F436301

General Info

Members Datasets Scaffolds Average Seq Length
406 260 812 302

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0044208|Ga0495664_0044208_974_2005
Length 343
Sequence LLGIRSRGTVINSCFEFESTSIAVKVRTDMKAVRFHEYGDPSVLRYEDVEQPVPGAGEVRIRVAATSFNSVDGNIRGGFMQGPIPVVLPHTPGLDVAGTVDALGEGVDGIAVGDQVVGFLPMGKPGAAAQYVIAPAEILATAPKSVPLADAAALPLVGLTAWQALFDHGKLTAGQRVLINGAGGAVGGYAVQLAKGAEAHVIATASPRSSEAVTSAGADEVIDHTTTSVTAAVTEPVDVVLNLAPVDPAELAALVTLVRPGGVVVNTTVWMPAPSDQERGVRGIDLFVRSDADQLAKLVALVDRGELRVDVAERVPLAELPALHARAAEGAVHGKAIVVPSTV

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
232 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
233 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
234 2643221647 Streptomyces sp. Root369 Isolate Unclassified
235 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
236 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
237 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
238 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
239 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
240 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
241 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
242 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
243 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
244 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
245 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
246 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
247 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
248 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
249 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
250 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
251 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
252 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
253 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
254 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
255 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
256 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
257 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
258 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
259 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
260 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 0
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0.74
Rhizoplane 3.2
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0044208 3300046477 Bacteria 2639
2 JGI25406J46586_10035864 3300003203 Bacteria 1806
3 Ga0070683_100171185 3300005329 Bacteria 2061
4 Ga0070690_100034111 3300005330 Bacteria 3188
5 Ga0068868_100121331 3300005338 Bacteria 2132
6 Ga0068868_100325614 3300005338 Bacteria 1310
7 Ga0070691_10082432 3300005341 Bacteria 1577
8 Ga0070687_100152230 3300005343 Bacteria 1359
9 Ga0070668_100022785 3300005347 Bacteria 4734
10 Ga0070668_100060212 3300005347 Bacteria 2940
11 Ga0070674_100273011 3300005356 Bacteria 1337
12 Ga0070659_100012352 3300005366 Bacteria 6329
