F436414

General Info

Members Datasets Scaffolds Average Seq Length
407 226 814 127

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100585345|Ga0070698_1005853452
Length 148
Sequence VPSKKKSPKKVARKSTKTAARSKLGVVKTASAPSAIGPYSQAISAGGFLFTAGQIAIDPATGQVVTGDVRVQTDRVMQNLAAVLAAAGVTWKDVVKTTVFLHDMSDFPTVNEIYGAALGEARPARSTVQVAGLPRGVLVEIDAVAKLS

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.74
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 1.97
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 12.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100585345 3300005471 Bacteria 1056
2 JGI24752J21851_1045057 3300001976 Bacteria 595
3 rootH1_10044204 3300003316 Bacteria 2048
4 rootH1_10105693 3300003323 Bacteria 2195
5 Ga0058863_11630560 3300004799 Bacteria 661
6 Ga0058863_11666818 3300004799 Bacteria 785
7 Ga0070658_10293574 3300005327 Bacteria 1385
8 Ga0070676_10330595 3300005328 Bacteria 1042
9 Ga0070683_100010597 3300005329 Bacteria 7925
10 Ga0070683_100030805 3300005329 Bacteria 4874
11 Ga0070690_100050221 3300005330 Bacteria 2661
12 Ga0070690_100161062 3300005330 Bacteria 1537
13 Ga0070690_101403537 3300005330 Bacteria 562
14 Ga0070670_100196458 3300005331 Bacteria 1752
15 Ga0070677_10373746 3300005333 Bacteria 744
16 Ga0068869_100011432 3300005334 Bacteria 5822
17 Ga0070666_10400943 3300005335 Bacteria 986
18 Ga0070666_10528347 3300005335 Bacteria 857
19 Ga0070666_10719600 3300005335 Bacteria 732
20 Ga0070680_100000087 3300005336 Bacteria 51648
21 Ga0070680_100000891 3300005336 Bacteria 21071
22 Ga0070680_100046103 3300005336 Bacteria 3545
23 Ga0070680_100095665 3300005336 Bacteria 2462
24 Ga0068868_100033663 3300005338 Bacteria 3951
25 Ga0068868_100250404 3300005338 Bacteria 1491
26 Ga0068868_100483350 3300005338 Bacteria 1082
27 Ga0068868_100484459 3300005338 Unclassified 1081
28 Ga0068868_102013093 3300005338 Bacteria 548
29 Ga0070660_100177108 3300005339 Bacteria 1725
30 Ga0070660_101309912 3300005339 Bacteria 615
31 Ga0070689_100088504 3300005340 Bacteria 2437
32 Ga0070689_100988056 3300005340 Unclassified 748
33 Ga0070689_101316368 3300005340 Bacteria 651
34 Ga0070691_10027751 3300005341 Bacteria 2642
35 Ga0070691_10159090 3300005341 Bacteria 1163
36 Ga0070687_100022906 3300005343 Bacteria 2960
37 Ga0070687_100377477 3300005343 Bacteria 923
38 Ga0070692_10319057 3300005345 Bacteria 955
39 Ga0070692_10543415 3300005345 Bacteria 760
40 Ga0070668_100196653 3300005347 Bacteria 1654
41 Ga0070668_100296022 3300005347 Bacteria 1356
42 Ga0070669_101239241 3300005353 Unclassified 645
43 Ga0070675_100031536 3300005354 Bacteria 4285
44 Ga0070675_100314520 3300005354 Bacteria 1382
45 Ga0070674_100109882 3300005356 Bacteria 2022
46 Ga0070673_100028732 3300005364 Bacteria 4139
47 Ga0070673_100277206 3300005364 Bacteria 1470
48 Ga0070673_100649007 3300005364 Bacteria 966
49 Ga0070688_100024300 3300005365 Bacteria 3574
50 Ga0070659_100002368 3300005366 Bacteria 13395
51 Ga0070667_100836027 3300005367 Unclassified 856
52 Ga0070667_101024255 3300005367 Bacteria 771
53 Ga0070714_100002098 3300005435 Bacteria 14612
54 Ga0070714_100136843 3300005435 Bacteria 2195
55 Ga0070701_10289579 3300005438 Bacteria 1003
56 Ga0070694_100551314 3300005444 Bacteria 923
57 Ga0070662_100001675 3300005457 Bacteria 13632
58 Ga0070681_10003281 3300005458 Bacteria 15105
59 Ga0070681_10025666 3300005458 Bacteria 5927
60 Ga0070681_10126893 3300005458 Unclassified 2484
61 Ga0070681_10211158 3300005458 Bacteria 1857
62 Ga0068867_101065593 3300005459 Bacteria 736
63 Ga0070707_100216736 3300005468 Unclassified 1865
64 Ga0070699_100850270 3300005518 Bacteria 835
65 Ga0070679_100004790 3300005530 Bacteria 12482
66 Ga0070679_100011105 3300005530 Bacteria 8572
67 Ga0070679_100030359 3300005530 Bacteria 5337
68 Ga0070679_100067038 3300005530 Bacteria 3579
69 Ga0070679_100078002 3300005530 Bacteria 3302
