F436409

General Info

Members Datasets Scaffolds Average Seq Length
407 239 400 202

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100033889|Ga0070678_1000338893
Length 221
Sequence MDGITSLRYFKGYARARHGARRMSNRANPFEWSGGHPALDLVNTLDERPSGAPIENLATYHDLTRFAALAGLIDRRTAAGLERLDSRSGSTVVKSARRLREHLHDVLAAANSGRSARQPDLDALSAAIRAAHAARKLVASPSPGLADRRWSPALAREIPLHACSLAIECLLVGEDSKRIRKCGAADCDVYYLDTSKGRRRQWCSMKGCGNREKQRRWRGVA

Samples

Sample ID Description Type Environment
1 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2791355199
4 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
5 2904699407
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
239 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0.98
Rhizoplane 6.88
Rhizosphere 77.89
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10006327 3300003659 Bacteria 2474
2 Ga0070676_10306089 3300005328 Bacteria 1079
3 Ga0070676_10475899 3300005328 Bacteria 883
4 Ga0070690_100250499 3300005330 Bacteria 1252
5 Ga0070670_100827772 3300005331 Bacteria 837
6 Ga0068869_100015386 3300005334 Bacteria 5130
7 Ga0070666_10256694 3300005335 Bacteria 1238
8 Ga0070666_10503028 3300005335 Bacteria 878
9 Ga0070680_100017485 3300005336 Bacteria 5655
10 Ga0070682_100202008 3300005337 Bacteria 1403
11 Ga0068868_100134184 3300005338 Bacteria 2028
12 Ga0068868_100235306 3300005338 Bacteria 1537
13 Ga0070660_100594320 3300005339 Bacteria 925
14 Ga0070687_100100957 3300005343 Bacteria 1615
15 Ga0070687_100127401 3300005343 Bacteria 1465
16 Ga0070661_100114293 3300005344 Bacteria 2018
17 Ga0070668_100051730 3300005347 Bacteria 3166
18 Ga0070668_100568070 3300005347 Bacteria 989
19 Ga0070675_100373312 3300005354 Bacteria 1268
20 Ga0070671_100284761 3300005355 Bacteria 1406
21 Ga0070674_100103987 3300005356 Bacteria 2074
22 Ga0070673_100141283 3300005364 Bacteria 2031
23 Ga0070667_100317846 3300005367 Bacteria 1404
24 Ga0070709_10035292 3300005434 Bacteria 3038
25 Ga0070713_100024131 3300005436 Bacteria 4732
26 Ga0070710_10030923 3300005437 Bacteria 2885
27 Ga0070701_10049807 3300005438 Bacteria 2167
28 Ga0070701_10097564 3300005438 Bacteria 1622
29 Ga0070700_100010532 3300005441 Bacteria 5109
30 Ga0070694_100068723 3300005444 Bacteria 2435
31 Ga0070694_100299008 3300005444 Bacteria 1233
32 Ga0070663_100016039 3300005455 Bacteria 4852
33 Ga0070663_100020620 3300005455 Bacteria 4365
34 Ga0070663_100054862 3300005455 Bacteria 2850
35 Ga0070678_100033889 3300005456 Bacteria 3550
36 Ga0070678_100097328 3300005456 Bacteria 2272
37 Ga0070662_100028359 3300005457 Bacteria 3894
38 Ga0070662_100065510 3300005457 Bacteria 2664
39 Ga0070662_100689110 3300005457 Bacteria 864
40 Ga0070685_10203297 3300005466 Bacteria 1289
41 Ga0070706_100380712 3300005467 Bacteria 1314
42 Ga0070706_100953605 3300005467 Bacteria 792
43 Ga0070698_100173040 3300005471 Bacteria 2099
44 Ga0070699_100148429 3300005518 Bacteria 2073
45 Ga0070699_100567010 3300005518 Bacteria 1034
46 Ga0070679_100063187 3300005530 Bacteria 3691
47 Ga0070672_100020162 3300005543 Bacteria 4858
48 Ga0070686_100141722 3300005544 Bacteria 1674
49 Ga0070695_100001032 3300005545 Bacteria 15228
50 Ga0070696_100383005 3300005546 Bacteria 1097
51 Ga0070693_100073360 3300005547 Bacteria 2021
52 Ga0070665_100088456 3300005548 Bacteria 3103
53 Ga0070665_100186956 3300005548 Bacteria 2072
54 Ga0070665_100272392 3300005548 Bacteria 1695
55 Ga0070665_100315478 3300005548 Bacteria 1567
56 Ga0070665_100444123 3300005548 Bacteria 1306
57 Ga0070704_100330976 3300005549 Unclassified 1279
58 Ga0068855_100071280 3300005563 Bacteria 4041
59 Ga0070664_100076494 3300005564 Bacteria 2876
60 Ga0068854_100267925 3300005578 Bacteria 1370
61 Ga0068856_100380574 3300005614 Bacteria 1430
62 Ga0070702_100196110 3300005615 Bacteria 1333
63 Ga0070702_100512651 3300005615 Bacteria 883
64 Ga0068859_100185911 3300005617 Bacteria 2162
65 Ga0068859_100533439 3300005617 Bacteria 1268
66 Ga0068866_10060681 3300005718 Bacteria 1961
67 Ga0068866_10147656 3300005718 Bacteria 1358
68 Ga0068861_100068243 3300005719 Bacteria 2747
69 Ga0068861_100461346 3300005719 Bacteria 1140
70 Ga0068861_100644266 3300005719 Bacteria 978
71 Ga0068863_100339339 3300005841 Bacteria 1462
72 Ga0068863_100461257 3300005841 Bacteria 1248
73 Ga0068858_100273015 3300005842 Bacteria 1609
74 Ga0068858_100804918 3300005842 Bacteria 917
75 Ga0068860_100162839 3300005843 Bacteria 2151
76 Ga0068860_100182455 3300005843 Bacteria 2029
77 Ga0068862_100081669 3300005844 Bacteria 2804
78 Ga0068862_100108432 3300005844 Bacteria 2435
79 Ga0068862_100629635 3300005844 Bacteria 1033
80 Ga0081455_10015442 3300005937 Bacteria 7420
81 Ga0081455_10051883 3300005937 Bacteria 3516
82 Ga0081540_1000713 3300005983 Bacteria 30810
83 Ga0081540_1003902 3300005983 Bacteria 11615
84 Ga0081540_1022639 3300005983 Bacteria 3706
85 Ga0081540_1056492 3300005983 Bacteria 1905
86 Ga0081540_1129899 3300005983 Bacteria 1030
87 Ga0070717_10137450 3300006028 Bacteria 2106
88 Ga0070717_10463805 3300006028 Bacteria 1143
89 Ga0070717_10650623 3300006028 Bacteria 957
90 Ga0075365_10051632 3300006038 Bacteria 2717
91 Ga0075365_10108871 3300006038 Unclassified 1903
92 Ga0075368_10008552 3300006042 Bacteria 3650
93 Ga0075368_10010566 3300006042 Bacteria 3340
94 Ga0075368_10102719 3300006042 Bacteria 1175
95 Ga0075363_100013043 3300006048 Bacteria 4017
96 Ga0075363_100033296 3300006048 Bacteria 2682
97 Ga0075363_100042391 3300006048 Bacteria 2405
98 Ga0075364_10012966 3300006051 Bacteria 5116
99 Ga0075364_10488046 3300006051 Bacteria 842
100 Ga0075367_10012467 3300006178 Bacteria 4535
101 Ga0075369_10026660 3300006186 Bacteria 2410
102 Ga0097621_100703157 3300006237 Bacteria 931
103 Ga0075370_10128081 3300006353 Bacteria 1480
104 Ga0075370_10194635 3300006353 Bacteria 1195
105 Ga0075370_10399734 3300006353 Bacteria 824
106 Ga0068871_100055003 3300006358 Bacteria 3230
107 Ga0075428_100098860 3300006844 Bacteria 3181
108 Ga0075428_100158916 3300006844 Bacteria 2454
109 Ga0075428_100211961 3300006844 Bacteria 2093
110 Ga0075428_100312068 3300006844 Unclassified 1690
111 Ga0075428_100343112 3300006844 Bacteria 1603
112 Ga0075428_101021580 3300006844 Bacteria 875
113 Ga0075428_101024210 3300006844 Bacteria 873
114 Ga0075428_101147414 3300006844 Bacteria 820
115 Ga0075430_100097306 3300006846 Bacteria 2459
116 Ga0075430_100302255 3300006846 Bacteria 1323
117 Ga0075430_100631492 3300006846 Unclassified 883
118 Ga0075431_100063214 3300006847 Bacteria 3820
