375 Bacteria 9466072
350 2809231042 2808606448 Bacteria 8656184
351 2811842437 2808606982 Bacteria 7791042
352 2811845595 2808606982 Bacteria 7791042
353 2812359501 2811994879 Bacteria 9313447
354 2812481629 2811994917 Bacteria 7761064
355 2819695339 2818991463 Bacteria 7948711
356 2819742913 2818991472 Bacteria 10089953
357 2852642919 2852635781 Bacteria 8251373
358 2862288587 2862281513 Bacteria 9621493
359 2862292730 2862290372 Bacteria 7471434
360 2863412063 2863404153 Bacteria 9672205
361 2867372707 2867369537 Bacteria 6501581
362 2867436760 2867428634 Bacteria 9590268
363 2867480918 2867475112 Bacteria 6909112
364 2875395885 2875391855 Bacteria 7600475
365 2877682520 2877676314 Bacteria 9512378
366 2912721541 2912715099 Bacteria 9460473
367 2912725400 2912723979 Bacteria 8557534
368 2912764480 2912757875 Bacteria 7940295
369 2919468228 2919468124 Bacteria 9133025
370 2946048751 2946045630 Bacteria 8527308
371 2946066417 2946064051 Bacteria 8957905
372 2946074672 2946072368 Bacteria 8999607
373 2947230960 2947224130 Bacteria 9938529
374 2954004259 2954002825 Bacteria 9173742
375 2954387718 2954380949 Bacteria 10050426
376 2954675375 2954673503 Bacteria 9685905
377 2954688757 2954682443 Bacteria 9862841
378 2954698530 2954691527 Bacteria 10720516
379 2954703694 2954701450 Bacteria 10834262
380 2954717502 2954711539 Bacteria 10867210
381 2954720239 2954711539 Bacteria 10867210
382 2954727465 2954721474 Bacteria 10456478
383 2954734335 2954731030 Bacteria 10243860
384 2954746362 2954740390 Bacteria 10229294
385 2954753218 2954749733 Bacteria 10366972
386 2954765475 2954759201 Bacteria 9358192
387 2966601574 2966598605 Bacteria 7676064
388 2990092993 2990088156 Bacteria 6657676
389 2997459077 2997451912 Bacteria 8492419
390 2997604714 2997600082 Bacteria 9896405
391 3006327680 3006321560 Bacteria 8247479
392 3006399399 3006393351 Bacteria 6615579
393 3006487405 3006486233 Bacteria 8157040
394 3006495630 3006493962 Bacteria 8825450
395 8008579987 8008574985 Bacteria 7815457
396 8023628572 8023623736 Bacteria 8593882
397 8025418613 8025413630 Bacteria 7014048
398 8025482594 8025478263 Bacteria 8209203
399 8033691200 8033684223 Bacteria 6906479
400 8047897620 8047893842 Bacteria 11723082
401 8048129657 8048127548 Bacteria 11053136
402 8048361250 8048356638 Bacteria 11044339
403 8048374607 8048369669 Bacteria 11666822
404 8048383615 8048379754 Bacteria 11877923
405 8048411068 8048406513 Bacteria 8936924
406 8054167390 8054160619 Bacteria 7783213
407 8056449904 8056447290 Bacteria 7680491
408 8056836523 8056829672 Bacteria 9045328
409 Ga0075363_100023493
410 JGI25153J46596_10023562
411 rootH1_10007390
412 rootH2_10051476
413 rootH1_10020609
414 rootH1_10037813
415 Ga0058863_11822532
416 Ga0070714_100000007
417 Ga0070714_100003760
418 Ga0068853_100063779
419 Ga0075365_10026911
420 Ga0075367_10003049
421 Ga0075370_10085413
422 Ga0105243_10131651
423 Ga0157369_10549217
424 Ga0157372_10173716
425 Ga0182008_10000719
426 Ga0182007_10002002
427 Ga0183367_1009
428 Ga0197907_10513251
429 Ga0197907_10763782
430 Ga0206356_11431549
431 Ga0206352_11034122