13 Ga0070709_10054700 3300005434 Bacteria 2517
14 Ga0070714_100029126 3300005435 Bacteria 4588
15 Ga0070714_100222028 3300005435 Bacteria 1737
16 Ga0070701_10077557 3300005438 Bacteria 1791
17 Ga0070711_100055474 3300005439 Bacteria 2737
18 Ga0070663_100003643 3300005455 Bacteria 8921
19 Ga0070685_10306893 3300005466 Bacteria 1071
20 Ga0070707_100084742 3300005468 Bacteria 3062
21 Ga0068853_100047119 3300005539 Bacteria 3699
22 Ga0070686_100207078 3300005544 Bacteria 1409
23 Ga0070665_100018444 3300005548 Bacteria 6994
24 Ga0070665_100039866 3300005548 Bacteria 4722
25 Ga0070665_100072158 3300005548 Bacteria 3460
26 Ga0070665_100228534 3300005548 Bacteria 1860
27 Ga0070665_100233281 3300005548 Bacteria 1840
28 Ga0070664_100214664 3300005564 Bacteria 1720
29 Ga0068854_100004039 3300005578 Bacteria 9211
30 Ga0068856_100384219 3300005614 Bacteria 1423
31 Ga0070702_100002672 3300005615 Bacteria 7786
32 Ga0068852_100014344 3300005616 Bacteria 6096
33 Ga0068859_100252816 3300005617 Bacteria 1853
34 Ga0068864_100145297 3300005618 Bacteria 2143
35 Ga0068864_100563876 3300005618 Bacteria 1102
36 Ga0068861_100114582 3300005719 Bacteria 2165
37 Ga0068861_100154210 3300005719 Bacteria 1888
38 Ga0068858_100239181 3300005842 Bacteria 1722
39 Ga0068860_100093464 3300005843 Bacteria 2866
40 Ga0068862_100000591 3300005844 Bacteria 37734
41 Ga0081455_10016103 3300005937 Bacteria 7229
42 Ga0081455_10097725 3300005937 Bacteria 2365
43 Ga0081538_10000403 3300005981 Bacteria 48940
44 Ga0081538_10010374 3300005981 Bacteria 7640
45 Ga0081538_10046122 3300005981 Bacteria 2693
46 Ga0081539_10003356 3300005985 Bacteria 19836
47 Ga0081539_10023676 3300005985 Bacteria 4013
48 Ga0070717_10027636 3300006028 Bacteria 4535
49 Ga0075365_10004755 3300006038 Bacteria 7238
50 Ga0075365_10017942 3300006038 Bacteria 4342
51 Ga0075365_10040648 3300006038 Bacteria 3033
52 Ga0075365_10056445 3300006038 Bacteria 2610
53 Ga0075365_10201517 3300006038 Bacteria 1394
54 Ga0075368_10045114 3300006042 Bacteria 1741
55 Ga0075368_10058609 3300006042 Bacteria 1539
56 Ga0075363_100101190 3300006048 Bacteria 1595
57 Ga0075363_100102164 3300006048 Bacteria 1587
58 Ga0075364_10005760 3300006051 Bacteria 7227
59 Ga0075364_10028232 3300006051 Bacteria 3591
60 Ga0075364_10072074 3300006051 Bacteria 2276
61 Ga0075364_10081860 3300006051 Bacteria 2135
62 Ga0075432_10006322 3300006058 Bacteria 4027
63 Ga0075362_10008417 3300006177 Bacteria 3943
64 Ga0075367_10155960 3300006178 Bacteria 1418
65 Ga0075369_10004009 3300006186 Bacteria 5409
66 Ga0075370_10126634 3300006353 Bacteria 1489
67 Ga0075430_100020208 3300006846 Bacteria 5665
68 Ga0075431_100058851 3300006847 Bacteria 3965
69 Ga0075433_10406546 3300006852 Bacteria 1201
70 Ga0075429_100150408 3300006880 Bacteria 2038
71 Ga0097620_100252816 3300006931 Bacteria 1853
72 Ga0099826_10194429 3300006948 Bacteria 1116
73 Ga0111539_10014733 3300009094 Bacteria 9754
74 Ga0111539_10215750 3300009094 Bacteria 2235
