F436311

General Info

Members Datasets Scaffolds Average Seq Length
406 214 810 321

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0283376|Ga0496104_0283376_279_1418
Length 379
Sequence MRRREFLTVLGGAAAAWPAGARAQQAAMPVVAFTRSTTFAGAQYLVTAFREGLKETGFVEGRNVLIEFHAADDQVDRLQKLTTELIRRPVSVIVGNTVSALAAKANTAAIPIVFATGSDPIRDGLVASLSRPGGNVTGVIFISGTLSTKRLELLRQFVPKATTIALLVQANSVEAEAERKEVQAAAQSLGAQLITSETSNDQEIDAAFATFVQGGVGALFVGARPFLFARRARVLDLADRHAMPAMYSQRDSVLSGGLMSYSASQPDAYRQSGLYTGRILKGEKPGDLPVIQSTKFELVINLLATADEVFPPALLPAERRALWEAARGAQSGRMKSKMPRHCRVSPSWCFGLPALSRLSLRASAPQLFRYASWRPRAPG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 16.01
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0283376 3300048907 Bacteria 1570
2 JGI24742J22300_10003476 3300002244 Bacteria 2555
3 JGI25404J52841_10006041 3300003659 Bacteria 2519
4 Ga0065707_10029620 3300005295 Bacteria 1413
5 Ga0070658_10021824 3300005327 Bacteria 5132
6 Ga0070683_100036096 3300005329 Bacteria 4521
7 Ga0070690_100030619 3300005330 Bacteria 3346
8 Ga0070690_100124273 3300005330 Bacteria 1735
9 Ga0070670_100022037 3300005331 Bacteria 5482
10 Ga0070670_100058341 3300005331 Bacteria 3314
11 Ga0068869_100035899 3300005334 Bacteria 3517
12 Ga0070666_10235127 3300005335 Bacteria 1295
13 Ga0068868_100004336 3300005338 Bacteria 9945
14 Ga0070660_100008618 3300005339 Bacteria 7138
15 Ga0070689_100006779 3300005340 Bacteria 7966
16 Ga0070691_10105138 3300005341 Bacteria 1406
17 Ga0070687_100144633 3300005343 Unclassified 1388
18 Ga0070687_100190955 3300005343 Unclassified 1234
19 Ga0070668_100010746 3300005347 Bacteria 6806
20 Ga0070671_100052628 3300005355 Bacteria 3385
21 Ga0070674_100003043 3300005356 Bacteria 9325
22 Ga0070673_100025635 3300005364 Bacteria 4344
23 Ga0070673_100221465 3300005364 Bacteria 1638
24 Ga0070688_100205713 3300005365 Bacteria 1379
25 Ga0070667_100040481 3300005367 Bacteria 3908
26 Ga0070667_100306346 3300005367 Bacteria 1431
27 Ga0070709_10017400 3300005434 Bacteria 4122
28 Ga0070709_10224036 3300005434 Unclassified 1342
29 Ga0070714_100056602 3300005435 Bacteria 3354
30 Ga0070713_100083392 3300005436 Bacteria 2732
31 Ga0070710_10044571 3300005437 Bacteria 2461
32 Ga0070710_10062774 3300005437 Bacteria 2120
33 Ga0070710_10080079 3300005437 Bacteria 1905
34 Ga0070710_10214191 3300005437 Bacteria 1222
35 Ga0070701_10173229 3300005438 Bacteria 1258
36 Ga0070711_100086889 3300005439 Bacteria 2244
37 Ga0070711_100097467 3300005439 Bacteria 2132
38 Ga0070711_100254359 3300005439 Bacteria 1379
39 Ga0070700_100006254 3300005441 Bacteria 6353
40 Ga0070700_100081902 3300005441 Bacteria 2086
41 Ga0070708_100237574 3300005445 Bacteria 1711
42 Ga0070708_100476130 3300005445 Bacteria 1178
43 Ga0070663_100024132 3300005455 Bacteria 4087
44 Ga0070663_100240849 3300005455 Bacteria 1428
45 Ga0070678_100002315 3300005456 Bacteria 10400
46 Ga0070678_100070308 3300005456 Bacteria 2616
47 Ga0070662_100117310 3300005457 Bacteria 2036
48 Ga0070681_10182909 3300005458 Bacteria 2017
49 Ga0070681_10190782 3300005458 Bacteria 1969
50 Ga0068867_100003627 3300005459 Bacteria 10857
51 Ga0070685_10009446 3300005466 Bacteria 5040
52 Ga0070706_100011324 3300005467 Bacteria 8287
53 Ga0070706_100017695 3300005467 Bacteria 6577
54 Ga0070706_100141772 3300005467 Bacteria 2243
55 Ga0070706_100328787 3300005467 Bacteria 1425
56 Ga0070707_100102167 3300005468 Bacteria 2778
57 Ga0070698_100021671 3300005471 Bacteria 6727
58 Ga0070698_100025627 3300005471 Bacteria 6145
59 Ga0070698_100093887 3300005471 Bacteria 2979
60 Ga0070698_100330479 3300005471 Bacteria 1455
61 Ga0070699_100006441 3300005518 Bacteria 10224
62 Ga0070699_100018949 3300005518 Bacteria 5918
63 Ga0070699_100064446 3300005518 Bacteria 3178
64 Ga0070684_100027180 3300005535 Bacteria 4827
65 Ga0070684_100506585 3300005535 Bacteria 1118
66 Ga0070697_100058208 3300005536 Bacteria 3145