119 Ga0075431_100200407 3300006847 Bacteria 2042
120 Ga0075431_100283808 3300006847 Unclassified 1676
121 Ga0075431_100359934 3300006847 Bacteria 1462
122 Ga0075433_10003568 3300006852 Bacteria 12009
123 Ga0075434_100001043 3300006871 Bacteria 22614
124 Ga0075434_100140591 3300006871 Bacteria 2433
125 Ga0075429_100197838 3300006880 Unclassified 1761
126 Ga0075429_100323094 3300006880 Bacteria 1350
127 Ga0075429_100526926 3300006880 Bacteria 1035
128 Ga0068865_100011760 3300006881 Bacteria 5483
129 Ga0068865_100044009 3300006881 Bacteria 3053
130 Ga0075436_100002029 3300006914 Bacteria 13966
131 Ga0097620_100185915 3300006931 Bacteria 2162
132 Ga0097620_100533436 3300006931 Bacteria 1268
133 Ga0075435_100007289 3300007076 Bacteria 7874
134 Ga0099795_10060140 3300007788 Bacteria 1407
135 Ga0111539_10002363 3300009094 Bacteria 25086
136 Ga0111539_10123801 3300009094 Bacteria 3030
137 Ga0111539_10273992 3300009094 Unclassified 1964
138 Ga0105245_10060936 3300009098 Bacteria 3400
139 Ga0105245_10125829 3300009098 Bacteria 2399
140 Ga0105245_10702190 3300009098 Bacteria 1045
141 Ga0105245_11298078 3300009098 Bacteria 777
142 Ga0105247_10246247 3300009101 Bacteria 1220
143 Ga0105247_10247405 3300009101 Bacteria 1217
144 Ga0105247_10280982 3300009101 Bacteria 1148
145 Ga0114129_10026035 3300009147 Bacteria 8283
146 Ga0114129_10040798 3300009147 Bacteria 6543
147 Ga0114129_10333708 3300009147 Bacteria 2012
148 Ga0114129_10353077 3300009147 Bacteria 1947
149 Ga0114129_10658199 3300009147 Bacteria 1351
150 Ga0105243_10361828 3300009148 Bacteria 1336
151 Ga0105243_10398413 3300009148 Bacteria 1278
152 Ga0105241_10030519 3300009174 Bacteria 4029
153 Ga0105241_10713740 3300009174 Bacteria 916
154 Ga0105242_10310333 3300009176 Bacteria 1443
155 Ga0105248_10020941 3300009177 Bacteria 7247
156 Ga0105248_10221499 3300009177 Bacteria 2130
157 Ga0105248_11371149 3300009177 Unclassified 800
158 Ga0105237_10019705 3300009545 Bacteria 6964
159 Ga0105238_10114953 3300009551 Bacteria 2670
160 Ga0105238_10353230 3300009551 Bacteria 1459
161 Ga0105238_10418337 3300009551 Bacteria 1335
162 Ga0105249_10075871 3300009553 Bacteria 3114
163 Ga0105249_10596793 3300009553 Bacteria 1159
164 Ga0105249_10681157 3300009553 Bacteria 1087
165 Ga0099796_10005305 3300010159 Bacteria 3206
166 Ga0105239_10062216 3300010375 Bacteria 4097
167 Ga0105239_10428705 3300010375 Bacteria 1499
168 Ga0105239_10873151 3300010375 Bacteria 1032
169 Ga0105246_10041887 3300011119 Bacteria 3098
170 Ga0157374_10140813 3300013296 Bacteria 2341
171 Ga0157374_10345598 3300013296 Bacteria 1477
172 Ga0157378_10105367 3300013297 Bacteria 2578
173 Ga0157378_10365210 3300013297 Bacteria 1414
174 Ga0163162_10347541 3300013306 Bacteria 1616
175 Ga0163162_10627421 3300013306 Bacteria 1200
176 Ga0163162_10826092 3300013306 Bacteria 1043
177 Ga0157375_10184361 3300013308 Bacteria 2240
178 Ga0157375_10204648 3300013308 Bacteria 2130
179 Ga0157375_10475051 3300013308 Bacteria 1415
180 Ga0163163_10092516 3300014325 Bacteria 3039
181 Ga0163163_11294294 3300014325 Bacteria 791
182 Ga0157380_10112975 3300014326 Bacteria 2286
183 Ga0157380_10256226 3300014326 Bacteria 1587
184 Ga0157380_10335263 3300014326 Bacteria 1408
185 Ga0157380_11061078 3300014326 Bacteria 847
186 Ga0157377_10148654 3300014745 Bacteria 1446
187 Ga0157379_10095926 3300014968 Bacteria 2661
188 Ga0157379_10214402 3300014968 Bacteria 1744
189 Ga0157379_10323733 3300014968 Bacteria 1408
190 Ga0157376_10090478 3300014969 Bacteria 2649
191 Ga0157376_10360576 3300014969 Bacteria 1394
192 Ga0163161_10030309 3300017792 Bacteria 3848
193 Ga0163161_10364777 3300017792 Bacteria 1151
194 Ga0207697_10040989 3300025315 Bacteria 1901
195 Ga0207692_10114167 3300025898 Bacteria 1502
196 Ga0207710_10077151 3300025900 Bacteria 1539
197 Ga0207710_10149794 3300025900 Bacteria 1131
198 Ga0207688_10028535 3300025901 Bacteria 3070
199 Ga0207688_10115458 3300025901 Bacteria 1562
200 Ga0207680_10038138 3300025903 Bacteria 2780
201 Ga0207699_10081686 3300025906 Bacteria 2006
202 Ga0207645_10056131 3300025907 Bacteria 2514
203 Ga0207645_10158828 3300025907 Bacteria 1478
204 Ga0207684_10290874 3300025910 Bacteria 1409
205 Ga0207654_10003362 3300025911 Bacteria 8100
206 Ga0207654_10492565 3300025911 Bacteria 865
207 Ga0207707_10001378 3300025912 Bacteria 22538
208 Ga0207671_10039950 3300025914 Bacteria 3474
209 Ga0207693_10043771 3300025915 Bacteria 3520
210 Ga0207662_10062370 3300025918 Bacteria 2240
211 Ga0207662_10420413 3300025918 Bacteria 909
212 Ga0207657_10503014 3300025919 Bacteria 949
213 Ga0207649_10075642 3300025920 Bacteria 2165
214 Ga0207681_10169112 3300025923 Bacteria 1656
215 Ga0207681_10339254 3300025923 Bacteria 1200
216 Ga0207659_10322003 3300025926 Bacteria 1276
217 Ga0207687_10039524 3300025927 Bacteria 3231
218 Ga0207700_10383707 3300025928 Bacteria 1229
219 Ga0207644_10347202 3300025931 Bacteria 1204
220 Ga0207690_10881984 3300025932 Bacteria 741
221 Ga0207706_10057068 3300025933 Bacteria 3441
222 Ga0207706_10062138 3300025933 Bacteria 3290
223 Ga0207686_10067849 3300025934 Bacteria 2283
224 Ga0207686_10425437 3300025934 Bacteria 1017
225 Ga0207670_10429061 3300025936 Bacteria 1062
226 Ga0207669_10288151 3300025937 Bacteria 1242
227 Ga0207704_10646022 3300025938 Unclassified 871
228 Ga0207665_10727509 3300025939 Bacteria 781
229 Ga0207691_10015630 3300025940 Bacteria 7216
230 Ga0207711_10028374 3300025941 Bacteria 4709
231 Ga0207689_10051803 3300025942 Bacteria 3384
232 Ga0207689_10057897 3300025942 Bacteria 3187
233 Ga0207651_10540401 3300025960 Bacteria 1012
234 Ga0207712_10057435 3300025961 Bacteria 2746
235 Ga0207712_10403798 3300025961 Bacteria 1149
236 Ga0207668_10024244 3300025972 Bacteria 3912
237 Ga0207668_10186960 3300025972 Bacteria 1638
238 Ga0207668_11036833 3300025972 Unclassified 734
239 Ga0207640_10158632 3300025981 Bacteria 1671
240 Ga0207658_10402721 3300025986 Bacteria 1203
241 Ga0207677_10069432 3300026023 Bacteria 2478
242 Ga0207677_10107923 3300026023 Bacteria 2066
243 Ga0207677_10291676 3300026023 Bacteria 1344
244 Ga0207703_10091782 3300026035 Bacteria 2555
245 Ga0207678_10033787 3300026067 Bacteria 4454
246 Ga0207678_10044199 3300026067 Bacteria 3854
247 Ga0207678_10093017 3300026067 Bacteria 2576
248 Ga0207708_10006892 3300026075 Bacteria 8407
249 Ga0207708_10039305 3300026075 Bacteria 3604
250 Ga0207702_10506991 3300026078 Bacteria 1177
251 Ga0207641_10125964 3300026088 Bacteria 2293
252 Ga0207641_10658472 3300026088 Bacteria 1029