75 Ga0105245_10126759 3300009098 Bacteria 2390
76 Ga0105245_10145238 3300009098 Bacteria 2238
77 Ga0105247_10031299 3300009101 Bacteria 3228
78 Ga0105243_10008484 3300009148 Bacteria 7889
79 Ga0105243_10133014 3300009148 Bacteria 2113
80 Ga0105243_10712155 3300009148 Bacteria 980
81 Ga0105248_10010722 3300009177 Bacteria 10116
82 Ga0105248_10464741 3300009177 Bacteria 1426
83 Ga0105237_10231190 3300009545 Bacteria 1850
84 Ga0105249_10012619 3300009553 Bacteria 7450
85 Ga0105249_10143666 3300009553 Bacteria 2291
86 Ga0105239_10092042 3300010375 Bacteria 3346
87 Ga0105239_10093432 3300010375 Bacteria 3321
88 Ga0105239_10418184 3300010375 Bacteria 1518
89 Ga0105246_10129014 3300011119 Bacteria 1885
90 Ga0157369_10168457 3300013105 Bacteria 2309
91 Ga0157374_10315494 3300013296 Bacteria 1548
92 Ga0157378_10234390 3300013297 Bacteria 1751
93 Ga0163162_10428383 3300013306 Bacteria 1455
94 Ga0157375_10117295 3300013308 Bacteria 2767
95 Ga0157375_10288025 3300013308 Bacteria 1805
96 Ga0157379_10137689 3300014968 Bacteria 2200
97 Ga0157379_10188034 3300014968 Bacteria 1866
98 Ga0157379_10428867 3300014968 Bacteria 1218
99 Ga0157376_10018263 3300014969 Bacteria 5371
100 Ga0207710_10021868 3300025900 Bacteria 2744
101 Ga0207688_10059282 3300025901 Bacteria 2155
102 Ga0207680_10003455 3300025903 Bacteria 7452
103 Ga0207647_10034015 3300025904 Bacteria 3258
104 Ga0207643_10059606 3300025908 Bacteria 2178
105 Ga0207654_10002701 3300025911 Bacteria 9007
106 Ga0207693_10015135 3300025915 Bacteria 6192
107 Ga0207662_10059963 3300025918 Bacteria 2281
108 Ga0207646_10242363 3300025922 Bacteria 1628
109 Ga0207687_10095033 3300025927 Bacteria 2182
110 Ga0207687_10133415 3300025927 Bacteria 1875
111 Ga0207690_10159279 3300025932 Bacteria 1681
112 Ga0207690_10318156 3300025932 Bacteria 1222
113 Ga0207709_10084774 3300025935 Bacteria 2052
114 Ga0207670_10066693 3300025936 Bacteria 2473
115 Ga0207669_10180992 3300025937 Bacteria 1511
116 Ga0207711_10048383 3300025941 Bacteria 3638
117 Ga0207711_10116623 3300025941 Bacteria 2381
118 Ga0207679_10089435 3300025945 Bacteria 2377
119 Ga0207712_10062272 3300025961 Bacteria 2651
120 Ga0207712_10071659 3300025961 Bacteria 2493
121 Ga0207668_10005669 3300025972 Bacteria 7351
122 Ga0207668_10028517 3300025972 Bacteria 3650
123 Ga0207668_10045225 3300025972 Bacteria 3001
124 Ga0207658_10001606 3300025986 Bacteria 17376
125 Ga0207658_10030264 3300025986 Bacteria 3831
126 Ga0207658_10109713 3300025986 Bacteria 2179
127 Ga0207677_10128292 3300026023 Bacteria 1921
128 Ga0207639_10120583 3300026041 Bacteria 2154
129 Ga0207678_10002060 3300026067 Bacteria 18229
130 Ga0207678_10071040 3300026067 Bacteria 2985
131 Ga0207678_10145149 3300026067 Bacteria 2025
132 Ga0207708_10022166 3300026075 Bacteria 4796
133 Ga0207702_10382574 3300026078 Bacteria 1354
134 Ga0207641_10348598 3300026088 Bacteria 1411
135 Ga0207641_10476066 3300026088 Bacteria 1210
136 Ga0207648_10043223 3300026089 Bacteria 3956