67 Ga0070697_100270541 3300005536 Bacteria 1456
68 Ga0068853_100064004 3300005539 Bacteria 3187
69 Ga0070672_100070160 3300005543 Bacteria 2784
70 Ga0070686_100003143 3300005544 Bacteria 9041
71 Ga0070686_100046070 3300005544 Bacteria 2749
72 Ga0070696_100439174 3300005546 Bacteria 1028
73 Ga0070665_100024242 3300005548 Bacteria 6109
74 Ga0070665_100362218 3300005548 Bacteria 1456
75 Ga0068855_100612631 3300005563 Bacteria 1173
76 Ga0070702_100021989 3300005615 Bacteria 3365
77 Ga0068852_100499695 3300005616 Bacteria 1211
78 Ga0068859_100036366 3300005617 Bacteria 4944
79 Ga0068859_100261008 3300005617 Bacteria 1824
80 Ga0068859_100689530 3300005617 Bacteria 1112
81 Ga0068866_10002593 3300005718 Bacteria 7463
82 Ga0068861_100006324 3300005719 Bacteria 8060
83 Ga0068861_100045929 3300005719 Bacteria 3291
84 Ga0068851_10017777 3300005834 Bacteria 3421
85 Ga0068870_10000905 3300005840 Bacteria 11608
86 Ga0068870_10105369 3300005840 Bacteria 1601
87 Ga0068863_100021574 3300005841 Bacteria 6143
88 Ga0068863_100387109 3300005841 Bacteria 1366
89 Ga0068858_100009104 3300005842 Bacteria 9493
90 Ga0068858_100102361 3300005842 Bacteria 2672
91 Ga0068858_100188452 3300005842 Unclassified 1949
92 Ga0068860_100007881 3300005843 Bacteria 10634
93 Ga0068860_100312169 3300005843 Bacteria 1542
94 Ga0068862_100006330 3300005844 Bacteria 9842
95 Ga0068862_100166994 3300005844 Bacteria 1968
96 Ga0081455_10022259 3300005937 Bacteria 5927
97 Ga0081455_10057699 3300005937 Bacteria 3289
98 Ga0081455_10057905 3300005937 Bacteria 3282
99 Ga0081455_10067994 3300005937 Bacteria 2967
100 Ga0081455_10077030 3300005937 Bacteria 2745
101 Ga0081455_10084860 3300005937 Bacteria 2584
102 Ga0081455_10107757 3300005937 Bacteria 2221
103 Ga0081455_10110432 3300005937 Unclassified 2186
104 Ga0081455_10113282 3300005937 Bacteria 2151
105 Ga0081455_10129658 3300005937 Bacteria 1974
106 Ga0081538_10065412 3300005981 Bacteria 2047
107 Ga0081540_1000005 3300005983 Bacteria 227052
108 Ga0081540_1042760 3300005983 Bacteria 2333
109 Ga0081540_1045145 3300005983 Bacteria 2242
110 Ga0070717_10013103 3300006028 Bacteria 6337
111 Ga0070717_10030609 3300006028 Bacteria 4323
112 Ga0070717_10148092 3300006028 Bacteria 2029
113 Ga0075365_10048586 3300006038 Bacteria 2793
114 Ga0075365_10088924 3300006038 Bacteria 2102
115 Ga0075365_10092638 3300006038 Bacteria 2060
116 Ga0075364_10115029 3300006051 Bacteria 1798
117 Ga0070712_100006669 3300006175 Bacteria 7178
118 Ga0070712_100257632 3300006175 Bacteria 1397
119 Ga0070712_100272059 3300006175 Unclassified 1361
120 Ga0070712_100287942 3300006175 Bacteria 1325
121 Ga0070712_100331268 3300006175 Bacteria 1240
122 Ga0070712_100337561 3300006175 Bacteria 1229
123 Ga0075366_10055385 3300006195 Bacteria 2355
124 Ga0097621_100027569 3300006237 Bacteria 4469
125 Ga0075428_100020239 3300006844 Bacteria 7369
126 Ga0075428_100131190 3300006844 Bacteria 2726
127 Ga0075428_100213758 3300006844 Bacteria 2083
128 Ga0075428_100527056 3300006844 Bacteria 1263
129 Ga0075430_100052275 3300006846 Bacteria 3441
130 Ga0075430_100115009 3300006846 Bacteria 2241
131 Ga0075431_100059560 3300006847 Bacteria 3940
132 Ga0075431_100132142 3300006847 Bacteria 2574
133 Ga0075431_100141308 3300006847 Bacteria 2481
134 Ga0075431_100295842 3300006847 Bacteria 1636
135 Ga0075429_100203772 3300006880 Bacteria 1733
136 Ga0097620_100036366 3300006931 Bacteria 4944
137 Ga0097620_100261008 3300006931 Bacteria 1824
138 Ga0097620_100689567 3300006931 Bacteria 1112
139 Ga0105240_10020085 3300009093 Bacteria 8918
140 Ga0105245_10004865 3300009098 Bacteria 11827
141 Ga0105245_10056185 3300009098 Bacteria 3537
142 Ga0105245_10144022 3300009098 Bacteria 2247
143 Ga0105247_10004614 3300009101 Bacteria 8785
144 Ga0114129_10020668 3300009147 Bacteria 9359
145 Ga0114129_10362880 3300009147 Bacteria 1916
146 Ga0105243_10001839 3300009148 Bacteria 18151