253 Ga0207674_10043409 3300026116 Bacteria 4636
254 Ga0207675_100013227 3300026118 Bacteria 7703
255 Ga0207675_100107125 3300026118 Bacteria 2635
256 Ga0207683_10151856 3300026121 Bacteria 2090
257 Ga0207698_10868826 3300026142 Bacteria 908
258 Ga0209813_10012935 3300027866 Bacteria 2218
259 Ga0209813_10065271 3300027866 Bacteria 1171
260 Ga0209813_10085111 3300027866 Bacteria 1052
261 Ga0207428_10012592 3300027907 Bacteria 7418
262 Ga0207428_10217856 3300027907 Bacteria 1432
263 Ga0268266_10059047 3300028379 Bacteria 3304
264 Ga0268266_10270616 3300028379 Bacteria 1577
265 Ga0268266_10287529 3300028379 Bacteria 1530
266 Ga0268266_10338200 3300028379 Bacteria 1412
267 Ga0268265_10392587 3300028380 Bacteria 1280
268 Ga0268264_10161540 3300028381 Bacteria 2019
269 Ga0307517_10000512 3300028786 Bacteria 66501
270 Ga0307405_10611569 3300031731 Bacteria 891
271 Ga0307416_100436758 3300032002 Bacteria 1358
272 Ga0307416_101165364 3300032002 Bacteria 876
273 Ga0307415_100122475 3300032126 Bacteria 1953
274 Ga0373944_0072566 3300035089 Unclassified 1124
275 Ga0373935_0444262 3300035692 Bacteria 936
276 Ga0373927_0060052 3300035695 Bacteria 2460
277 Ga0373927_0122719 3300035695 Bacteria 1696
278 Ga0436365_0330738 3300039437 Bacteria 4361
279 Ga0436363_0730905 3300039450 Bacteria 1161
280 Ga0495590_0108938 3300046457 Bacteria 988
281 Ga0495638_0113557 3300046460 Bacteria 1607
282 Ga0495605_0071388 3300046474 Bacteria 1640
283 Ga0495584_0059025 3300046491 Bacteria 1930
284 Ga0495584_0122480 3300046491 Bacteria 1317
285 Ga0495585_0305143 3300046492 Bacteria 782
286 Ga0495596_0116180 3300046500 Bacteria 1039
287 Ga0495583_0090714 3300046506 Bacteria 1316
288 Ga0495610_0046520 3300046512 Bacteria 2140
289 Ga0495632_0071536 3300046519 Bacteria 1666
290 Ga0495597_0270576 3300046542 Bacteria 664
291 Ga0495656_0007730 3300046615 Bacteria 3813
292 Ga0495656_0376545 3300046615 Bacteria 739
293 Ga0495611_0062525 3300046648 Bacteria 1694
294 Ga0495625_0174060 3300046660 Bacteria 1435
295 Ga0495625_0184807 3300046660 Bacteria 1384
296 Ga0495659_0221768 3300046664 Bacteria 781
297 Ga0495669_0004541 3300046684 Bacteria 5742
298 Ga0495671_0057935 3300046692 Bacteria 1917
299 Ga0495589_0137605 3300046794 Bacteria 1171
300 Ga0495589_0214206 3300046794 Bacteria 906
301 Ga0495636_0054221 3300047318 Bacteria 1685
302 Ga0495672_0024276 3300047320 Bacteria 3909
303 Ga0495683_0093531 3300047323 Bacteria 1454
304 Ga0495677_0015036 3300047445 Bacteria 2813
305 Ga0496100_0479858 3300048903 Bacteria 956
306 Ga0496101_0062531 3300048904 Bacteria 2707
307 Ga0496102_0142791 3300048905 Bacteria 2245
308 Ga0496102_0246222 3300048905 Bacteria 1685
309 Ga0496102_0497518 3300048905 Bacteria 1141
310 Ga0496103_0111898 3300048906 Bacteria 1735
311 Ga0496104_0153424 3300048907 Bacteria 2211
312 Ga0496105_0350943 3300048908 Bacteria 1178
313 Ga0496106_0050836 3300048909 Bacteria 3124
314 Ga0496106_0371198 3300048909 Bacteria 1150
315 Ga0496106_0705819 3300048909 Unclassified 804
316 Ga0496107_0339748 3300048910 Bacteria 1117
317 Ga0496107_0371805 3300048910 Bacteria 1063
318 Ga0496107_0480252 3300048910 Bacteria 922
319 Ga0496107_0723478 3300048910 Bacteria 731
320 Ga0496108_0023293 3300048911 Bacteria 5094
321 Ga0496108_0617563 3300048911 Bacteria 944
322 Ga0496109_0051360 3300048912 Bacteria 3755
323 Ga0496109_0549661 3300048912 Bacteria 1089
324 Ga0496109_0667845 3300048912 Bacteria 976
325 Ga0496110_0011391 3300048913 Bacteria 7277
326 Ga0496110_0140493 3300048913 Bacteria 2183
327 Ga0496111_0095154 3300048914 Bacteria 2185
328 Ga0496111_0185705 3300048914 Bacteria 1546
329 Ga0496112_0020318 3300048915 Bacteria 6292
330 Ga0496113_0067438 3300048916 Bacteria 2713
331 Ga0496114_0367071 3300048917 Bacteria 1274
332 Ga0496115_0340037 3300048918 Bacteria 1225
333 Ga0496117_0118108 3300048920 Bacteria 1636
334 Ga0496120_0144584 3300048923 Bacteria 1203
335 Ga0496121_0041096 3300048924 Bacteria 4047
336 Ga0496121_0372150 3300048924 Bacteria 945
337 Ga0496125_0303679 3300048928 Bacteria 976
338 Ga0496126_0113436 3300048929 Bacteria 2359
339 Ga0495682_0091220 3300049460 Bacteria 1094
340 Ga0501073_0127813 3300049589 Bacteria 1762
341 nmdc:mga03683_114905_c1 3300050489 Bacteria 1193
342 nmdc:mga03n38_24259_c1 3300050490 Bacteria 2478
343 nmdc:mga03n38_7228_c1 3300050490 Bacteria 3917
344 nmdc:mga03n38_85509_c1 3300050490 Bacteria 1491
345 nmdc:mga03n38_90086_c1 3300050490 Bacteria 1458
346 nmdc:mga00v17_50441_c1 3300050491 Bacteria 2529
347 nmdc:mga0yw44_56908_c1 3300050492 Bacteria 2384
348 nmdc:mga06z11_186752_c1 3300050494 Bacteria 1198
349 nmdc:mga06z11_2320_c1 3300050494 Bacteria 7242
350 nmdc:mga06z11_270954_c1 3300050494 Bacteria 1004
351 nmdc:mga04h51_5728_c1 3300050495 Bacteria 3181
352 nmdc:mga07m45_19636_c2 3300050496 Bacteria 1304
353 nmdc:mga07m45_358161_c1 3300050496 Bacteria 848
354 nmdc:mga05p37_186431_c1 3300050507 Bacteria 2522
355 nmdc:mga05p37_19121_c1 3300050507 Unclassified 4852
356 nmdc:mga05p37_26188_c1 3300050507 Bacteria 3444
357 nmdc:mga05p37_387318_c1 3300050507 Bacteria 1636
358 nmdc:mga05p37_500069_c1 3300050507 Bacteria 1395
359 nmdc:mga05p37_644200_c1 3300050507 Bacteria 1188
360 nmdc:mga09592_161841_c1 3300050508 Bacteria 1934
361 nmdc:mga09592_35254_c1 3300050508 Bacteria 4187
362 nmdc:mga09592_427476_c1 3300050508 Bacteria 1144
363 nmdc:mga09592_440399_c1 3300050508 Bacteria 1125
364 nmdc:mga09592_481660_c1 3300050508 Bacteria 1069
365 nmdc:mga0qj67_143549_c1 3300050509 Bacteria 1936
366 nmdc:mga0qj67_22045_c1 3300050509 Bacteria 4889
367 nmdc:mga0qj67_395877_c1 3300050509 Unclassified 1115
368 nmdc:mga0qj67_87630_c1 3300050509 Bacteria 2499
369 nmdc:mga06r32_144242_c1 3300050510 Bacteria 2358
370 nmdc:mga06r32_190490_c1 3300050510 Unclassified 2039
371 nmdc:mga06r32_196945_c1 3300050510 Bacteria 2002
372 nmdc:mga06r32_3462_c1 3300050510 Bacteria 14093
373 nmdc:mga06r32_43763_c1 3300050510 Bacteria 4261
374 nmdc:mga06r32_641584_c1 3300050510 Bacteria 1031
375 nmdc:mga08y16_201474_c1 3300050511 Bacteria 2063
376 nmdc:mga08y16_75458_c1 3300050511 Bacteria 3515
377 nmdc:mga0n895_2931_c1 3300050512 Bacteria 13536
378 nmdc:mga0n895_53891_c1 3300050512 Bacteria 3954
379 nmdc:mga0n895_79464_c1 3300050512 Bacteria 3266
380 nmdc:mga0n895_825725_c1 3300050512 Bacteria 916
381 nmdc:mga0rr50_146182_c1 3300050513 Bacteria 1906
382 nmdc:mga0rr50_34783_c1 3300050513 Bacteria 3611
383 nmdc:mga0rr50_686_c1 3300050513 Bacteria 18072