137 Ga0207676_10505521 3300026095 Bacteria 1148
138 Ga0207675_100062795 3300026118 Bacteria 3470
139 Ga0207675_100201459 3300026118 Bacteria 1912
140 Ga0207698_10059318 3300026142 Bacteria 2970
141 Ga0268266_10002551 3300028379 Bacteria 19327
142 Ga0268266_10023152 3300028379 Bacteria 5288
143 Ga0268266_10134801 3300028379 Bacteria 2211
144 Ga0268266_10153259 3300028379 Bacteria 2079
145 Ga0268266_10413823 3300028379 Bacteria 1277
146 Ga0268265_10000868 3300028380 Bacteria 28346
147 Ga0268265_10019211 3300028380 Bacteria 4746
148 Ga0268265_10158152 3300028380 Bacteria 1921
149 Ga0268265_10408554 3300028380 Bacteria 1257
150 Ga0268264_10115254 3300028381 Bacteria 2360
151 Ga0268264_10183236 3300028381 Bacteria 1903
152 Ga0268264_10276498 3300028381 Bacteria 1571
153 Ga0268264_10305930 3300028381 Bacteria 1498
154 Ga0307515_10044464 3300028794 Bacteria 6860
155 Ga0307511_10047936 3300030521 Bacteria 3486
156 Ga0307512_10091962 3300030522 Bacteria 2107
157 Ga0307509_10097721 3300031507 Bacteria 2984
158 Ga0307508_10051574 3300031616 Bacteria 3656
159 Ga0307514_10016237 3300031649 Bacteria 6132
160 Ga0307516_10000888 3300031730 Bacteria 41189
161 Ga0307516_10025893 3300031730 Bacteria 5965
162 Ga0307516_10045274 3300031730 Bacteria 4346
163 Ga0307410_10010655 3300031852 Bacteria 5220
164 Ga0307409_100007357 3300031995 Bacteria 6579
165 Ga0307409_100041116 3300031995 Bacteria 3449
166 Ga0307416_100016150 3300032002 Bacteria 5178
167 Ga0307414_10614514 3300032004 Bacteria 976
168 Ga0307415_100000639 3300032126 Bacteria 15379
169 Ga0307415_100044048 3300032126 Bacteria 2981
170 Ga0307415_100286590 3300032126 Bacteria 1357
171 Ga0307507_10006790 3300033179 Bacteria 17162
172 Ga0307510_10000278 3300033180 Bacteria 47084
173 Ga0373926_0012944 3300035083 Bacteria 2825
174 Ga0373936_0003333 3300035113 Bacteria 6022
175 Ga0373946_0016377 3300035171 Bacteria 2823
176 Ga0373935_0004192 3300035692 Bacteria 8441
177 Ga0373933_0115611 3300035724 Bacteria 1676
178 Ga0373947_0012056 3300035725 Bacteria 4950
179 Ga0395899_0010058 3300037312 Bacteria 7252
180 Ga0395900_0041395 3300037418 Bacteria 4749
181 Ga0395900_0074338 3300037418 Bacteria 3494
182 Ga0395900_0118844 3300037418 Bacteria 2713
183 Ga0395900_0139916 3300037418 Bacteria 2479
184 Ga0395898_0009817 3300037466 Bacteria 10032
185 Ga0395898_0021436 3300037466 Bacteria 6553
186 Ga0395898_0039808 3300037466 Bacteria 4651
187 Ga0395898_0109661 3300037466 Bacteria 2646
188 Ga0395898_0220907 3300037466 Bacteria 1807
189 Ga0395905_0002804 3300037471 Bacteria 19100
190 Ga0395905_0315340 3300037471 Bacteria 1453
191 Ga0395901_0017001 3300038443 Bacteria 7413
192 Ga0395901_0091642 3300038443 Bacteria 3181
193 Ga0395901_0205775 3300038443 Bacteria 2062
194 Ga0395901_0467453 3300038443 Bacteria 1288
195 Ga0436365_1525294 3300039437 Bacteria 6757
196 Ga0451837_1334826 3300041494 Bacteria 1587
197 Ga0451853_2308981 3300041512 Bacteria 1758
198 Ga0439448_0015522 3300042005 Bacteria 2309