147 Ga0105241_10243877 3300009174 Bacteria 1520
148 Ga0105242_10011147 3300009176 Bacteria 6908
149 Ga0105242_10221834 3300009176 Bacteria 1690
150 Ga0105248_10008067 3300009177 Bacteria 11558
151 Ga0105248_10019613 3300009177 Bacteria 7484
152 Ga0105248_10029383 3300009177 Bacteria 6131
153 Ga0105248_10051800 3300009177 Bacteria 4606
154 Ga0105248_10670988 3300009177 Unclassified 1169
155 Ga0105237_10002809 3300009545 Bacteria 21147
156 Ga0105238_10000767 3300009551 Bacteria 33436
157 Ga0105238_10219807 3300009551 Bacteria 1876
158 Ga0105249_10222743 3300009553 Bacteria 1857
159 Ga0105249_10314929 3300009553 Bacteria 1574
160 Ga0105239_10003524 3300010375 Bacteria 19165
161 Ga0105239_10020546 3300010375 Bacteria 7284
162 Ga0105246_10001905 3300011119 Bacteria 12566
163 Ga0105246_10102255 3300011119 Bacteria 2089
164 Ga0157370_10040407 3300013104 Bacteria 4503
165 Ga0157369_10017545 3300013105 Bacteria 8044
166 Ga0157374_10016109 3300013296 Bacteria 6568
167 Ga0157378_10481344 3300013297 Unclassified 1237
168 Ga0163162_10025087 3300013306 Bacteria 5892
169 Ga0163162_10175142 3300013306 Bacteria 2270
170 Ga0157375_10001511 3300013308 Bacteria 19994
171 Ga0163163_10006830 3300014325 Bacteria 10013
172 Ga0163163_10072450 3300014325 Bacteria 3434
173 Ga0163163_10290795 3300014325 Bacteria 1686
174 Ga0157380_10197776 3300014326 Bacteria 1781
175 Ga0157380_10219970 3300014326 Bacteria 1698
176 Ga0157377_10009278 3300014745 Bacteria 4820
177 Ga0157379_10006607 3300014968 Bacteria 10005
178 Ga0157379_10091875 3300014968 Bacteria 2723
179 Ga0157376_10016293 3300014969 Bacteria 5638
180 Ga0157376_10297431 3300014969 Bacteria 1526
181 Ga0163161_10006087 3300017792 Bacteria 8357
182 Ga0163161_10070938 3300017792 Bacteria 2548
183 Ga0224572_1003653 3300024225 Bacteria 2615
184 Ga0207697_10017393 3300025315 Bacteria 2955
185 Ga0207656_10021278 3300025321 Bacteria 2590
186 Ga0207692_10183014 3300025898 Bacteria 1222
187 Ga0207710_10010002 3300025900 Bacteria 3990
188 Ga0207688_10005611 3300025901 Bacteria 6822
189 Ga0207680_10192654 3300025903 Bacteria 1385
190 Ga0207647_10015368 3300025904 Bacteria 5249
191 Ga0207685_10119361 3300025905 Bacteria 1155
192 Ga0207699_10125322 3300025906 Bacteria 1667
193 Ga0207643_10004103 3300025908 Bacteria 7841
194 Ga0207684_10005715 3300025910 Bacteria 11425
195 Ga0207684_10012347 3300025910 Bacteria 7433
196 Ga0207684_10050122 3300025910 Bacteria 3542
197 Ga0207684_10309678 3300025910 Bacteria 1361
198 Ga0207707_10000990 3300025912 Bacteria 27321
199 Ga0207695_10018591 3300025913 Bacteria 8028
200 Ga0207693_10007902 3300025915 Bacteria 8736
201 Ga0207693_10047953 3300025915 Bacteria 3355
202 Ga0207693_10104642 3300025915 Bacteria 2219
203 Ga0207693_10185750 3300025915 Bacteria 1636
204 Ga0207693_10187821 3300025915 Bacteria 1626
205 Ga0207693_10293624 3300025915 Bacteria 1274
206 Ga0207663_10033366 3300025916 Bacteria 3066
207 Ga0207663_10069767 3300025916 Bacteria 2262
208 Ga0207663_10344272 3300025916 Bacteria 1127
209 Ga0207662_10129925 3300025918 Bacteria 1587
210 Ga0207657_10008798 3300025919 Bacteria 10213
211 Ga0207681_10074235 3300025923 Bacteria 2382
212 Ga0207650_10003653 3300025925 Bacteria 10526
213 Ga0207650_10041243 3300025925 Bacteria 3381
214 Ga0207687_10002430 3300025927 Bacteria 12648
215 Ga0207687_10031661 3300025927 Bacteria 3576
216 Ga0207664_10135169 3300025929 Bacteria 2080
217 Ga0207690_10034552 3300025932 Bacteria 3258
218 Ga0207706_10124520 3300025933 Bacteria 2268
219 Ga0207686_10068818 3300025934 Bacteria 2269
220 Ga0207709_10006419 3300025935 Bacteria 6599
221 Ga0207670_10004249 3300025936 Bacteria 7685
222 Ga0207669_10004628 3300025937 Bacteria 6075
223 Ga0207704_10002263 3300025938 Bacteria 8652
224 Ga0207704_10303637 3300025938 Bacteria 1224
225 Ga0207665_10096827 3300025939 Bacteria 2053