432 Ga0224712_10066093
433 Ga0209758_1003928
434 Ga0207426_1000755
435 Ga0207426_1001873
436 Ga0207647_10028647
437 Ga0207705_10119887
438 Ga0207664_10000014
439 Ga0207664_10027935
440 Ga0207664_10170134
441 Ga0207639_10145233
442 Ga0209371_1021873
443 Ga0209371_1030385
444 Ga0307515_10229548
445 Ga0268256_1016516
446 Ga0268256_1024807
447 Ga0307511_10000609
448 Ga0307511_10016293
449 Ga0307512_10001818
450 Ga0307513_10059083
451 Ga0307509_10017106
452 Ga0307508_10002360
453 Ga0307508_10037228
454 Ga0307508_10286399
455 Ga0307514_10001909
456 Ga0307514_10189069
457 Ga0307516_10022009
458 Ga0307410_10238208
459 Ga0307507_10000011
460 Ga0307507_10038578
461 Ga0307510_10016735
462 Ga0307510_10051722
463 Ga0395899_0020067
464 Ga0395900_0216596
465 Ga0395898_0014408
466 Ga0395898_0070515
467 Ga0395901_0098440
468 Ga0395901_0128561
469 Ga0439439_0002242
470 Ga0451802_0674031
471 Ga0451853_0478795
472 Ga0439433_0004691
473 Ga0439442_028091
474 Ga0439448_0011264
475 Ga0439448_0020318
476 Ga0439449_0000259
477 Ga0439457_001584
478 Ga0439462_0000278
479 Ga0450903_002338
480 Ga0450906_023648
481 Ga0439458_0000224
482 Ga0439458_0000645
483 Ga0466969_0003757
484 Ga0466969_0004587
485 Ga0466969_0034632
486 Ga0466972_0021565
487 Ga0466965_0002288
488 Ga0466965_0275832
489 Ga0466966_0020829
490 Ga0466966_0024126
491 Ga0466966_0037534
492 Ga0466966_0101130
493 Ga0466961_0001367
494 Ga0466961_0008989
495 Ga0466961_0047742
496 Ga0466963_0026775
497 Ga0466964_0010151
498 Ga0466971_0001106
499 Ga0466971_0003014
500 Ga0466971_0010127
501 Ga0466971_0037662
502 Ga0466968_0092022
503 Ga0466970_0002188
504 Ga0466970_0010857
505 Ga0466957_0004300
506 Ga0466960_0156299
507 Ga0466959_0007131
508 Ga0466959_0011005
509 Ga0466959_0062928
510 Ga0466958_0004407
511 Ga0466958_0063820
512 Ga0466967_0025736
513 Ga0466967_0039304
514 Ga0466967_0345134
515 Ga0495592_0003559
516 Ga0495592_0018858
517 Ga0495592_0035128
518 Ga0495603_0001403
519 Ga0495603_0004273
520 Ga0495629_0001374
521 Ga0495629_0002942
522 Ga0495629_0007941
523 Ga0495629_0019151
524 Ga0495629_0021960
525 Ga0495638_0104128
526 Ga0495651_0008828
527 Ga0495651_0009640
528 Ga0495651_0009765
529 Ga0495651_0048938
530 Ga0495582_0121734
531 Ga0495662_0004042
532 Ga0495662_0030631
533 Ga0495662_0035164
534 Ga0495662_0068442
535 Ga0495664_0012366
536 Ga0495664_0030446
537 Ga0495585_0036056
538 Ga0495594_0002834
539 Ga0495594_0116006
540 Ga0495583_0111490
541 Ga0495608_0007079
542 Ga0495618_0054428
543 Ga0495628_0005917
544 Ga0495628_0015006
545 Ga0495628_0040560
546 Ga0495628_0125677
547 Ga0495630_0026192
548 Ga0495666_0099150
549 Ga0495652_0001944
550 Ga0495652_0035994
551 Ga0495652_0043833
552 Ga0495665_0007134
553 Ga0495640_0011689
554 Ga0495640_0045710
555 Ga0495640_0137455
556 Ga0495586_0192466
557 Ga0495587_0015630
558 Ga0495587_0090502
559 Ga0495645_0157498
560 Ga0495622_0004511
561 Ga0495667_0019102
562 Ga0495667_0044910
563 Ga0495634_0001444
564 Ga0495634_0014678
565 Ga0495634_0053762
566 Ga0495625_0011990
567 Ga0495635_0000778
568 Ga0495635_0002406
569 Ga0495588_0010810
570 Ga0495588_0039775