384 nmdc:mga08x19_1991_c1 3300050514 Bacteria 12508
385 nmdc:mga0a205_25518_c1 3300050515 Bacteria 5631
386 nmdc:mga0sz30_39734_c1 3300050516 Bacteria 1975
387 Ga0500646_0133998 3300053090 Bacteria 808
388 Ga0500651_0142106 3300053093 Bacteria 1446
389 Ga0500554_025744 3300053102 Bacteria 1682
390 Ga0500562_015156 3300053108 Bacteria 1977
391 Ga0500595_028134 3300053119 Bacteria 1919
392 Ga0500658_0024341 3300053134 Bacteria 2319
393 Ga0500577_0282723 3300053142 Bacteria 723
394 Ga0500604_0063752 3300053151 Bacteria 1163
395 Ga0500622_0067964 3300053156 Bacteria 1806
396 Ga0500633_0094187 3300053160 Bacteria 1097
397 Ga0500638_099748 3300053162 Bacteria 1356
398 Ga0500637_0006651 3300053178 Bacteria 5714
399 Ga0500611_130145 3300053727 Bacteria 677
400 Ga0500661_000394 3300055283 Bacteria 8075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10051883 Ga0081455_100518832 168
2 3300005331 Ga0070670_100827772 Ga0070670_1008277722 179
3 3300014325 Ga0163163_11294294 Ga0163163_112942942 179
4 3300050507 nmdc:mga05p37_644200_c1 nmdc:mga05p37_644200_c1_13_552 179
5 3300050516 nmdc:mga0sz30_39734_c1 nmdc:mga0sz30_39734_c1_13_558 181
6 3300014968 Ga0157379_10095926 Ga0157379_100959261 184
7 3300006038 Ga0075365_10051632 Ga0075365_100516323 190
8 3300006042 Ga0075368_10010566 Ga0075368_100105662 190
9 3300006048 Ga0075363_100033296 Ga0075363_1000332962 190
10 3300006051 Ga0075364_10012966 Ga0075364_100129663 190
11 3300006178 Ga0075367_10012467 Ga0075367_100124674 190
12 3300025972 Ga0207668_11036833 Ga0207668_110368331 190
13 3300027866 Ga0209813_10012935 Ga0209813_100129352 190
14 3300028380 Ga0268265_10392587 Ga0268265_103925872 190
15 3300046457 Ga0495590_0108938 Ga0495590_0108938_121_723 190
16 3300050490 nmdc:mga03n38_7228_c1 nmdc:mga03n38_7228_c1_768_1370 190
17 3300050492 nmdc:mga0yw44_56908_c1 nmdc:mga0yw44_56908_c1_1604_2206 190
18 3300050494 nmdc:mga06z11_2320_c1 nmdc:mga06z11_2320_c1_3786_4388 190
19 3300050495 nmdc:mga04h51_5728_c1 nmdc:mga04h51_5728_c1_1223_1825 190
20 iso_pu_bacteria 8006964411 8006966601 194
21 iso_pu_bacteria 2524023228 2524536114 196
22 iso_pu_bacteria 2721755755 2723842999 196
23 iso_pu_bacteria 2904699407 2904705284 196
24 3300006852 Ga0075433_10003568 Ga0075433_1000356813 197
25 3300006871 Ga0075434_100001043 Ga0075434_1000010434 197
26 3300006914 Ga0075436_100002029 Ga0075436_1000020293 197
27 3300007076 Ga0075435_100007289 Ga0075435_1000072893 197
28 3300009147 Ga0114129_10040798 Ga0114129_100407987 197
29 3300050507 nmdc:mga05p37_19121_c1 nmdc:mga05p37_19121_c1_1599_2192 197
30 3300050512 nmdc:mga0n895_2931_c1 nmdc:mga0n895_2931_c1_575_1168 197
31 3300050513 nmdc:mga0rr50_686_c1 nmdc:mga0rr50_686_c1_13678_14271 197
32 3300050514 nmdc:mga08x19_1991_c1 nmdc:mga08x19_1991_c1_10181_10774 197
33 3300050515 nmdc:mga0a205_25518_c1 nmdc:mga0a205_25518_c1_575_1168 197
34 3300005335 Ga0070666_10503028 Ga0070666_105030281 198
35 3300005347 Ga0070668_100568070 Ga0070668_1005680702 198
36 3300005434 Ga0070709_10035292 Ga0070709_100352922 198
37 3300005436 Ga0070713_100024131 Ga0070713_1000241312 198
38 3300005437 Ga0070710_10030923 Ga0070710_100309232 198
39 3300005441 Ga0070700_100010532 Ga0070700_1000105323 198
40 3300005444 Ga0070694_100068723 Ga0070694_1000687232 198
41 3300005545 Ga0070695_100001032 Ga0070695_10000103215 198
42 3300005548 Ga0070665_100186956 Ga0070665_1001869562 198
43 3300005549 Ga0070704_100330976 Ga0070704_1003309762 198
44 3300006028 Ga0070717_10463805 Ga0070717_104638052 198
45 3300006028 Ga0070717_10650623 Ga0070717_106506231 198
46 3300006051 Ga0075364_10488046 Ga0075364_104880461 198
47 3300006353 Ga0075370_10399734 Ga0075370_103997342 198
48 3300006844 Ga0075428_100312068 Ga0075428_1003120681 198
49 3300006844 Ga0075428_101024210 Ga0075428_1010242101 198
50 3300006846 Ga0075430_100631492 Ga0075430_1006314921 198
51 3300006847 Ga0075431_100283808 Ga0075431_1002838081 198
52 3300006880 Ga0075429_100526926 Ga0075429_1005269262 198
53 3300009094 Ga0111539_10273992 Ga0111539_102739922 198
54 3300025898 Ga0207692_10114167 Ga0207692_101141672 198
55 3300025906 Ga0207699_10081686 Ga0207699_100816862 198
56 3300025915 Ga0207693_10043771 Ga0207693_100437714 198
57 3300025928 Ga0207700_10383707 Ga0207700_103837072 198
58 3300025934 Ga0207686_10067849 Ga0207686_100678492 198
59 3300025938 Ga0207704_10646022 Ga0207704_106460222 198
60 3300026075 Ga0207708_10006892 Ga0207708_100068926 198
61 3300028379 Ga0268266_10270616 Ga0268266_102706162 198
62 3300031731 Ga0307405_10611569 Ga0307405_106115692 198
63 3300032002 Ga0307416_101165364 Ga0307416_1011653642 198
64 3300039437 Ga0436365_0330738 Ga0436365_0330738_1711_2307 198
65 3300047320 Ga0495672_0024276 Ga0495672_0024276_1460_2056 198
66 3300048924 Ga0496121_0372150 Ga0496121_0372150_67_663 198
67 3300050490 nmdc:mga03n38_85509_c1 nmdc:mga03n38_85509_c1_705_1301 198
68 3300050507 nmdc:mga05p37_387318_c1 nmdc:mga05p37_387318_c1_879_1475 198
69 3300050508 nmdc:mga09592_440399_c1 nmdc:mga09592_440399_c1_449_1045 198
70 3300050509 nmdc:mga0qj67_143549_c1 nmdc:mga0qj67_143549_c1_1323_1919 198
71 3300050510 nmdc:mga06r32_190490_c1 nmdc:mga06r32_190490_c1_1069_1665 198
72 3300005338 Ga0068868_100134184 Ga0068868_1001341843 199
73 3300005339 Ga0070660_100594320 Ga0070660_1005943201 199
74 3300005343 Ga0070687_100100957 Ga0070687_1001009572 199
75 3300005354 Ga0070675_100373312 Ga0070675_1003733122 199
76 3300005356 Ga0070674_100103987 Ga0070674_1001039872 199
77 3300005364 Ga0070673_100141283 Ga0070673_1001412833 199
78 3300005438 Ga0070701_10097564 Ga0070701_100975642 199
79 3300005455 Ga0070663_100020620 Ga0070663_1000206202 199
80 3300005456 Ga0070678_100033889 Ga0070678_1000338893 199
81 3300005456 Ga0070678_100097328 Ga0070678_1000973282 199
82 3300005457 Ga0070662_100065510 Ga0070662_1000655102 199
83 3300005457 Ga0070662_100689110 Ga0070662_1006891102 199
84 3300005543 Ga0070672_100020162 Ga0070672_1000201625 199
85 3300005544 Ga0070686_100141722 Ga0070686_1001417222 199
86 3300005548 Ga0070665_100088456 Ga0070665_1000884562 199
87 3300005548 Ga0070665_100272392 Ga0070665_1002723922 199
88 3300005578 Ga0068854_100267925 Ga0068854_1002679251 199
89 3300005615 Ga0070702_100196110 Ga0070702_1001961102 199
90 3300005718 Ga0068866_10060681 Ga0068866_100606812 199
91 3300005719 Ga0068861_100068243 Ga0068861_1000682434 199
92 3300005843 Ga0068860_100182455 Ga0068860_1001824552 199
93 3300005844 Ga0068862_100108432 Ga0068862_1001084322 199