70 Ga0070679_100366255 3300005530 Bacteria 1388
71 Ga0070684_100020282 3300005535 Bacteria 5513
72 Ga0070684_100147290 3300005535 Bacteria 2132
73 Ga0070684_100515959 3300005535 Bacteria 1107
74 Ga0070697_100226957 3300005536 Bacteria 1592
75 Ga0068853_100054609 3300005539 Bacteria 3443
76 Ga0068853_100170534 3300005539 Bacteria 1968
77 Ga0070672_100404817 3300005543 Bacteria 1170
78 Ga0070686_100356779 3300005544 Bacteria 1100
79 Ga0070696_100001496 3300005546 Bacteria 15332
80 Ga0070696_100344674 3300005546 Bacteria 1152
81 Ga0070696_101555116 3300005546 Unclassified 567
82 Ga0070693_100177451 3300005547 Bacteria 1369
83 Ga0070693_100270221 3300005547 Bacteria 1135
84 Ga0070693_101369976 3300005547 Bacteria 549
85 Ga0070665_100394338 3300005548 Bacteria 1392
86 Ga0068855_100153541 3300005563 Bacteria 2617
87 Ga0068855_100182016 3300005563 Bacteria 2375
88 Ga0068855_100233767 3300005563 Bacteria 2056
89 Ga0068855_101257404 3300005563 Unclassified 768
90 Ga0070664_100150327 3300005564 Bacteria 2055
91 Ga0068857_100008258 3300005577 Bacteria 8995
92 Ga0068857_100180526 3300005577 Bacteria 1921
93 Ga0068854_100019671 3300005578 Bacteria 4554
94 Ga0068854_101364684 3300005578 Bacteria 640
95 Ga0068856_100023545 3300005614 Bacteria 5988
96 Ga0068856_102540778 3300005614 Bacteria 519
97 Ga0068852_100206904 3300005616 Bacteria 1859
98 Ga0068859_100036079 3300005617 Bacteria 4962
99 Ga0068859_100094514 3300005617 Bacteria 3041
100 Ga0068859_100252673 3300005617 Bacteria 1853
101 Ga0068859_100881582 3300005617 Bacteria 980
102 Ga0068859_101562349 3300005617 Bacteria 728
103 Ga0068859_101933245 3300005617 Bacteria 651
104 Ga0068864_100143828 3300005618 Bacteria 2153
105 Ga0068864_101998092 3300005618 Bacteria 586
106 Ga0068866_10912532 3300005718 Bacteria 619
107 Ga0068851_10747842 3300005834 Bacteria 605
108 Ga0068870_10110874 3300005840 Bacteria 1566
109 Ga0068863_100058191 3300005841 Bacteria 3658
110 Ga0068858_100400793 3300005842 Bacteria 1318
111 Ga0068858_100873625 3300005842 Bacteria 879
112 Ga0068860_100114208 3300005843 Bacteria 2582
113 Ga0068860_100877861 3300005843 Unclassified 912
114 Ga0081540_1001795 3300005983 Bacteria 17998
115 Ga0070715_10667025 3300006163 Unclassified 617
116 Ga0075366_10185521 3300006195 Bacteria 1264
117 Ga0097621_100065355 3300006237 Bacteria 2993
118 Ga0075428_100094062 3300006844 Bacteria 3268
119 Ga0075428_100213360 3300006844 Bacteria 2086
120 Ga0075428_100297704 3300006844 Bacteria 1735
121 Ga0075430_100000314 3300006846 Bacteria 34482
122 Ga0075430_100149962 3300006846 Unclassified 1942
123 Ga0075430_100405541 3300006846 Bacteria 1125
124 Ga0075430_100634211 3300006846 Unclassified 881
125 Ga0075431_100207546 3300006847 Bacteria 2002
126 Ga0075431_100269756 3300006847 Bacteria 1725
127 Ga0075431_101334973 3300006847 Unclassified 678
128 Ga0075434_100022531 3300006871 Bacteria 6133
129 Ga0075434_100492277 3300006871 Unclassified 1247
130 Ga0075434_100955860 3300006871 Unclassified 871
131 Ga0075429_100033496 3300006880 Unclassified 4465
132 Ga0068865_100089750 3300006881 Bacteria 2227
133 Ga0068865_100391698 3300006881 Bacteria 1136
134 Ga0075436_100010163 3300006914 Bacteria 6444
135 Ga0075436_100167432 3300006914 Bacteria 1551
136 Ga0075436_100306394 3300006914 Bacteria 1139
137 Ga0075436_100752401 3300006914 Bacteria 724
138 Ga0097620_100036079 3300006931 Bacteria 4962
139 Ga0097620_100094518 3300006931 Bacteria 3041
140 Ga0097620_100252670 3300006931 Bacteria 1853
141 Ga0097620_101562307 3300006931 Bacteria 728
142 Ga0097620_101933226 3300006931 Bacteria 651
143 Ga0075435_100460315 3300007076 Bacteria 1097
144 Ga0105240_11108501 3300009093 Unclassified 842
145 Ga0111539_11588625 3300009094 Bacteria 759
146 Ga0105245_10025558 3300009098 Bacteria 5194
147 Ga0105245_10349733 3300009098 Bacteria 1464
148 Ga0114129_10035942 3300009147 Bacteria 6996
149 Ga0114129_10293077 3300009147 Unclassified 2171