571 Ga0495657_0059117
572 Ga0495657_0073810
573 Ga0495599_0170217
574 Ga0495599_0176688
575 Ga0495623_0008937
576 Ga0495623_0060983
577 Ga0495623_0084026
578 Ga0495623_0151037
579 Ga0495646_0005393
580 Ga0495646_0011246
581 Ga0495613_0001429
582 Ga0495613_0027434
583 Ga0495613_0050954
584 Ga0495624_0129275
585 Ga0495624_0168740
586 Ga0495671_0015542
587 Ga0495589_0057826
588 Ga0495600_0004971
589 Ga0495600_0058081
590 Ga0495581_0024171
591 Ga0495581_0083684
592 Ga0495604_0000574
593 Ga0495604_0002140
594 Ga0495604_0007993
595 Ga0495604_0158801
596 Ga0495604_0170236
597 Ga0495636_0006008
598 Ga0495636_0033643
599 Ga0495636_0051473
600 Ga0495674_0012801
601 Ga0495674_0369191
602 Ga0495676_0025655
603 Ga0495676_0028993
604 Ga0495676_0031407
605 Ga0495676_0032339
606 Ga0495676_0053948
607 Ga0495683_0131856
608 Ga0495687_005990
609 Ga0495675_0011227
610 Ga0495675_0037222
611 Ga0495675_0097605
612 Ga0495681_0000943
613 Ga0495686_0162506
614 Ga0495593_0024837
615 Ga0495602_0039241
616 Ga0495602_0078994
617 Ga0495602_0128654
618 Ga0495614_0002005
619 Ga0495614_0011855
620 Ga0495614_0034990
621 Ga0496126_0150267
622 Ga0501031_0013765
623 Ga0501031_0026766
624 Ga0501031_0053056
625 Ga0501031_0063489
626 Ga0501031_0153051
627 Ga0501031_0171564
628 Ga0501032_0002157
629 Ga0501032_0028281
630 Ga0501032_0064750
631 Ga0501033_0001008
632 Ga0501033_0019145
633 Ga0501033_0029993
634 Ga0501033_0035959
635 Ga0501033_0112942
636 Ga0501033_0123761
637 Ga0501033_0179226
638 Ga0501034_0002464
639 Ga0501034_0009005
640 Ga0501034_0037215
641 Ga0501034_0043102
642 Ga0501034_0164818
643 Ga0501034_0198976
644 Ga0501034_0211534
645 Ga0501036_0017828
646 Ga0501036_0030117
647 Ga0501036_0052038
648 Ga0501037_0004888
649 Ga0501037_0023684
650 Ga0501037_0184605
651 Ga0501037_0186811
652 Ga0501037_0245317
653 Ga0501038_0012698
654 Ga0501038_0022596
655 Ga0501038_0033572
656 Ga0501038_0036163
657 Ga0501038_0063743
658 Ga0501038_0064561
659 Ga0501038_0193769
660 Ga0501039_0001589
661 Ga0501039_0052276
662 Ga0501040_0006671
663 Ga0501041_0009101
664 Ga0501042_0037421
665 Ga0501042_0069184
666 Ga0501043_0000952
667 Ga0501043_0022239
668 Ga0501043_0029759
669 Ga0501043_0115316
670 Ga0501043_0338779
671 Ga0501046_0008376
672 Ga0501046_0048426
673 Ga0501046_0161099
674 Ga0501046_0215210
675 Ga0501046_0227756
676 Ga0501047_0000547
677 Ga0501047_0022783
678 Ga0501047_0029622
679 Ga0501047_0036940
680 Ga0501047_0058535
681 Ga0501047_0140842
682 Ga0501047_0170708
683 Ga0501047_0182571
684 Ga0501048_0010519
685 Ga0501048_0036839
686 Ga0501048_0049567
687 Ga0501048_0272566
688 Ga0501067_0001659
689 Ga0501068_0001603
690 Ga0501070_0005097
691 Ga0501070_0054657
692 Ga0501070_0060556
693 Ga0501070_0196841
694 Ga0501071_0009745
695 Ga0501072_0028700
696 Ga0501073_0216689
697 Ga0501074_0048581
698 Ga0501076_0118156
699 Ga0501077_0026114
700 Ga0501079_0012317
701 Ga0501083_0014025
702 Ga0501035_0003878
703 Ga0501035_0022599
704 Ga0501035_0026680
705 Ga0501035_0032973
706 Ga0501035_0051333
707 Ga0501035_0092773
708 Ga0501035_0232374
709 Ga0501044_0000886
710 Ga0501044_0017091