226 Ga0207665_10273575 3300025939 Bacteria 1255
227 Ga0207691_10021764 3300025940 Bacteria 6053
228 Ga0207691_10338683 3300025940 Unclassified 1288
229 Ga0207711_10020197 3300025941 Bacteria 5550
230 Ga0207711_10043917 3300025941 Unclassified 3814
231 Ga0207711_10049320 3300025941 Bacteria 3605
232 Ga0207689_10048475 3300025942 Bacteria 3504
233 Ga0207661_10003798 3300025944 Bacteria 10536
234 Ga0207679_10035964 3300025945 Bacteria 3508
235 Ga0207679_10358743 3300025945 Bacteria 1272
236 Ga0207667_10007132 3300025949 Bacteria 13491
237 Ga0207651_10024102 3300025960 Bacteria 3757
238 Ga0207712_10154672 3300025961 Bacteria 1775
239 Ga0207668_10009968 3300025972 Bacteria 5717
240 Ga0207640_10149865 3300025981 Bacteria 1712
241 Ga0207658_10024209 3300025986 Bacteria 4246
242 Ga0207658_10311245 3300025986 Bacteria 1360
243 Ga0207703_10127531 3300026035 Bacteria 2193
244 Ga0207639_10046524 3300026041 Bacteria 3274
245 Ga0207639_10076520 3300026041 Bacteria 2635
246 Ga0207639_10411568 3300026041 Unclassified 1220
247 Ga0207678_10028363 3300026067 Bacteria 4886
248 Ga0207678_10464204 3300026067 Bacteria 1101
249 Ga0207708_10002907 3300026075 Bacteria 12632
250 Ga0207708_10318123 3300026075 Bacteria 1269
251 Ga0207648_10011619 3300026089 Bacteria 8290
252 Ga0207648_10361905 3300026089 Bacteria 1309
253 Ga0207676_10005283 3300026095 Bacteria 9145
254 Ga0207675_100017070 3300026118 Bacteria 6781
255 Ga0207675_100155924 3300026118 Unclassified 2176
256 Ga0207675_100434723 3300026118 Bacteria 1298
257 Ga0207683_10007329 3300026121 Bacteria 9453
258 Ga0207683_10097654 3300026121 Bacteria 2620
259 Ga0207683_10114087 3300026121 Unclassified 2421
260 Ga0207698_10050163 3300026142 Bacteria 3182
261 Ga0207698_10313667 3300026142 Bacteria 1465
262 Ga0207428_10091223 3300027907 Bacteria 2365
263 Ga0268266_10011912 3300028379 Bacteria 7532
264 Ga0268266_10303975 3300028379 Bacteria 1489
265 Ga0268265_10075247 3300028380 Bacteria 2644
266 Ga0268264_10004719 3300028381 Bacteria 11577
267 Ga0268264_10058876 3300028381 Bacteria 3218
268 Ga0373943_0086669 3300035170 Bacteria 1615
269 Ga0373943_0159415 3300035170 Bacteria 1227
270 Ga0373961_0016052 3300035241 Bacteria 1925
271 Ga0373931_0130405 3300035691 Bacteria 1446
272 Ga0373931_0185864 3300035691 Bacteria 1233
273 Ga0373927_0212854 3300035695 Bacteria 1270
274 Ga0373927_0239429 3300035695 Unclassified 1192
275 Ga0373947_0121059 3300035725 Unclassified 1662
276 Ga0373947_0160545 3300035725 Bacteria 1453
277 Ga0373947_0220771 3300035725 Bacteria 1246
278 Ga0373937_0002214 3300036401 Bacteria 16247
279 Ga0373937_0641688 3300036401 Unclassified 1007
280 Ga0373925_0135182 3300037068 Bacteria 1926
281 Ga0373925_0369272 3300037068 Bacteria 1167
282 Ga0373925_0472915 3300037068 Bacteria 1028
283 Ga0395901_0059070 3300038443 Bacteria 3990
284 Ga0495592_0018570 3300046454 Bacteria 5291
285 Ga0495629_0013111 3300046459 Bacteria 5987
286 Ga0495629_0054346 3300046459 Bacteria 2801
287 Ga0495641_0018590 3300046461 Bacteria 3582
288 Ga0495651_0166454 3300046462 Unclassified 1574
289 Ga0495582_0052586 3300046473 Bacteria 2246
290 Ga0495664_0151218 3300046477 Unclassified 1408
291 Ga0495584_0133491 3300046491 Unclassified 1260
292 Ga0495608_0206383 3300046511 Unclassified 1236
293 Ga0495618_0132549 3300046514 Unclassified 1594
294 Ga0495628_0006193 3300046516 Bacteria 10465
295 Ga0495630_0358937 3300046517 Bacteria 1115
296 Ga0495665_0118917 3300046531 Bacteria 1384
297 Ga0495640_0005050 3300046533 Bacteria 10477
298 Ga0495640_0186196 3300046533 Bacteria 1321
299 Ga0495587_0043625 3300046536 Unclassified 2670
300 Ga0495667_0013377 3300046559 Bacteria 5554
301 Ga0495667_0049733 3300046559 Bacteria 2767
302 Ga0495635_0064081 3300046663 Unclassified 2524
303 Ga0495646_0015749 3300046680 Bacteria 4799
304 Ga0495658_0044198 3300046683 Bacteria 2495
305 Ga0495600_0042693 3300046809 Bacteria 2956