150 Ga0114129_10333981 3300009147 Bacteria 2012
151 Ga0114129_11036291 3300009147 Bacteria 1031
152 Ga0114129_11802840 3300009147 Bacteria 744
153 Ga0114129_12564545 3300009147 Bacteria 609
154 Ga0105243_10125438 3300009148 Bacteria 2171
155 Ga0105243_11260851 3300009148 Unclassified 755
156 Ga0105241_10220300 3300009174 Bacteria 1594
157 Ga0105241_10389827 3300009174 Bacteria 1219
158 Ga0105242_10121754 3300009176 Bacteria 2240
159 Ga0105248_10006003 3300009177 Bacteria 13328
160 Ga0105248_10035213 3300009177 Bacteria 5601
161 Ga0105248_10094197 3300009177 Bacteria 3372
162 Ga0105248_10513702 3300009177 Bacteria 1351
163 Ga0105248_11931912 3300009177 Bacteria 670
164 Ga0105237_10013613 3300009545 Bacteria 8523
165 Ga0105237_10427650 3300009545 Bacteria 1330
166 Ga0105237_10847081 3300009545 Bacteria 921
167 Ga0105238_10672577 3300009551 Bacteria 1046
168 Ga0105238_11599513 3300009551 Bacteria 682
169 Ga0105249_10197047 3300009553 Bacteria 1969
170 Ga0105249_10470521 3300009553 Bacteria 1298
171 Ga0105239_10489060 3300010375 Bacteria 1398
172 Ga0105246_10165189 3300011119 Bacteria 1690
173 Ga0157316_1067814 3300012510 Bacteria 532
174 Ga0157373_10095161 3300013100 Bacteria 2096
175 Ga0157371_10076819 3300013102 Bacteria 2365
176 Ga0157369_10005035 3300013105 Bacteria 15466
177 Ga0157369_10272381 3300013105 Bacteria 1764
178 Ga0157369_11174676 3300013105 Bacteria 784
179 Ga0157369_11174677 3300013105 Bacteria 784
180 Ga0157369_11187153 3300013105 Bacteria 779
181 Ga0157369_11418103 3300013105 Bacteria 707
182 Ga0157374_10009151 3300013296 Bacteria 8489
183 Ga0157374_10555333 3300013296 Bacteria 1156
184 Ga0157374_10729420 3300013296 Bacteria 1005
185 Ga0157374_11769059 3300013296 Bacteria 643
186 Ga0157374_11980246 3300013296 Bacteria 609
187 Ga0157378_10189027 3300013297 Bacteria 1941
188 Ga0157378_11009765 3300013297 Bacteria 866
189 Ga0163162_10176569 3300013306 Bacteria 2262
190 Ga0163162_10636173 3300013306 Bacteria 1191
191 Ga0157372_10009348 3300013307 Bacteria 10432
192 Ga0157372_10905230 3300013307 Bacteria 1023
193 Ga0157372_11590067 3300013307 Bacteria 753
194 Ga0157372_11631760 3300013307 Bacteria 742
195 Ga0157375_10348789 3300013308 Bacteria 1646
196 Ga0157375_12740779 3300013308 Bacteria 589
197 Ga0163163_10026153 3300014325 Bacteria 5574
198 Ga0163163_10448767 3300014325 Bacteria 1350
199 Ga0157377_10233533 3300014745 Bacteria 1184
200 Ga0157377_10392295 3300014745 Unclassified 943
201 Ga0157376_10006619 3300014969 Bacteria 8200
202 Ga0157376_11850140 3300014969 Bacteria 640
203 Ga0182005_1070647 3300015265 Bacteria 959
204 Ga0163161_10133108 3300017792 Bacteria 1877
205 Ga0206354_10558447 3300020081 Bacteria 1191
206 Ga0213876_10054430 3300021384 Bacteria 2113
207 Ga0207682_10319717 3300025893 Bacteria 729
208 Ga0207680_10146315 3300025903 Bacteria 1571
209 Ga0207680_10492219 3300025903 Bacteria 873
210 Ga0207647_10078488 3300025904 Bacteria 1983
211 Ga0207645_10260655 3300025907 Bacteria 1148
212 Ga0207643_10069089 3300025908 Bacteria 2030
213 Ga0207705_10040817 3300025909 Bacteria 3329
214 Ga0207684_10872586 3300025910 Bacteria 758
215 Ga0207654_10019091 3300025911 Bacteria 3610
216 Ga0207707_10000874 3300025912 Bacteria 29449
217 Ga0207707_10031323 3300025912 Bacteria 4653
218 Ga0207707_10063219 3300025912 Bacteria 3221
219 Ga0207695_10372282 3300025913 Bacteria 1315
220 Ga0207671_10001999 3300025914 Bacteria 22454
221 Ga0207671_10462736 3300025914 Bacteria 1011
222 Ga0207693_10399093 3300025915 Bacteria 1075
223 Ga0207660_10000130 3300025917 Bacteria 44299
224 Ga0207660_10098113 3300025917 Bacteria 2185
225 Ga0207660_10165645 3300025917 Bacteria 1708
226 Ga0207662_10119202 3300025918 Bacteria 1653
227 Ga0207657_10048919 3300025919 Bacteria 3688
228 Ga0207649_10002554 3300025920 Bacteria 10122
229 Ga0207649_10132155 3300025920 Bacteria 1697