199 Ga0450903_011930 3300042138 Bacteria 1394
200 Ga0466969_0043199 3300044656 Bacteria 2246
201 Ga0466966_0019774 3300044684 Bacteria 4429
202 Ga0466961_0018996 3300044693 Bacteria 4422
203 Ga0466961_0054422 3300044693 Bacteria 2552
204 Ga0466961_0186781 3300044693 Bacteria 1286
205 Ga0466963_0339013 3300044694 Bacteria 1058
206 Ga0466964_0102664 3300044706 Bacteria 1263
207 Ga0466968_0000307 3300044735 Bacteria 15699
208 Ga0466970_0008805 3300044765 Bacteria 5084
209 Ga0466970_0030167 3300044765 Bacteria 2858
210 Ga0466970_0055322 3300044765 Bacteria 2119
211 Ga0466970_0057577 3300044765 Bacteria 2078
212 Ga0466970_0066862 3300044765 Bacteria 1930
213 Ga0466957_0006666 3300044842 Bacteria 6529
214 Ga0466957_0035198 3300044842 Bacteria 3005
215 Ga0466957_0036521 3300044842 Bacteria 2954
216 Ga0466957_0172373 3300044842 Bacteria 1410
217 Ga0466960_0012392 3300044901 Bacteria 3597
218 Ga0466960_0061681 3300044901 Bacteria 1841
219 Ga0466959_0151982 3300045049 Bacteria 1631
220 Ga0466958_0273326 3300045836 Bacteria 1082
221 Ga0466967_0501521 3300045976 Bacteria 1191
222 Ga0495592_0013955 3300046454 Bacteria 6102
223 Ga0495592_0225415 3300046454 Bacteria 1251
224 Ga0495603_0015507 3300046455 Bacteria 4612
225 Ga0495603_0188909 3300046455 Bacteria 1191
226 Ga0495651_0001754 3300046462 Bacteria 16733
227 Ga0495651_0018743 3300046462 Bacteria 5361
228 Ga0495651_0043097 3300046462 Bacteria 3502
229 Ga0495653_0012302 3300046463 Bacteria 6981
230 Ga0495653_0014128 3300046463 Bacteria 6510
231 Ga0495580_0291919 3300046472 Bacteria 1111
232 Ga0495582_0036652 3300046473 Bacteria 2698
233 Ga0495605_0001907 3300046474 Bacteria 13296
234 Ga0495662_0112690 3300046476 Bacteria 1333
235 Ga0495662_0159047 3300046476 Bacteria 1113
236 Ga0495664_0003243 3300046477 Bacteria 8841
237 Ga0495585_0008856 3300046492 Bacteria 6074
238 Ga0495585_0036101 3300046492 Bacteria 2790
239 Ga0495594_0009229 3300046499 Bacteria 5090
240 Ga0495607_0003892 3300046501 Bacteria 11249
241 Ga0495583_0003645 3300046506 Bacteria 11498
242 Ga0495606_0002084 3300046507 Bacteria 24406
243 Ga0495608_0023281 3300046511 Bacteria 4246
244 Ga0495610_0045543 3300046512 Bacteria 2170
245 Ga0495616_0003054 3300046513 Bacteria 10846
246 Ga0495618_0034420 3300046514 Bacteria 3177
247 Ga0495620_0001583 3300046515 Bacteria 13505
248 Ga0495628_0002815 3300046516 Bacteria 15610
249 Ga0495628_0006983 3300046516 Bacteria 9794
250 Ga0495628_0020286 3300046516 Bacteria 5486
251 Ga0495628_0036597 3300046516 Bacteria 3938
252 Ga0495628_0075339 3300046516 Bacteria 2628
253 Ga0495631_0010312 3300046518 Bacteria 4626
254 Ga0495666_0004321 3300046526 Bacteria 7174
255 Ga0495652_0001490 3300046529 Bacteria 25807
256 Ga0495652_0004928 3300046529 Bacteria 12660
257 Ga0495640_0016204 3300046533 Bacteria 5580
258 Ga0495597_0017605 3300046542 Bacteria 3360
259 Ga0495645_0231770 3300046543 Bacteria 1237
260 Ga0495645_0277245 3300046543 Bacteria 1104
261 Ga0495622_0010448 3300046557 Bacteria 4287