306 Ga0495604_0015504 3300047317 Bacteria 6084
307 Ga0495636_0062555 3300047318 Bacteria 1575
308 Ga0495674_0010153 3300047319 Bacteria 8920
309 Ga0495672_0071834 3300047320 Bacteria 1957
310 Ga0495676_0225164 3300047321 Bacteria 1291
311 Ga0495680_0009121 3300047322 Bacteria 8953
312 Ga0495680_0225426 3300047322 Unclassified 1336
313 Ga0495675_0001879 3300047444 Bacteria 12511
314 Ga0495684_0006609 3300047471 Bacteria 8993
315 Ga0495684_0103136 3300047471 Bacteria 2156
316 Ga0495684_0110400 3300047471 Bacteria 2076
317 Ga0496100_0001472 3300048903 Bacteria 11526
318 Ga0496100_0023889 3300048903 Bacteria 3721
319 Ga0496101_0000630 3300048904 Bacteria 21384
320 Ga0496101_0111652 3300048904 Unclassified 2058
321 Ga0496101_0143648 3300048904 Bacteria 1821
322 Ga0496102_0006285 3300048905 Bacteria 10127
323 Ga0496102_0027860 3300048905 Bacteria 5046
324 Ga0496102_0195007 3300048905 Bacteria 1909
325 Ga0496103_0001536 3300048906 Bacteria 15403
326 Ga0496103_0074662 3300048906 Bacteria 2126
327 Ga0496104_0008411 3300048907 Bacteria 9172
328 Ga0496104_0010394 3300048907 Bacteria 8313
329 Ga0496104_0028661 3300048907 Bacteria 5161
330 Ga0496104_0100000 3300048907 Bacteria 2776
331 Ga0496104_0132125 3300048907 Bacteria 2398
332 Ga0496104_0149277 3300048907 Bacteria 2244
333 Ga0496104_0172351 3300048907 Bacteria 2074
334 Ga0496104_0455700 3300048907 Unclassified 1191
335 Ga0496104_0469128 3300048907 Bacteria 1170
336 Ga0496105_0001481 3300048908 Bacteria 16573
337 Ga0496105_0012429 3300048908 Bacteria 6740
338 Ga0496105_0017264 3300048908 Bacteria 5782
339 Ga0496105_0031428 3300048908 Bacteria 4352
340 Ga0496105_0079236 3300048908 Unclassified 2713
341 Ga0496105_0085432 3300048908 Bacteria 2607
342 Ga0496105_0220669 3300048908 Bacteria 1543
343 Ga0496105_0314150 3300048908 Bacteria 1257
344 Ga0496106_0000996 3300048909 Bacteria 20689
345 Ga0496106_0113642 3300048909 Bacteria 2111
346 Ga0496106_0149384 3300048909 Bacteria 1842
347 Ga0496106_0263922 3300048909 Unclassified 1378
348 Ga0496106_0305805 3300048909 Bacteria 1275
349 Ga0496106_0324871 3300048909 Bacteria 1235
350 Ga0496107_0004543 3300048910 Bacteria 9398
351 Ga0496108_0003508 3300048911 Bacteria 12567
352 Ga0496108_0009916 3300048911 Bacteria 7722
353 Ga0496108_0114728 3300048911 Bacteria 2307
354 Ga0496109_0003952 3300048912 Bacteria 12377
355 Ga0496109_0012332 3300048912 Bacteria 7379
356 Ga0496109_0046819 3300048912 Bacteria 3929
357 Ga0496109_0064888 3300048912 Bacteria 3342
358 Ga0496110_0008156 3300048913 Bacteria 8415
359 Ga0496110_0009203 3300048913 Bacteria 7980
360 Ga0496110_0144847 3300048913 Bacteria 2148
361 Ga0496110_0203066 3300048913 Bacteria 1801
362 Ga0496111_0003279 3300048914 Bacteria 9998
363 Ga0496111_0006791 3300048914 Bacteria 7458
364 Ga0496111_0113169 3300048914 Bacteria 1999
365 Ga0496111_0243409 3300048914 Bacteria 1335
366 Ga0496111_0307723 3300048914 Bacteria 1174
367 Ga0496112_0003073 3300048915 Bacteria 13667
368 Ga0496112_0008877 3300048915 Bacteria 9020
369 Ga0496112_0036456 3300048915 Bacteria 4798
370 Ga0496112_0100853 3300048915 Bacteria 2856
371 Ga0496112_0443624 3300048915 Bacteria 1236
372 Ga0496113_0002136 3300048916 Bacteria 11406
373 Ga0496113_0008151 3300048916 Bacteria 6804
374 Ga0496113_0064590 3300048916 Bacteria 2768
375 Ga0496113_0156795 3300048916 Bacteria 1798
376 Ga0496114_0085949 3300048917 Bacteria 2664
377 Ga0496114_0203233 3300048917 Bacteria 1736
378 Ga0496115_0002436 3300048918 Bacteria 13364
379 Ga0496115_0092239 3300048918 Bacteria 2476
380 Ga0496115_0100966 3300048918 Bacteria 2365
381 Ga0501075_0236773 3300049591 Bacteria 1392
382 nmdc:mga0yw44_23762_c1 3300050492 Bacteria 3458
383 nmdc:mga0yw44_291604_c1 3300050492 Bacteria 1092
384 nmdc:mga0k408_6954_c1 3300050493 Bacteria 6035
385 nmdc:mga05p37_119946_c1 3300050507 Bacteria 3231
386 nmdc:mga05p37_469348_c1 3300050507 Bacteria 1452