230 Ga0207652_10004380 3300025921 Bacteria 11506
231 Ga0207652_10005635 3300025921 Bacteria 10161
232 Ga0207652_10018463 3300025921 Bacteria 5722
233 Ga0207652_10051714 3300025921 Bacteria 3523
234 Ga0207652_10106047 3300025921 Bacteria 2487
235 Ga0207646_11466194 3300025922 Unclassified 592
236 Ga0207681_10282611 3300025923 Bacteria 1307
237 Ga0207694_10196625 3300025924 Bacteria 1640
238 Ga0207650_10056013 3300025925 Bacteria 2928
239 Ga0207650_10123767 3300025925 Bacteria 2016
240 Ga0207650_10551436 3300025925 Bacteria 966
241 Ga0207659_10003960 3300025926 Bacteria 8935
242 Ga0207659_10113321 3300025926 Bacteria 2065
243 Ga0207687_10004301 3300025927 Bacteria 9508
244 Ga0207687_10068653 3300025927 Bacteria 2525
245 Ga0207700_10391287 3300025928 Unclassified 1217
246 Ga0207664_10006257 3300025929 Bacteria 8178
247 Ga0207644_10455216 3300025931 Unclassified 1052
248 Ga0207690_10835481 3300025932 Bacteria 762
249 Ga0207706_10008117 3300025933 Bacteria 9688
250 Ga0207706_11067857 3300025933 Bacteria 676
251 Ga0207686_10305925 3300025934 Unclassified 1182
252 Ga0207709_10260074 3300025935 Bacteria 1272
253 Ga0207670_10268531 3300025936 Bacteria 1325
254 Ga0207669_10805679 3300025937 Unclassified 779
255 Ga0207691_10100831 3300025940 Bacteria 2577
256 Ga0207691_10395690 3300025940 Bacteria 1179
257 Ga0207711_10056278 3300025941 Bacteria 3379
258 Ga0207711_10443213 3300025941 Bacteria 1208
259 Ga0207711_10476792 3300025941 Bacteria 1162
260 Ga0207689_10002215 3300025942 Bacteria 18217
261 Ga0207689_10138804 3300025942 Bacteria 2002
262 Ga0207661_10005296 3300025944 Bacteria 9079
263 Ga0207661_10020762 3300025944 Bacteria 4914
264 Ga0207661_10069353 3300025944 Bacteria 2874
265 Ga0207661_11747693 3300025944 Bacteria 567
266 Ga0207679_10005278 3300025945 Bacteria 8102
267 Ga0207667_10253670 3300025949 Bacteria 1800
268 Ga0207667_10894056 3300025949 Bacteria 880
269 Ga0207651_10293985 3300025960 Bacteria 1348
270 Ga0207651_10378404 3300025960 Bacteria 1199
271 Ga0207651_11238433 3300025960 Bacteria 670
272 Ga0207712_11635890 3300025961 Unclassified 577
273 Ga0207668_10103114 3300025972 Bacteria 2124
274 Ga0207668_10499490 3300025972 Bacteria 1046
275 Ga0207640_10103056 3300025981 Bacteria 2005
276 Ga0207640_11068210 3300025981 Bacteria 713
277 Ga0207658_10104309 3300025986 Bacteria 2228
278 Ga0207658_10179037 3300025986 Bacteria 1753
279 Ga0207658_10377351 3300025986 Unclassified 1241
280 Ga0207658_10500348 3300025986 Bacteria 1082
281 Ga0207677_10053610 3300026023 Bacteria 2746
282 Ga0207677_10137048 3300026023 Unclassified 1868
283 Ga0207677_10165660 3300026023 Unclassified 1722
284 Ga0207703_10219039 3300026035 Bacteria 1701
285 Ga0207703_10841670 3300026035 Bacteria 877
286 Ga0207703_11801948 3300026035 Bacteria 588
287 Ga0207639_10001014 3300026041 Bacteria 19102
288 Ga0207678_11468252 3300026067 Bacteria 602
289 Ga0207708_10030910 3300026075 Bacteria 4063
290 Ga0207702_10470657 3300026078 Bacteria 1222
291 Ga0207702_10654310 3300026078 Bacteria 1033
292 Ga0207641_10207404 3300026088 Bacteria 1810
293 Ga0207648_10129651 3300026089 Bacteria 2219
294 Ga0207676_10025251 3300026095 Bacteria 4408
295 Ga0207676_10048050 3300026095 Bacteria 3311
296 Ga0207676_10191309 3300026095 Bacteria 1801
297 Ga0207676_10354771 3300026095 Bacteria 1357
298 Ga0207674_10001567 3300026116 Bacteria 29451
299 Ga0207674_10402246 3300026116 Bacteria 1323
300 Ga0207675_100826057 3300026118 Bacteria 941
301 Ga0207683_10716061 3300026121 Unclassified 928
302 Ga0207698_11635046 3300026142 Bacteria 660
303 Ga0209968_1013434 3300027526 Bacteria 1285
304 Ga0209999_1091285 3300027543 Unclassified 590
305 Ga0209971_1024308 3300027682 Bacteria 1446
306 Ga0209966_1024151 3300027695 Bacteria 1199
307 Ga0209998_10000465 3300027717 Bacteria 11254
308 Ga0209974_10058966 3300027876 Bacteria 1298
309 Ga0268265_10469469 3300028380 Bacteria 1179