94 3300006038 Ga0075365_10108871 Ga0075365_101088712 199
95 3300006881 Ga0068865_100011760 Ga0068865_1000117603 199
96 3300006881 Ga0068865_100044009 Ga0068865_1000440092 199
97 3300007788 Ga0099795_10060140 Ga0099795_100601402 199
98 3300009098 Ga0105245_10060936 Ga0105245_100609362 199
99 3300009098 Ga0105245_11298078 Ga0105245_112980781 199
100 3300009101 Ga0105247_10280982 Ga0105247_102809822 199
101 3300009174 Ga0105241_10713740 Ga0105241_107137402 199
102 3300009177 Ga0105248_11371149 Ga0105248_113711491 199
103 3300009553 Ga0105249_10075871 Ga0105249_100758711 199
104 3300009553 Ga0105249_10681157 Ga0105249_106811572 199
105 3300010159 Ga0099796_10005305 Ga0099796_100053052 199
106 3300010375 Ga0105239_10428705 Ga0105239_104287052 199
107 3300013296 Ga0157374_10345598 Ga0157374_103455982 199
108 3300013297 Ga0157378_10105367 Ga0157378_101053673 199
109 3300013308 Ga0157375_10184361 Ga0157375_101843612 199
110 3300014326 Ga0157380_10112975 Ga0157380_101129753 199
111 3300014968 Ga0157379_10323733 Ga0157379_103237332 199
112 3300017792 Ga0163161_10030309 Ga0163161_100303093 199
113 3300025315 Ga0207697_10040989 Ga0207697_100409892 199
114 3300025901 Ga0207688_10115458 Ga0207688_101154582 199
115 3300025907 Ga0207645_10158828 Ga0207645_101588282 199
116 3300025918 Ga0207662_10062370 Ga0207662_100623704 199
117 3300025919 Ga0207657_10503014 Ga0207657_105030142 199
118 3300025926 Ga0207659_10322003 Ga0207659_103220032 199
119 3300025932 Ga0207690_10881984 Ga0207690_108819841 199
120 3300025933 Ga0207706_10062138 Ga0207706_100621382 199
121 3300025936 Ga0207670_10429061 Ga0207670_104290612 199
122 3300025937 Ga0207669_10288151 Ga0207669_102881512 199
123 3300025940 Ga0207691_10015630 Ga0207691_100156307 199
124 3300025960 Ga0207651_10540401 Ga0207651_105404012 199
125 3300025961 Ga0207712_10057435 Ga0207712_100574352 199
126 3300025972 Ga0207668_10186960 Ga0207668_101869602 199
127 3300025981 Ga0207640_10158632 Ga0207640_101586322 199
128 3300026023 Ga0207677_10107923 Ga0207677_101079232 199
129 3300026067 Ga0207678_10033787 Ga0207678_100337876 199
130 3300026075 Ga0207708_10039305 Ga0207708_100393052 199
131 3300026118 Ga0207675_100013227 Ga0207675_1000132275 199
132 3300028379 Ga0268266_10287529 Ga0268266_102875291 199
133 3300028379 Ga0268266_10338200 Ga0268266_103382002 199
134 3300028381 Ga0268264_10161540 Ga0268264_101615402 199
135 3300028786 Ga0307517_10000512 Ga0307517_1000051257 199
136 3300035695 Ga0373927_0060052 Ga0373927_0060052_1770_2369 199
137 3300039450 Ga0436363_0730905 Ga0436363_0730905_80_685 199
138 3300046615 Ga0495656_0007730 Ga0495656_0007730_1659_2288 199
139 3300046660 Ga0495625_0174060 Ga0495625_0174060_93_692 199
140 3300046684 Ga0495669_0004541 Ga0495669_0004541_615_1244 199
141 3300046794 Ga0495589_0214206 Ga0495589_0214206_42_671 199
142 3300047445 Ga0495677_0015036 Ga0495677_0015036_1358_1987 199
143 3300048904 Ga0496101_0062531 Ga0496101_0062531_1826_2455 199
144 3300048910 Ga0496107_0371805 Ga0496107_0371805_381_980 199
145 3300048911 Ga0496108_0617563 Ga0496108_0617563_24_623 199
146 3300048917 Ga0496114_0367071 Ga0496114_0367071_665_1264 199
147 3300048918 Ga0496115_0340037 Ga0496115_0340037_470_1069 199
148 3300048929 Ga0496126_0113436 Ga0496126_0113436_1692_2312 199
149 3300053727 Ga0500611_130145 Ga0500611_130145_38_637 199
150 3300005328 Ga0070676_10306089 Ga0070676_103060892 200
151 3300005328 Ga0070676_10475899 Ga0070676_104758991 200
152 3300005330 Ga0070690_100250499 Ga0070690_1002504992 200
153 3300005334 Ga0068869_100015386 Ga0068869_1000153863 200
154 3300005335 Ga0070666_10256694 Ga0070666_102566941 200
155 3300005336 Ga0070680_100017485 Ga0070680_1000174853 200
156 3300005337 Ga0070682_100202008 Ga0070682_1002020082 200
157 3300005338 Ga0068868_100235306 Ga0068868_1002353062 200
158 3300005343 Ga0070687_100127401 Ga0070687_1001274012 200
159 3300005344 Ga0070661_100114293 Ga0070661_1001142933 200
160 3300005347 Ga0070668_100051730 Ga0070668_1000517303 200
161 3300005355 Ga0070671_100284761 Ga0070671_1002847611 200
162 3300005367 Ga0070667_100317846 Ga0070667_1003178462 200
163 3300005438 Ga0070701_10049807 Ga0070701_100498073 200
164 3300005444 Ga0070694_100299008 Ga0070694_1002990082 200
165 3300005455 Ga0070663_100016039 Ga0070663_1000160392 200
166 3300005455 Ga0070663_100054862 Ga0070663_1000548622 200
167 3300005457 Ga0070662_100028359 Ga0070662_1000283595 200
168 3300005466 Ga0070685_10203297 Ga0070685_102032972 200
169 3300005467 Ga0070706_100380712 Ga0070706_1003807122 200
170 3300005467 Ga0070706_100953605 Ga0070706_1009536051 200
171 3300005471 Ga0070698_100173040 Ga0070698_1001730403 200
172 3300005518 Ga0070699_100148429 Ga0070699_1001484292 200
173 3300005518 Ga0070699_100567010 Ga0070699_1005670102 200
174 3300005530 Ga0070679_100063187 Ga0070679_1000631873 200
175 3300005546 Ga0070696_100383005 Ga0070696_1003830051 200
176 3300005547 Ga0070693_100073360 Ga0070693_1000733603 200
177 3300005548 Ga0070665_100315478 Ga0070665_1003154781 200
178 3300005548 Ga0070665_100444123 Ga0070665_1004441232 200
179 3300005563 Ga0068855_100071280 Ga0068855_1000712802 200
180 3300005564 Ga0070664_100076494 Ga0070664_1000764942 200
181 3300005614 Ga0068856_100380574 Ga0068856_1003805742 200
182 3300005615 Ga0070702_100512651 Ga0070702_1005126511 200
183 3300005617 Ga0068859_100185911 Ga0068859_1001859113 200
184 3300005617 Ga0068859_100533439 Ga0068859_1005334392 200
185 3300005718 Ga0068866_10147656 Ga0068866_101476562 200
186 3300005719 Ga0068861_100461346 Ga0068861_1004613462 200
187 3300005719 Ga0068861_100644266 Ga0068861_1006442662 200
188 3300005841 Ga0068863_100339339 Ga0068863_1003393392 200
189 3300005841 Ga0068863_100461257 Ga0068863_1004612572 200
190 3300005842 Ga0068858_100273015 Ga0068858_1002730153 200
191 3300005842 Ga0068858_100804918 Ga0068858_1008049182 200
192 3300005843 Ga0068860_100162839 Ga0068860_1001628393 200
193 3300005844 Ga0068862_100081669 Ga0068862_1000816692 200
194 3300005844 Ga0068862_100629635 Ga0068862_1006296352 200
195 3300005937 Ga0081455_10015442 Ga0081455_100154423 200
196 3300005983 Ga0081540_1000713 Ga0081540_10007139 200
197 3300005983 Ga0081540_1022639 Ga0081540_10226392 200
198 3300005983 Ga0081540_1056492 Ga0081540_10564922 200
199 3300005983 Ga0081540_1129899 Ga0081540_11298992 200
200 3300006028 Ga0070717_10137450 Ga0070717_101374503 200
201 3300006042 Ga0075368_10008552 Ga0075368_100085526 200