387 nmdc:mga09592_257225_c1 3300050508 Bacteria 1514
388 nmdc:mga09592_335700_c1 3300050508 Bacteria 1308
389 nmdc:mga0qj67_119623_c1 3300050509 Bacteria 2130
390 nmdc:mga0qj67_12031_c1 3300050509 Bacteria 6504
391 nmdc:mga0qj67_214756_c1 3300050509 Bacteria 1562
392 nmdc:mga06r32_127407_c1 3300050510 Bacteria 2515
393 nmdc:mga06r32_629114_c1 3300050510 Bacteria 1043
394 nmdc:mga08y16_203502_c1 3300050511 Bacteria 2051
395 nmdc:mga08y16_333887_c1 3300050511 Bacteria 1559
396 Ga0495601_0019116 3300053077 Bacteria 4175
397 Ga0495601_0243187 3300053077 Bacteria 1175
398 Ga0495601_0306003 3300053077 Bacteria 1035
399 Ga0495612_0010074 3300053078 Bacteria 3824
400 Ga0495595_0001596 3300053084 Bacteria 8849
401 Ga0495619_0002511 3300053085 Bacteria 12011
402 Ga0495619_0030272 3300053085 Bacteria 3503
403 Ga0495619_0230758 3300053085 Bacteria 1282
404 Ga0495619_0232560 3300053085 Bacteria 1277
405 Ga0501084_0432456 3300054114 Bacteria 1113
406 Ga0496104_0283376
407 JGI24742J22300_10003476
408 JGI25404J52841_10006041
409 Ga0065707_10029620
410 Ga0070658_10021824
411 Ga0070683_100036096
412 Ga0070690_100030619
413 Ga0070690_100124273
414 Ga0070670_100022037
415 Ga0070670_100058341
416 Ga0068869_100035899
417 Ga0070666_10235127
418 Ga0068868_100004336
419 Ga0070660_100008618
420 Ga0070689_100006779
421 Ga0070691_10105138
422 Ga0070687_100144633
423 Ga0070687_100190955
424 Ga0070668_100010746
425 Ga0070671_100052628
426 Ga0070674_100003043
427 Ga0070673_100025635
428 Ga0070673_100221465
429 Ga0070688_100205713
430 Ga0070667_100040481
431 Ga0070667_100306346
432 Ga0070709_10017400
433 Ga0070709_10224036
434 Ga0070714_100056602
435 Ga0070713_100083392
436 Ga0070710_10044571
437 Ga0070710_10062774
438 Ga0070710_10080079
439 Ga0070710_10214191
440 Ga0070701_10173229
441 Ga0070711_100086889
442 Ga0070711_100097467
443 Ga0070711_100254359
444 Ga0070700_100006254
445 Ga0070700_100081902
446 Ga0070708_100237574
447 Ga0070708_100476130
448 Ga0070663_100024132
449 Ga0070663_100240849
450 Ga0070678_100002315
451 Ga0070678_100070308
452 Ga0070662_100117310
453 Ga0070681_10182909
454 Ga0070681_10190782
455 Ga0068867_100003627
456 Ga0070685_10009446
457 Ga0070706_100011324
458 Ga0070706_100017695
459 Ga0070706_100141772
460 Ga0070706_100328787
461 Ga0070707_100102167
462 Ga0070698_100021671
463 Ga0070698_100025627
464 Ga0070698_100093887
465 Ga0070698_100330479
466 Ga0070699_100006441
467 Ga0070699_100018949
468 Ga0070699_100064446
469 Ga0070684_100027180
470 Ga0070684_100506585
471 Ga0070697_100058208
472 Ga0070697_100270541
473 Ga0068853_100064004
474 Ga0070672_100070160
475 Ga0070686_100003143
476 Ga0070686_100046070
477 Ga0070696_100439174
478 Ga0070665_100024242
479 Ga0070665_100362218
480 Ga0068855_100612631
481 Ga0070702_100021989
482 Ga0068852_100499695
483 Ga0068859_100036366
484 Ga0068859_100261008
485 Ga0068859_100689530
486 Ga0068866_10002593
487 Ga0068861_100006324
488 Ga0068861_100045929
489 Ga0068851_10017777
490 Ga0068870_10000905
491 Ga0068870_10105369
492 Ga0068863_100021574
493 Ga0068863_100387109
494 Ga0068858_100009104
495 Ga0068858_100102361
496 Ga0068858_100188452
497 Ga0068860_100007881
498 Ga0068860_100312169
499 Ga0068862_100006330
500 Ga0068862_100166994
501 Ga0081455_10022259
502 Ga0081455_10057699
503 Ga0081455_10057905
504 Ga0081455_10067994
505 Ga0081455_10077030
506 Ga0081455_10084860
507 Ga0081455_10107757
508 Ga0081455_10110432
509 Ga0081455_10113282
510 Ga0081455_10129658
511 Ga0081538_10065412
512 Ga0081540_1000005
513 Ga0081540_1042760
514 Ga0081540_1045145
515 Ga0070717_10013103
516 Ga0070717_10030609
517 Ga0070717_10148092
518 Ga0075365_10048586
519 Ga0075365_10088924
520 Ga0075365_10092638
521 Ga0075364_10115029
522 Ga0070712_100006669
523 Ga0070712_100257632
524 Ga0070712_100272059
525 Ga0070712_100287942
526 Ga0070712_100331268