310 Ga0268265_10718736 3300028380 Bacteria 967
311 Ga0268264_10040690 3300028381 Bacteria 3841
312 Ga0268264_10519540 3300028381 Bacteria 1164
313 Ga0268264_10741716 3300028381 Unclassified 978
314 Ga0373931_0050434 3300035691 Unclassified 2214
315 Ga0373931_0474890 3300035691 Unclassified 803
316 Ga0373931_0586401 3300035691 Bacteria 727
317 Ga0373931_0800070 3300035691 Bacteria 628
318 Ga0373937_0528071 3300036401 Bacteria 1121
319 Ga0373937_0703561 3300036401 Bacteria 957
320 Ga0400490_09408 3300038726 Bacteria 1655
321 Ga0436365_0518536 3300039437 Bacteria 5476
322 Ga0436365_1174160 3300039437 Unclassified 1112
323 Ga0436365_1812169 3300039437 Bacteria 3239
324 Ga0451577_0443085 3300042876 Unclassified 1179
325 Ga0466966_0315387 3300044684 Bacteria 940
326 Ga0453684_0652914 3300044712 Unclassified 1148
327 Ga0451576_0759771 3300045051 Unclassified 1018
328 Ga0466958_0106791 3300045836 Bacteria 1746
329 Ga0466967_0084328 3300045976 Bacteria 2875
330 Ga0466967_0186996 3300045976 Bacteria 1956
331 Ga0466967_0731610 3300045976 Bacteria 981
332 Ga0495629_0026192 3300046459 Bacteria 4143
333 Ga0495582_0148052 3300046473 Bacteria 1332
334 Ga0495594_0007944 3300046499 Bacteria 5456
335 Ga0495594_0039352 3300046499 Bacteria 2586
336 Ga0495594_0159719 3300046499 Bacteria 1281
337 Ga0495599_0205822 3300046678 Bacteria 1208
338 Ga0495658_0190338 3300046683 Bacteria 1275
339 Ga0495581_0077535 3300047315 Bacteria 1923
340 Ga0495672_0031923 3300047320 Bacteria 3283
341 Ga0495676_0669256 3300047321 Bacteria 673
342 Ga0495593_0174829 3300047673 Unclassified 1082
343 Ga0496104_0663654 3300048907 Bacteria 951
344 Ga0496104_1250380 3300048907 Unclassified 646
345 Ga0496105_0639764 3300048908 Bacteria 822
346 Ga0496109_0081298 3300048912 Bacteria 2986
347 Ga0496112_0005289 3300048915 Bacteria 11132
348 Ga0496113_0176450 3300048916 Bacteria 1693
349 Ga0496113_0709253 3300048916 Bacteria 802
350 Ga0496113_1104342 3300048916 Bacteria 622
351 Ga0496126_0367531 3300048929 Bacteria 1174
352 Ga0496126_1341994 3300048929 Unclassified 519
353 Ga0501033_0178140 3300049570 Bacteria 1525
354 Ga0501033_0448913 3300049570 Archaea 896
355 Ga0501034_0015542 3300049571 Bacteria 7817
356 Ga0501036_0183708 3300049572 Bacteria 1760
357 Ga0501038_0187763 3300049574 Bacteria 1665
358 Ga0501039_0163016 3300049575 Bacteria 1753
359 Ga0501040_0031116 3300049576 Bacteria 3605
360 Ga0501042_0812549 3300049578 Unclassified 680
361 Ga0501046_0197783 3300049580 Bacteria 1496
362 Ga0501048_0047089 3300049582 Bacteria 3077
363 Ga0501070_0391492 3300049586 Bacteria 1125
364 Ga0501070_0546022 3300049586 Bacteria 928
365 Ga0501071_0200669 3300049587 Bacteria 1498
366 Ga0501072_0238531 3300049588 Bacteria 1448
367 Ga0501072_0878002 3300049588 Unclassified 701
368 Ga0501072_1214496 3300049588 Unclassified 585
369 Ga0501075_0096470 3300049591 Bacteria 2244
370 Ga0501219_000098 3300049703 Bacteria 15144
371 Ga0501225_0052037 3300049705 Bacteria 1141
372 Ga0501079_0057247 3300049741 Bacteria 3008
373 Ga0501080_0114023 3300049742 Bacteria 2506
374 Ga0501081_0089600 3300049743 Bacteria 2162
375 Ga0501083_0095832 3300049744 Bacteria 1958
376 Ga0501271_028632 3300049768 Unclassified 678
377 Ga0501035_0210594 3300049822 Bacteria 1663
378 Ga0501045_0145160 3300049824 Bacteria 1765
379 Ga0501284_00036 3300050005 Bacteria 57905
380 nmdc:mga0k408_345184_c1 3300050493 Bacteria 887
381 nmdc:mga05p37_27870_c1 3300050507 Bacteria 6881
382 nmdc:mga05p37_306904_c1 3300050507 Bacteria 1883
383 nmdc:mga05p37_312300_c1 3300050507 Unclassified 1863
384 nmdc:mga05p37_753365_c1 3300050507 Bacteria 1073
385 nmdc:mga09592_718705_c1 3300050508 Bacteria 849
386 nmdc:mga09592_99941_c1 3300050508 Bacteria 2484
387 nmdc:mga0qj67_1589735_c1 3300050509 Unclassified 502
388 nmdc:mga0qj67_260907_c1 3300050509 Bacteria 1405
389 nmdc:mga0qj67_5585_c1 3300050509 Bacteria 9188