202 3300006042 Ga0075368_10102719 Ga0075368_101027192 200
203 3300006048 Ga0075363_100013043 Ga0075363_1000130432 200
204 3300006048 Ga0075363_100042391 Ga0075363_1000423914 200
205 3300006186 Ga0075369_10026660 Ga0075369_100266604 200
206 3300006237 Ga0097621_100703157 Ga0097621_1007031571 200
207 3300006353 Ga0075370_10128081 Ga0075370_101280812 200
208 3300006353 Ga0075370_10194635 Ga0075370_101946352 200
209 3300006358 Ga0068871_100055003 Ga0068871_1000550033 200
210 3300006844 Ga0075428_100098860 Ga0075428_1000988603 200
211 3300006844 Ga0075428_100158916 Ga0075428_1001589163 200
212 3300006844 Ga0075428_100211961 Ga0075428_1002119613 200
213 3300006844 Ga0075428_100343112 Ga0075428_1003431123 200
214 3300006844 Ga0075428_101021580 Ga0075428_1010215802 200
215 3300006844 Ga0075428_101147414 Ga0075428_1011474141 200
216 3300006846 Ga0075430_100097306 Ga0075430_1000973063 200
217 3300006846 Ga0075430_100302255 Ga0075430_1003022552 200
218 3300006847 Ga0075431_100063214 Ga0075431_1000632145 200
219 3300006847 Ga0075431_100200407 Ga0075431_1002004072 200
220 3300006847 Ga0075431_100359934 Ga0075431_1003599342 200
221 3300006871 Ga0075434_100140591 Ga0075434_1001405912 200
222 3300006880 Ga0075429_100197838 Ga0075429_1001978382 200
223 3300006880 Ga0075429_100323094 Ga0075429_1003230942 200
224 3300006931 Ga0097620_100185915 Ga0097620_1001859152 200
225 3300006931 Ga0097620_100533436 Ga0097620_1005334362 200
226 3300009094 Ga0111539_10002363 Ga0111539_1000236323 200
227 3300009094 Ga0111539_10123801 Ga0111539_101238013 200
228 3300009098 Ga0105245_10125829 Ga0105245_101258292 200
229 3300009098 Ga0105245_10702190 Ga0105245_107021902 200
230 3300009101 Ga0105247_10246247 Ga0105247_102462472 200
231 3300009101 Ga0105247_10247405 Ga0105247_102474052 200
232 3300009147 Ga0114129_10026035 Ga0114129_100260354 200
233 3300009147 Ga0114129_10333708 Ga0114129_103337081 200
234 3300009147 Ga0114129_10353077 Ga0114129_103530772 200
235 3300009147 Ga0114129_10658199 Ga0114129_106581992 200
236 3300009148 Ga0105243_10361828 Ga0105243_103618282 200
237 3300009148 Ga0105243_10398413 Ga0105243_103984132 200
238 3300009174 Ga0105241_10030519 Ga0105241_100305192 200
239 3300009176 Ga0105242_10310333 Ga0105242_103103332 200
240 3300009177 Ga0105248_10020941 Ga0105248_100209417 200
241 3300009177 Ga0105248_10221499 Ga0105248_102214993 200
242 3300009545 Ga0105237_10019705 Ga0105237_100197057 200
243 3300009551 Ga0105238_10114953 Ga0105238_101149532 200
244 3300009551 Ga0105238_10353230 Ga0105238_103532302 200
245 3300009551 Ga0105238_10418337 Ga0105238_104183372 200
246 3300009553 Ga0105249_10596793 Ga0105249_105967932 200
247 3300010375 Ga0105239_10062216 Ga0105239_100622163 200
248 3300010375 Ga0105239_10873151 Ga0105239_108731512 200
249 3300011119 Ga0105246_10041887 Ga0105246_100418872 200
250 3300013296 Ga0157374_10140813 Ga0157374_101408132 200
251 3300013297 Ga0157378_10365210 Ga0157378_103652102 200
252 3300013306 Ga0163162_10347541 Ga0163162_103475412 200
253 3300013306 Ga0163162_10627421 Ga0163162_106274212 200
254 3300013306 Ga0163162_10826092 Ga0163162_108260922 200
255 3300013308 Ga0157375_10204648 Ga0157375_102046483 200
256 3300013308 Ga0157375_10475051 Ga0157375_104750512 200
257 3300014325 Ga0163163_10092516 Ga0163163_100925162 200
258 3300014326 Ga0157380_10256226 Ga0157380_102562262 200
259 3300014326 Ga0157380_10335263 Ga0157380_103352632 200
260 3300014326 Ga0157380_11061078 Ga0157380_110610781 200
261 3300014745 Ga0157377_10148654 Ga0157377_101486542 200
262 3300014968 Ga0157379_10214402 Ga0157379_102144022 200
263 3300014969 Ga0157376_10090478 Ga0157376_100904782 200
264 3300014969 Ga0157376_10360576 Ga0157376_103605762 200
265 3300017792 Ga0163161_10364777 Ga0163161_103647772 200
266 3300025900 Ga0207710_10077151 Ga0207710_100771512 200
267 3300025900 Ga0207710_10149794 Ga0207710_101497942 200
268 3300025901 Ga0207688_10028535 Ga0207688_100285352 200
269 3300025903 Ga0207680_10038138 Ga0207680_100381383 200
270 3300025907 Ga0207645_10056131 Ga0207645_100561312 200
271 3300025910 Ga0207684_10290874 Ga0207684_102908742 200
272 3300025911 Ga0207654_10003362 Ga0207654_100033625 200
273 3300025911 Ga0207654_10492565 Ga0207654_104925651 200
274 3300025912 Ga0207707_10001378 Ga0207707_100013789 200
275 3300025914 Ga0207671_10039950 Ga0207671_100399502 200
276 3300025918 Ga0207662_10420413 Ga0207662_104204132 200
277 3300025920 Ga0207649_10075642 Ga0207649_100756422 200
278 3300025923 Ga0207681_10169112 Ga0207681_101691122 200
279 3300025923 Ga0207681_10339254 Ga0207681_103392542 200
280 3300025927 Ga0207687_10039524 Ga0207687_100395243 200
281 3300025931 Ga0207644_10347202 Ga0207644_103472022 200
282 3300025933 Ga0207706_10057068 Ga0207706_100570683 200
283 3300025934 Ga0207686_10425437 Ga0207686_104254372 200
284 3300025939 Ga0207665_10727509 Ga0207665_107275092 200
285 3300025941 Ga0207711_10028374 Ga0207711_100283747 200
286 3300025942 Ga0207689_10051803 Ga0207689_100518033 200
287 3300025942 Ga0207689_10057897 Ga0207689_100578973 200
288 3300025961 Ga0207712_10403798 Ga0207712_104037982 200
289 3300025972 Ga0207668_10024244 Ga0207668_100242442 200
290 3300025986 Ga0207658_10402721 Ga0207658_104027212 200
291 3300026023 Ga0207677_10069432 Ga0207677_100694322 200
292 3300026023 Ga0207677_10291676 Ga0207677_102916761 200
293 3300026035 Ga0207703_10091782 Ga0207703_100917822 200
294 3300026067 Ga0207678_10044199 Ga0207678_100441996 200
295 3300026067 Ga0207678_10093017 Ga0207678_100930171 200
296 3300026078 Ga0207702_10506991 Ga0207702_105069912 200
297 3300026088 Ga0207641_10125964 Ga0207641_101259642 200
298 3300026088 Ga0207641_10658472 Ga0207641_106584722 200
299 3300026116 Ga0207674_10043409 Ga0207674_100434092 200
300 3300026118 Ga0207675_100107125 Ga0207675_1001071252 200
301 3300026121 Ga0207683_10151856 Ga0207683_101518563 200
302 3300026142 Ga0207698_10868826 Ga0207698_108688262 200
303 3300027866 Ga0209813_10065271 Ga0209813_100652712 200
304 3300027866 Ga0209813_10085111 Ga0209813_100851112 200
305 3300027907 Ga0207428_10012592 Ga0207428_100125925 200
306 3300027907 Ga0207428_10217856 Ga0207428_102178562 200
307 3300028379 Ga0268266_10059047 Ga0268266_100590473 200
308 3300032002 Ga0307416_100436758 Ga0307416_1004367582 200
309 3300032126 Ga0307415_100122475 Ga0307415_1001224752 200
310 3300035089 Ga0373944_0072566 Ga0373944_0072566_259_870 200
311 3300035692 Ga0373935_0444262 Ga0373935_0444262_14_625 200