527 Ga0070712_100337561
528 Ga0075366_10055385
529 Ga0097621_100027569
530 Ga0075428_100020239
531 Ga0075428_100131190
532 Ga0075428_100213758
533 Ga0075428_100527056
534 Ga0075430_100052275
535 Ga0075430_100115009
536 Ga0075431_100059560
537 Ga0075431_100132142
538 Ga0075431_100141308
539 Ga0075431_100295842
540 Ga0075429_100203772
541 Ga0097620_100036366
542 Ga0097620_100261008
543 Ga0097620_100689567
544 Ga0105240_10020085
545 Ga0105245_10004865
546 Ga0105245_10056185
547 Ga0105245_10144022
548 Ga0105247_10004614
549 Ga0114129_10020668
550 Ga0114129_10362880
551 Ga0105243_10001839
552 Ga0105241_10243877
553 Ga0105242_10011147
554 Ga0105242_10221834
555 Ga0105248_10008067
556 Ga0105248_10019613
557 Ga0105248_10029383
558 Ga0105248_10051800
559 Ga0105248_10670988
560 Ga0105237_10002809
561 Ga0105238_10000767
562 Ga0105238_10219807
563 Ga0105249_10222743
564 Ga0105249_10314929
565 Ga0105239_10003524
566 Ga0105239_10020546
567 Ga0105246_10001905
568 Ga0105246_10102255
569 Ga0157370_10040407
570 Ga0157369_10017545
571 Ga0157374_10016109
572 Ga0157378_10481344
573 Ga0163162_10025087
574 Ga0163162_10175142
575 Ga0157375_10001511
576 Ga0163163_10006830
577 Ga0163163_10072450
578 Ga0163163_10290795
579 Ga0157380_10197776
580 Ga0157380_10219970
581 Ga0157377_10009278
582 Ga0157379_10006607
583 Ga0157379_10091875
584 Ga0157376_10016293
585 Ga0157376_10297431
586 Ga0163161_10006087
587 Ga0163161_10070938
588 Ga0224572_1003653
589 Ga0207697_10017393
590 Ga0207656_10021278
591 Ga0207692_10183014
592 Ga0207710_10010002
593 Ga0207688_10005611
594 Ga0207680_10192654
595 Ga0207647_10015368
596 Ga0207685_10119361
597 Ga0207699_10125322
598 Ga0207643_10004103
599 Ga0207684_10005715
600 Ga0207684_10012347
601 Ga0207684_10050122
602 Ga0207684_10309678
603 Ga0207707_10000990
604 Ga0207695_10018591
605 Ga0207693_10007902
606 Ga0207693_10047953
607 Ga0207693_10104642
608 Ga0207693_10185750
609 Ga0207693_10187821
610 Ga0207693_10293624
611 Ga0207663_10033366
612 Ga0207663_10069767
613 Ga0207663_10344272
614 Ga0207662_10129925
615 Ga0207657_10008798
616 Ga0207681_10074235
617 Ga0207650_10003653
618 Ga0207650_10041243
619 Ga0207687_10002430
620 Ga0207687_10031661
621 Ga0207664_10135169
622 Ga0207690_10034552
623 Ga0207706_10124520
624 Ga0207686_10068818
625 Ga0207709_10006419
626 Ga0207670_10004249
627 Ga0207669_10004628
628 Ga0207704_10002263
629 Ga0207704_10303637
630 Ga0207665_10096827
631 Ga0207665_10273575
632 Ga0207691_10021764
633 Ga0207691_10338683
634 Ga0207711_10020197
635 Ga0207711_10043917
636 Ga0207711_10049320
637 Ga0207689_10048475
638 Ga0207661_10003798
639 Ga0207679_10035964
640 Ga0207679_10358743
641 Ga0207667_10007132
642 Ga0207651_10024102
643 Ga0207712_10154672
644 Ga0207668_10009968
645 Ga0207640_10149865
646 Ga0207658_10024209
647 Ga0207658_10311245
648 Ga0207703_10127531
649 Ga0207639_10046524
650 Ga0207639_10076520
651 Ga0207639_10411568
652 Ga0207678_10028363
653 Ga0207678_10464204
654 Ga0207708_10002907
655 Ga0207708_10318123
656 Ga0207648_10011619
657 Ga0207648_10361905
658 Ga0207676_10005283
659 Ga0207675_100017070
660 Ga0207675_100155924
661 Ga0207675_100434723
662 Ga0207683_10007329
663 Ga0207683_10097654
664 Ga0207683_10114087
665 Ga0207698_10050163
666 Ga0207698_10313667
667 Ga0207428_10091223
668 Ga0268266_10011912
669 Ga0268266_10303975
670 Ga0268265_10075247
671 Ga0268264_10004719
672 Ga0268264_10058876
673 Ga0373943_0086669
674 Ga0373943_0159415
675 Ga0373961_0016052
676 Ga0373931_0130405
677 Ga0373931_0185864
678 Ga0373927_0212854
679 Ga0373927_0239429
680 Ga0373947_0121059
681 Ga0373947_0160545
682 Ga0373947_0220771
683 Ga0373937_0002214
684 Ga0373937_0641688
685 Ga0373925_0135182
686 Ga0373925_0369272
687 Ga0373925_0472915
688 Ga0395901_0059070
689 Ga0495592_0018570
690 Ga0495629_0013111
691 Ga0495629_0054346
692 Ga0495641_0018590
693 Ga0495651_0166454
694 Ga0495582_0052586