390 nmdc:mga0qj67_600674_c1 3300050509 Unclassified 880
391 nmdc:mga06r32_141158_c1 3300050510 Bacteria 2385
392 nmdc:mga06r32_19052_c1 3300050510 Bacteria 6292
393 nmdc:mga06r32_30395_c1 3300050510 Bacteria 5067
394 nmdc:mga06r32_496172_c1 3300050510 Bacteria 1198
395 nmdc:mga0n895_130590_c1 3300050512 Bacteria 2537
396 nmdc:mga0n895_695124_c1 3300050512 Unclassified 1013
397 nmdc:mga0rr50_50092_c1 3300050513 Bacteria 3093
398 nmdc:mga08x19_199143_c1 3300050514 Bacteria 1372
399 nmdc:mga08x19_209021_c1 3300050514 Bacteria 1339
400 nmdc:mga08x19_55481_c1 3300050514 Bacteria 2554
401 nmdc:mga08x19_99241_c1 3300050514 Bacteria 1930
402 nmdc:mga0a205_196623_c1 3300050515 Bacteria 1907
403 Ga0495601_0018016 3300053077 Bacteria 4293
404 Ga0501082_0463945 3300060353 Bacteria 1107
405 Ga0501082_0861793 3300060353 Unclassified 792
406 Ga0530510_0416054 3300061734 Unclassified 1014
407 8056538574 8056533031 Bacteria 8964429
408 Ga0070698_100585345
409 JGI24752J21851_1045057
410 rootH1_10044204
411 rootH1_10105693
412 Ga0058863_11630560
413 Ga0058863_11666818
414 Ga0070658_10293574
415 Ga0070676_10330595
416 Ga0070683_100010597
417 Ga0070683_100030805
418 Ga0070690_100050221
419 Ga0070690_100161062
420 Ga0070690_101403537
421 Ga0070670_100196458
422 Ga0070677_10373746
423 Ga0068869_100011432
424 Ga0070666_10400943
425 Ga0070666_10528347
426 Ga0070666_10719600
427 Ga0070680_100000087
428 Ga0070680_100000891
429 Ga0070680_100046103
430 Ga0070680_100095665
431 Ga0068868_100033663
432 Ga0068868_100250404
433 Ga0068868_100483350
434 Ga0068868_100484459
435 Ga0068868_102013093
436 Ga0070660_100177108
437 Ga0070660_101309912
438 Ga0070689_100088504
439 Ga0070689_100988056
440 Ga0070689_101316368
441 Ga0070691_10027751
442 Ga0070691_10159090
443 Ga0070687_100022906
444 Ga0070687_100377477
445 Ga0070692_10319057
446 Ga0070692_10543415
447 Ga0070668_100196653
448 Ga0070668_100296022
449 Ga0070669_101239241
450 Ga0070675_100031536
451 Ga0070675_100314520
452 Ga0070674_100109882
453 Ga0070673_100028732
454 Ga0070673_100277206
455 Ga0070673_100649007
456 Ga0070688_100024300
457 Ga0070659_100002368
458 Ga0070667_100836027
459 Ga0070667_101024255
460 Ga0070714_100002098
461 Ga0070714_100136843
462 Ga0070701_10289579
463 Ga0070694_100551314
464 Ga0070662_100001675
465 Ga0070681_10003281
466 Ga0070681_10025666
467 Ga0070681_10126893
468 Ga0070681_10211158
469 Ga0068867_101065593
470 Ga0070707_100216736
471 Ga0070699_100850270
472 Ga0070679_100004790
473 Ga0070679_100011105
474 Ga0070679_100030359
475 Ga0070679_100067038
476 Ga0070679_100078002
477 Ga0070679_100366255
478 Ga0070684_100020282
479 Ga0070684_100147290
480 Ga0070684_100515959
481 Ga0070697_100226957
482 Ga0068853_100054609
483 Ga0068853_100170534
484 Ga0070672_100404817
485 Ga0070686_100356779
486 Ga0070696_100001496
487 Ga0070696_100344674
488 Ga0070696_101555116
489 Ga0070693_100177451
490 Ga0070693_100270221
491 Ga0070693_101369976
492 Ga0070665_100394338
493 Ga0068855_100153541
494 Ga0068855_100182016
495 Ga0068855_100233767
496 Ga0068855_101257404
497 Ga0070664_100150327
498 Ga0068857_100008258
499 Ga0068857_100180526
500 Ga0068854_100019671
501 Ga0068854_101364684
502 Ga0068856_100023545
503 Ga0068856_102540778
504 Ga0068852_100206904
505 Ga0068859_100036079
506 Ga0068859_100094514
507 Ga0068859_100252673
508 Ga0068859_100881582
509 Ga0068859_101562349
510 Ga0068859_101933245
511 Ga0068864_100143828
512 Ga0068864_101998092
513 Ga0068866_10912532
514 Ga0068851_10747842
515 Ga0068870_10110874
516 Ga0068863_100058191
517 Ga0068858_100400793
518 Ga0068858_100873625
519 Ga0068860_100114208
520 Ga0068860_100877861
521 Ga0081540_1001795
522 Ga0070715_10667025
523 Ga0075366_10185521
524 Ga0097621_100065355
525 Ga0075428_100094062
526 Ga0075428_100213360
527 Ga0075428_100297704
528 Ga0075430_100000314
529 Ga0075430_100149962
530 Ga0075430_100405541
531 Ga0075430_100634211
532 Ga0075431_100207546