312 3300035695 Ga0373927_0122719 Ga0373927_0122719_389_991 200
313 3300046460 Ga0495638_0113557 Ga0495638_0113557_273_896 200
314 3300046474 Ga0495605_0071388 Ga0495605_0071388_875_1498 200
315 3300046491 Ga0495584_0059025 Ga0495584_0059025_1180_1803 200
316 3300046491 Ga0495584_0122480 Ga0495584_0122480_219_821 200
317 3300046492 Ga0495585_0305143 Ga0495585_0305143_144_746 200
318 3300046500 Ga0495596_0116180 Ga0495596_0116180_380_1003 200
319 3300046506 Ga0495583_0090714 Ga0495583_0090714_120_743 200
320 3300046512 Ga0495610_0046520 Ga0495610_0046520_1118_1741 200
321 3300046519 Ga0495632_0071536 Ga0495632_0071536_175_798 200
322 3300046542 Ga0495597_0270576 Ga0495597_0270576_26_649 200
323 3300046615 Ga0495656_0376545 Ga0495656_0376545_38_640 200
324 3300046648 Ga0495611_0062525 Ga0495611_0062525_423_1025 200
325 3300046660 Ga0495625_0184807 Ga0495625_0184807_521_1123 200
326 3300046664 Ga0495659_0221768 Ga0495659_0221768_147_749 200
327 3300046692 Ga0495671_0057935 Ga0495671_0057935_1139_1762 200
328 3300046794 Ga0495589_0137605 Ga0495589_0137605_282_905 200
329 3300047318 Ga0495636_0054221 Ga0495636_0054221_686_1288 200
330 3300047323 Ga0495683_0093531 Ga0495683_0093531_719_1342 200
331 3300048903 Ga0496100_0479858 Ga0496100_0479858_286_909 200
332 3300048905 Ga0496102_0142791 Ga0496102_0142791_894_1496 200
333 3300048905 Ga0496102_0246222 Ga0496102_0246222_1008_1631 200
334 3300048905 Ga0496102_0497518 Ga0496102_0497518_268_870 200
335 3300048906 Ga0496103_0111898 Ga0496103_0111898_393_1013 200
336 3300048907 Ga0496104_0153424 Ga0496104_0153424_347_967 200
337 3300048908 Ga0496105_0350943 Ga0496105_0350943_533_1156 200
338 3300048909 Ga0496106_0050836 Ga0496106_0050836_1558_2181 200
339 3300048909 Ga0496106_0371198 Ga0496106_0371198_453_1073 200
340 3300048909 Ga0496106_0705819 Ga0496106_0705819_145_747 200
341 3300048910 Ga0496107_0339748 Ga0496107_0339748_453_1073 200
342 3300048910 Ga0496107_0480252 Ga0496107_0480252_67_669 200
343 3300048910 Ga0496107_0723478 Ga0496107_0723478_61_690 200
344 3300048911 Ga0496108_0023293 Ga0496108_0023293_2867_3490 200
345 3300048912 Ga0496109_0051360 Ga0496109_0051360_2868_3491 200
346 3300048912 Ga0496109_0549661 Ga0496109_0549661_230_850 200
347 3300048912 Ga0496109_0667845 Ga0496109_0667845_355_957 200
348 3300048913 Ga0496110_0011391 Ga0496110_0011391_527_1129 200
349 3300048913 Ga0496110_0140493 Ga0496110_0140493_323_946 200
350 3300048914 Ga0496111_0095154 Ga0496111_0095154_446_1048 200
351 3300048914 Ga0496111_0185705 Ga0496111_0185705_518_1141 200
352 3300048915 Ga0496112_0020318 Ga0496112_0020318_2600_3223 200
353 3300048916 Ga0496113_0067438 Ga0496113_0067438_1039_1662 200
354 3300048920 Ga0496117_0118108 Ga0496117_0118108_487_1110 200
355 3300048923 Ga0496120_0144584 Ga0496120_0144584_463_1086 200
356 3300048924 Ga0496121_0041096 Ga0496121_0041096_3374_3976 200
357 3300048928 Ga0496125_0303679 Ga0496125_0303679_310_933 200
358 3300049460 Ga0495682_0091220 Ga0495682_0091220_237_860 200
359 3300049589 Ga0501073_0127813 Ga0501073_0127813_290_898 200
360 3300050489 nmdc:mga03683_114905_c1 nmdc:mga03683_114905_c1_380_997 200
361 3300050490 nmdc:mga03n38_24259_c1 nmdc:mga03n38_24259_c1_187_807 200
362 3300050490 nmdc:mga03n38_90086_c1 nmdc:mga03n38_90086_c1_199_801 200
363 3300050491 nmdc:mga00v17_50441_c1 nmdc:mga00v17_50441_c1_1709_2332 200
364 3300050494 nmdc:mga06z11_186752_c1 nmdc:mga06z11_186752_c1_173_793 200
365 3300050494 nmdc:mga06z11_270954_c1 nmdc:mga06z11_270954_c1_22_642 200
366 3300050496 nmdc:mga07m45_19636_c2 nmdc:mga07m45_19636_c2_511_1131 200
367 3300050496 nmdc:mga07m45_358161_c1 nmdc:mga07m45_358161_c1_140_763 200
368 3300050507 nmdc:mga05p37_186431_c1 nmdc:mga05p37_186431_c1_400_1002 200
369 3300050507 nmdc:mga05p37_26188_c1 nmdc:mga05p37_26188_c1_1365_1967 200
370 3300050507 nmdc:mga05p37_500069_c1 nmdc:mga05p37_500069_c1_290_892 200
371 3300050508 nmdc:mga09592_161841_c1 nmdc:mga09592_161841_c1_265_867 200
372 3300050508 nmdc:mga09592_35254_c1 nmdc:mga09592_35254_c1_517_1119 200
373 3300050508 nmdc:mga09592_427476_c1 nmdc:mga09592_427476_c1_381_983 200
374 3300050508 nmdc:mga09592_481660_c1 nmdc:mga09592_481660_c1_131_733 200
375 3300050509 nmdc:mga0qj67_22045_c1 nmdc:mga0qj67_22045_c1_4033_4635 200
376 3300050509 nmdc:mga0qj67_395877_c1 nmdc:mga0qj67_395877_c1_63_683 200
377 3300050509 nmdc:mga0qj67_87630_c1 nmdc:mga0qj67_87630_c1_492_1094 200
378 3300050510 nmdc:mga06r32_144242_c1 nmdc:mga06r32_144242_c1_460_1062 200
379 3300050510 nmdc:mga06r32_196945_c1 nmdc:mga06r32_196945_c1_1025_1627 200
380 3300050510 nmdc:mga06r32_3462_c1 nmdc:mga06r32_3462_c1_12781_13383 200
381 3300050510 nmdc:mga06r32_43763_c1 nmdc:mga06r32_43763_c1_2891_3493 200
382 3300050510 nmdc:mga06r32_641584_c1 nmdc:mga06r32_641584_c1_161_763 200
383 3300050511 nmdc:mga08y16_201474_c1 nmdc:mga08y16_201474_c1_292_894 200
384 3300050511 nmdc:mga08y16_75458_c1 nmdc:mga08y16_75458_c1_2493_3095 200
385 3300050512 nmdc:mga0n895_53891_c1 nmdc:mga0n895_53891_c1_3319_3921 200
386 3300050512 nmdc:mga0n895_79464_c1 nmdc:mga0n895_79464_c1_2349_2972 200
387 3300050512 nmdc:mga0n895_825725_c1 nmdc:mga0n895_825725_c1_224_826 200
388 3300050513 nmdc:mga0rr50_146182_c1 nmdc:mga0rr50_146182_c1_1292_1894 200
389 3300050513 nmdc:mga0rr50_34783_c1 nmdc:mga0rr50_34783_c1_2287_2889 200
390 3300053090 Ga0500646_0133998 Ga0500646_0133998_31_654 200
391 3300053093 Ga0500651_0142106 Ga0500651_0142106_318_941 200
392 3300053102 Ga0500554_025744 Ga0500554_025744_338_940 200
393 3300053108 Ga0500562_015156 Ga0500562_015156_1118_1741 200
394 3300053119 Ga0500595_028134 Ga0500595_028134_1056_1679 200
395 3300053134 Ga0500658_0024341 Ga0500658_0024341_533_1156 200
396 3300053142 Ga0500577_0282723 Ga0500577_0282723_27_650 200
397 3300053151 Ga0500604_0063752 Ga0500604_0063752_150_773 200
398 3300053156 Ga0500622_0067964 Ga0500622_0067964_132_755 200
399 3300053160 Ga0500633_0094187 Ga0500633_0094187_185_808 200
400 3300053162 Ga0500638_099748 Ga0500638_099748_111_713 200
401 3300053178 Ga0500637_0006651 Ga0500637_0006651_4506_5108 200
402 3300055283 Ga0500661_000394 Ga0500661_000394_3339_3941 200
403 iso_pu_bacteria 2791355199 2793082445 200
404 iso_pu_bacteria 2874604998 2874606346 200
405 iso_pu_bacteria 8006984368 8006989447 200
406 3300003659 JGI25404J52841_10006327 JGI25404J52841_100063272 201
407 3300005983 Ga0081540_1003902 Ga0081540_10039028 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