711 Ga0501044_0025554
712 Ga0501044_0033587
713 Ga0501044_0053594
714 Ga0501044_0054337
715 Ga0501044_0106880
716 Ga0501044_0110610
717 Ga0501044_0117124
718 Ga0501045_0079613
719 nmdc:mga03n38_51657_c1
720 nmdc:mga06z11_2632_c1
721 Ga0495601_0073398
722 Ga0495612_0006456
723 Ga0495612_0050036
724 Ga0495655_0015051
725 Ga0495655_0019349
726 Ga0495619_0090446
727 Ga0500640_016054
728 Ga0500560_001019
729 Ga0500573_0035126
730 Ga0501084_0041706
731 Ga0587071_030280
732 Ga0501082_0039192
733 Ga0466962_0000886
734 Ga0466962_0002436
735 Ga0530510_0080035
736 2515850714
737 2585299383
738 2585306912
739 2616902090
740 2643764888
741 2643902745
742 2643944307
743 2644018747
744 2644179882
745 2644265451
746 2644404746
747 2644435866
748 2644461272
749 2644632245
750 2768644413
751 2785368023
752 2786669077
753 2793976054
754 2804843459
755 2808840678
756 2808919269
757 2809231042
758 2811842437
759 2811845595
760 2812359501
761 2812481629
762 2819695339
763 2819742913
764 2852642919
765 2862288587
766 2862292730
767 2863412063
768 2867372707
769 2867436760
770 2867480918
771 2875395885
772 2877682520
773 2912721541
774 2912725400
775 2912764480
776 2919468228
777 2946048751
778 2946066417
779 2946074672
780 2947230960
781 2954004259
782 2954387718
783 2954675375
784 2954688757
785 2954698530
786 2954703694
787 2954717502
788 2954720239
789 2954727465
790 2954734335
791 2954746362
792 2954753218
793 2954765475
794 2966601574
795 2990092993
796 2997459077
797 2997604714
798 3006327680
799 3006399399
800 3006487405
801 3006495630
802 8008579987
803 8023628572
804 8025418613
805 8025482594
806 8033691200
807 8047897620
808 8048129657
809 8048361250
810 8048374607
811 8048383615
812 8048411068
813 8054167390
814 8056449904
815 8056836523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

93

312

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8858 55 132
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8711 48 132
7qho-assembly1.cif.gz_A cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (as isolated) 0.7874 134 196
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7353 48 132
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.6752 55 132
ID Description Score Start End Superfamily
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9905 53 131 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9247 62 132 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9178 55 141 3.30.2010.10
af_A0A1D6LI78_20_121_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.917 64 132 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8803 57 141 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6B3I2P7-F1-model_v4 M48 family metalloprotease 0.9921 47 131 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9836 54 133 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A832Y733-F1-model_v4 deleted 0.9383 26 113
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9375 54 133 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A499VPY5-F1-model_v4 Protease HtpX 0.904 54 292 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Map