533 Ga0075431_100269756
534 Ga0075431_101334973
535 Ga0075434_100022531
536 Ga0075434_100492277
537 Ga0075434_100955860
538 Ga0075429_100033496
539 Ga0068865_100089750
540 Ga0068865_100391698
541 Ga0075436_100010163
542 Ga0075436_100167432
543 Ga0075436_100306394
544 Ga0075436_100752401
545 Ga0097620_100036079
546 Ga0097620_100094518
547 Ga0097620_100252670
548 Ga0097620_101562307
549 Ga0097620_101933226
550 Ga0075435_100460315
551 Ga0105240_11108501
552 Ga0111539_11588625
553 Ga0105245_10025558
554 Ga0105245_10349733
555 Ga0114129_10035942
556 Ga0114129_10293077
557 Ga0114129_10333981
558 Ga0114129_11036291
559 Ga0114129_11802840
560 Ga0114129_12564545
561 Ga0105243_10125438
562 Ga0105243_11260851
563 Ga0105241_10220300
564 Ga0105241_10389827
565 Ga0105242_10121754
566 Ga0105248_10006003
567 Ga0105248_10035213
568 Ga0105248_10094197
569 Ga0105248_10513702
570 Ga0105248_11931912
571 Ga0105237_10013613
572 Ga0105237_10427650
573 Ga0105237_10847081
574 Ga0105238_10672577
575 Ga0105238_11599513
576 Ga0105249_10197047
577 Ga0105249_10470521
578 Ga0105239_10489060
579 Ga0105246_10165189
580 Ga0157316_1067814
581 Ga0157373_10095161
582 Ga0157371_10076819
583 Ga0157369_10005035
584 Ga0157369_10272381
585 Ga0157369_11174676
586 Ga0157369_11174677
587 Ga0157369_11187153
588 Ga0157369_11418103
589 Ga0157374_10009151
590 Ga0157374_10555333
591 Ga0157374_10729420
592 Ga0157374_11769059
593 Ga0157374_11980246
594 Ga0157378_10189027
595 Ga0157378_11009765
596 Ga0163162_10176569
597 Ga0163162_10636173
598 Ga0157372_10009348
599 Ga0157372_10905230
600 Ga0157372_11590067
601 Ga0157372_11631760
602 Ga0157375_10348789
603 Ga0157375_12740779
604 Ga0163163_10026153
605 Ga0163163_10448767
606 Ga0157377_10233533
607 Ga0157377_10392295
608 Ga0157376_10006619
609 Ga0157376_11850140
610 Ga0182005_1070647
611 Ga0163161_10133108
612 Ga0206354_10558447
613 Ga0213876_10054430
614 Ga0207682_10319717
615 Ga0207680_10146315
616 Ga0207680_10492219
617 Ga0207647_10078488
618 Ga0207645_10260655
619 Ga0207643_10069089
620 Ga0207705_10040817
621 Ga0207684_10872586
622 Ga0207654_10019091
623 Ga0207707_10000874
624 Ga0207707_10031323
625 Ga0207707_10063219
626 Ga0207695_10372282
627 Ga0207671_10001999
628 Ga0207671_10462736
629 Ga0207693_10399093
630 Ga0207660_10000130
631 Ga0207660_10098113
632 Ga0207660_10165645
633 Ga0207662_10119202
634 Ga0207657_10048919
635 Ga0207649_10002554
636 Ga0207649_10132155
637 Ga0207652_10004380
638 Ga0207652_10005635
639 Ga0207652_10018463
640 Ga0207652_10051714
641 Ga0207652_10106047
642 Ga0207646_11466194
643 Ga0207681_10282611
644 Ga0207694_10196625
645 Ga0207650_10056013
646 Ga0207650_10123767
647 Ga0207650_10551436
648 Ga0207659_10003960
649 Ga0207659_10113321
650 Ga0207687_10004301
651 Ga0207687_10068653
652 Ga0207700_10391287
653 Ga0207664_10006257
654 Ga0207644_10455216
655 Ga0207690_10835481
656 Ga0207706_10008117
657 Ga0207706_11067857
658 Ga0207686_10305925
659 Ga0207709_10260074
660 Ga0207670_10268531
661 Ga0207669_10805679
662 Ga0207691_10100831
663 Ga0207691_10395690
664 Ga0207711_10056278
665 Ga0207711_10443213
666 Ga0207711_10476792
667 Ga0207689_10002215
668 Ga0207689_10138804
669 Ga0207661_10005296
670 Ga0207661_10020762
671 Ga0207661_10069353
672 Ga0207661_11747693
673 Ga0207679_10005278
674 Ga0207667_10253670
675 Ga0207667_10894056
676 Ga0207651_10293985
677 Ga0207651_10378404
678 Ga0207651_11238433
679 Ga0207712_11635890
680 Ga0207668_10103114
681 Ga0207668_10499490
682 Ga0207640_10103056
683 Ga0207640_11068210
684 Ga0207658_10104309
685 Ga0207658_10179037
686 Ga0207658_10377351
687 Ga0207658_10500348
688 Ga0207677_10053610
689 Ga0207677_10137048
690 Ga0207677_10165660
691 Ga0207703_10219039
692 Ga0207703_10841670
693 Ga0207703_11801948
694 Ga0207639_10001014
695 Ga0207678_11468252
696 Ga0207708_10030910
697 Ga0207702_10470657
698 Ga0207702_10654310
699 Ga0207641_10207404