178

219

0.98

PF07336

ABATE

Putative stress-induced transcription regulator

35

174

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.659 15 198
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6199 15 198
3v3k-assembly2.cif.gz_D human caspase 9 in complex with bacterial effector protein 0.5094 77 150
3v3k-assembly6.cif.gz_L human caspase 9 in complex with bacterial effector protein 0.4396 77 154
6eri-assembly1.cif.gz_AJ structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.3855 114 154
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6575 15 198 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6204 15 198 1.10.3300.10
af_Q0DGE2_312_372_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.5283 103 147 3.40.850.10
af_E9AGV5_260_442_1.25.40.330 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Adenylate cyclase-associated CAP, N-terminal domain 0.4793 35 112 1.25.40.330
af_Q0JJV8_312_372_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.4751 103 147 3.40.850.10
ID Description Score Start End GO Terms
AF-A0A6G6YTX6-F1-model_v4 CGNR zinc finger domain-containing protein 0.9277 18 201
AF-A0A533IZU0-F1-model_v4 deleted 0.9244 1 201
AF-A0A6G6YTX6-F1-model_v4 CGNR zinc finger domain-containing protein 0.9181 18 201
AF-A0A533IZU0-F1-model_v4 deleted 0.9156 1 201
AF-A0A1N6E6P3-F1-model_v4 Conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding 0.904 9 200

Feature Viewer

pLDDT pTM Quality
87.98 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map