695 Ga0495664_0151218
696 Ga0495584_0133491
697 Ga0495608_0206383
698 Ga0495618_0132549
699 Ga0495628_0006193
700 Ga0495630_0358937
701 Ga0495665_0118917
702 Ga0495640_0005050
703 Ga0495640_0186196
704 Ga0495587_0043625
705 Ga0495667_0013377
706 Ga0495667_0049733
707 Ga0495635_0064081
708 Ga0495646_0015749
709 Ga0495658_0044198
710 Ga0495600_0042693
711 Ga0495604_0015504
712 Ga0495636_0062555
713 Ga0495674_0010153
714 Ga0495672_0071834
715 Ga0495676_0225164
716 Ga0495680_0009121
717 Ga0495680_0225426
718 Ga0495675_0001879
719 Ga0495684_0006609
720 Ga0495684_0103136
721 Ga0495684_0110400
722 Ga0496100_0001472
723 Ga0496100_0023889
724 Ga0496101_0000630
725 Ga0496101_0111652
726 Ga0496101_0143648
727 Ga0496102_0006285
728 Ga0496102_0027860
729 Ga0496102_0195007
730 Ga0496103_0001536
731 Ga0496103_0074662
732 Ga0496104_0008411
733 Ga0496104_0010394
734 Ga0496104_0028661
735 Ga0496104_0100000
736 Ga0496104_0132125
737 Ga0496104_0149277
738 Ga0496104_0172351
739 Ga0496104_0455700
740 Ga0496104_0469128
741 Ga0496105_0001481
742 Ga0496105_0012429
743 Ga0496105_0017264
744 Ga0496105_0031428
745 Ga0496105_0079236
746 Ga0496105_0085432
747 Ga0496105_0220669
748 Ga0496105_0314150
749 Ga0496106_0000996
750 Ga0496106_0113642
751 Ga0496106_0149384
752 Ga0496106_0263922
753 Ga0496106_0305805
754 Ga0496106_0324871
755 Ga0496107_0004543
756 Ga0496108_0003508
757 Ga0496108_0009916
758 Ga0496108_0114728
759 Ga0496109_0003952
760 Ga0496109_0012332
761 Ga0496109_0046819
762 Ga0496109_0064888
763 Ga0496110_0008156
764 Ga0496110_0009203
765 Ga0496110_0144847
766 Ga0496110_0203066
767 Ga0496111_0003279
768 Ga0496111_0006791
769 Ga0496111_0113169
770 Ga0496111_0243409
771 Ga0496111_0307723
772 Ga0496112_0003073
773 Ga0496112_0008877
774 Ga0496112_0036456
775 Ga0496112_0100853
776 Ga0496112_0443624
777 Ga0496113_0002136
778 Ga0496113_0008151
779 Ga0496113_0064590
780 Ga0496113_0156795
781 Ga0496114_0085949
782 Ga0496114_0203233
783 Ga0496115_0002436
784 Ga0496115_0092239
785 Ga0496115_0100966
786 Ga0501075_0236773
787 nmdc:mga0yw44_23762_c1
788 nmdc:mga0yw44_291604_c1
789 nmdc:mga0k408_6954_c1
790 nmdc:mga05p37_119946_c1
791 nmdc:mga05p37_469348_c1
792 nmdc:mga09592_257225_c1
793 nmdc:mga09592_335700_c1
794 nmdc:mga0qj67_119623_c1
795 nmdc:mga0qj67_12031_c1
796 nmdc:mga0qj67_214756_c1
797 nmdc:mga06r32_127407_c1
798 nmdc:mga06r32_629114_c1
799 nmdc:mga08y16_203502_c1
800 nmdc:mga08y16_333887_c1
801 Ga0495601_0019116
802 Ga0495601_0243187
803 Ga0495601_0306003
804 Ga0495612_0010074
805 Ga0495595_0001596
806 Ga0495619_0002511
807 Ga0495619_0030272
808 Ga0495619_0230758
809 Ga0495619_0232560
810 Ga0501084_0432456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

32

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8836 28 320
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8725 29 323
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8698 28 320
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8643 29 323
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.862 31 323
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8547 146 323 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8525 146 320 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8383 146 323 3.40.50.2300
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8288 162 237 3.40.50.10860
5isuA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8252 162 198 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A537N9H2-F1-model_v4 ABC transporter substrate-binding protein 0.9827 27 139
AF-A0A537SAR6-F1-model_v4 ABC transporter substrate-binding protein 0.9463 31 200
AF-A0A1G8SMX2-F1-model_v4 ABC transporter substrate binding protein 0.9413 145 289
AF-A0A537TQN9-F1-model_v4 ABC transporter substrate-binding protein 0.9387 96 324
AF-A0A537TG30-F1-model_v4 ABC transporter substrate-binding protein 0.9375 138 308

Map