700 Ga0207648_10129651
701 Ga0207676_10025251
702 Ga0207676_10048050
703 Ga0207676_10191309
704 Ga0207676_10354771
705 Ga0207674_10001567
706 Ga0207674_10402246
707 Ga0207675_100826057
708 Ga0207683_10716061
709 Ga0207698_11635046
710 Ga0209968_1013434
711 Ga0209999_1091285
712 Ga0209971_1024308
713 Ga0209966_1024151
714 Ga0209998_10000465
715 Ga0209974_10058966
716 Ga0268265_10469469
717 Ga0268265_10718736
718 Ga0268264_10040690
719 Ga0268264_10519540
720 Ga0268264_10741716
721 Ga0373931_0050434
722 Ga0373931_0474890
723 Ga0373931_0586401
724 Ga0373931_0800070
725 Ga0373937_0528071
726 Ga0373937_0703561
727 Ga0400490_09408
728 Ga0436365_0518536
729 Ga0436365_1174160
730 Ga0436365_1812169
731 Ga0451577_0443085
732 Ga0466966_0315387
733 Ga0453684_0652914
734 Ga0451576_0759771
735 Ga0466958_0106791
736 Ga0466967_0084328
737 Ga0466967_0186996
738 Ga0466967_0731610
739 Ga0495629_0026192
740 Ga0495582_0148052
741 Ga0495594_0007944
742 Ga0495594_0039352
743 Ga0495594_0159719
744 Ga0495599_0205822
745 Ga0495658_0190338
746 Ga0495581_0077535
747 Ga0495672_0031923
748 Ga0495676_0669256
749 Ga0495593_0174829
750 Ga0496104_0663654
751 Ga0496104_1250380
752 Ga0496105_0639764
753 Ga0496109_0081298
754 Ga0496112_0005289
755 Ga0496113_0176450
756 Ga0496113_0709253
757 Ga0496113_1104342
758 Ga0496126_0367531
759 Ga0496126_1341994
760 Ga0501033_0178140
761 Ga0501033_0448913
762 Ga0501034_0015542
763 Ga0501036_0183708
764 Ga0501038_0187763
765 Ga0501039_0163016
766 Ga0501040_0031116
767 Ga0501042_0812549
768 Ga0501046_0197783
769 Ga0501048_0047089
770 Ga0501070_0391492
771 Ga0501070_0546022
772 Ga0501071_0200669
773 Ga0501072_0238531
774 Ga0501072_0878002
775 Ga0501072_1214496
776 Ga0501075_0096470
777 Ga0501219_000098
778 Ga0501225_0052037
779 Ga0501079_0057247
780 Ga0501080_0114023
781 Ga0501081_0089600
782 Ga0501083_0095832
783 Ga0501271_028632
784 Ga0501035_0210594
785 Ga0501045_0145160
786 Ga0501284_00036
787 nmdc:mga0k408_345184_c1
788 nmdc:mga05p37_27870_c1
789 nmdc:mga05p37_306904_c1
790 nmdc:mga05p37_312300_c1
791 nmdc:mga05p37_753365_c1
792 nmdc:mga09592_718705_c1
793 nmdc:mga09592_99941_c1
794 nmdc:mga0qj67_1589735_c1
795 nmdc:mga0qj67_260907_c1
796 nmdc:mga0qj67_5585_c1
797 nmdc:mga0qj67_600674_c1
798 nmdc:mga06r32_141158_c1
799 nmdc:mga06r32_19052_c1
800 nmdc:mga06r32_30395_c1
801 nmdc:mga06r32_496172_c1
802 nmdc:mga0n895_130590_c1
803 nmdc:mga0n895_695124_c1
804 nmdc:mga0rr50_50092_c1
805 nmdc:mga08x19_199143_c1
806 nmdc:mga08x19_209021_c1
807 nmdc:mga08x19_55481_c1
808 nmdc:mga08x19_99241_c1
809 nmdc:mga0a205_196623_c1
810 Ga0495601_0018016
811 Ga0501082_0463945
812 Ga0501082_0861793
813 Ga0530510_0416054
814 8056538574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mqw-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9777 3 125
3mqw-assembly1.cif.gz_B crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9761 3 125
3m1x-assembly1.cif.gz_A crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form 0.976 1 125
5v4d-assembly2.cif.gz_F crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis 0.9758 2 125
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9756 2 127
ID Description Score Start End Superfamily
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9768 3 125 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.976 1 125 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9756 2 127 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9749 4 125 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9743 2 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A257SEB5-F1-model_v4 deleted 0.9995 23 127
AF-A0A2V7STQ1-F1-model_v4 Reactive intermediate/imine deaminase 0.9929 1 127 GO:0005829
GO:0019239
AF-A0A225ZR36-F1-model_v4 deleted 0.9896 3 127
AF-A0A1S8VFH4-F1-model_v4 deleted 0.9893 2 127
AF-A0A7Y5WKE0-F1-model_v4 RidA family protein 0.9892 1 127 GO:0005829
GO:0019239

Map