262 Ga0495667_0004568 3300046559 Bacteria 9351
263 Ga0495667_0007055 3300046559 Bacteria 7627
264 Ga0495656_0046517 3300046615 Bacteria 1836
265 Ga0495634_0081774 3300046642 Bacteria 2112
266 Ga0495611_0012155 3300046648 Bacteria 3659
267 Ga0495625_0011492 3300046660 Bacteria 7216
268 Ga0495635_0000572 3300046663 Bacteria 23607
269 Ga0495635_0135804 3300046663 Bacteria 1676
270 Ga0495661_0095574 3300046665 Bacteria 1682
271 Ga0495657_0010022 3300046675 Bacteria 7149
272 Ga0495657_0032947 3300046675 Bacteria 3612
273 Ga0495657_0037921 3300046675 Bacteria 3319
274 Ga0495599_0002468 3300046678 Bacteria 10769
275 Ga0495646_0013932 3300046680 Bacteria 5109
276 Ga0495646_0141294 3300046680 Bacteria 1346
277 Ga0495613_0015669 3300046689 Bacteria 5641
278 Ga0495613_0016678 3300046689 Bacteria 5468
279 Ga0495613_0066629 3300046689 Bacteria 2629
280 Ga0495624_0001764 3300046690 Bacteria 16566
281 Ga0495624_0010370 3300046690 Bacteria 6421
282 Ga0495624_0064090 3300046690 Bacteria 2297
283 Ga0495649_0011072 3300046694 Bacteria 5312
284 Ga0495589_0015561 3300046794 Bacteria 3912
285 Ga0495600_0006566 3300046809 Bacteria 7081
286 Ga0495660_0002102 3300046810 Bacteria 12894
287 Ga0495660_0010442 3300046810 Bacteria 5401
288 Ga0495581_0054842 3300047315 Bacteria 2301
289 Ga0495581_0108433 3300047315 Bacteria 1614
290 Ga0495604_0032615 3300047317 Bacteria 4128
291 Ga0495604_0062296 3300047317 Bacteria 2850
292 Ga0495604_0219303 3300047317 Bacteria 1310
293 Ga0495604_0275064 3300047317 Bacteria 1139
294 Ga0495674_0024790 3300047319 Bacteria 5506
295 Ga0495674_0067044 3300047319 Bacteria 3111
296 Ga0495676_0010726 3300047321 Bacteria 8294
297 Ga0495676_0011833 3300047321 Bacteria 7871
298 Ga0495676_0028811 3300047321 Bacteria 4737
299 Ga0495676_0035614 3300047321 Bacteria 4162
300 Ga0495680_0008382 3300047322 Bacteria 9400
301 Ga0495680_0011348 3300047322 Bacteria 7892
302 Ga0495680_0011596 3300047322 Bacteria 7792
303 Ga0495683_0001033 3300047323 Bacteria 19350
304 Ga0495683_0001924 3300047323 Bacteria 12956
305 Ga0495687_005671 3300047443 Bacteria 7885
306 Ga0495675_0001664 3300047444 Bacteria 13316
307 Ga0495675_0182273 3300047444 Bacteria 1285
308 Ga0495685_001898 3300047447 Bacteria 6454
309 Ga0495685_007882 3300047447 Bacteria 3525
310 Ga0495685_025224 3300047447 Bacteria 2046
311 Ga0495684_0001821 3300047471 Bacteria 17135
312 Ga0495684_0115280 3300047471 Bacteria 2026
313 Ga0495593_0009615 3300047673 Bacteria 5614
314 Ga0495593_0032378 3300047673 Bacteria 2851
315 Ga0495593_0047872 3300047673 Bacteria 2273
316 Ga0495602_0019986 3300048088 Bacteria 6630
317 Ga0495602_0037568 3300048088 Bacteria 4491
318 Ga0495602_0320928 3300048088 Bacteria 1127
319 Ga0495614_0002370 3300048089 Bacteria 8389
320 Ga0496100_0061209 3300048903 Bacteria 2480
321 Ga0496104_0110072 3300048907 Bacteria 2640
322 Ga0496105_0245700 3300048908 Bacteria 1451
323 Ga0496108_0000008 3300048911 Bacteria 294619
324 Ga0496108_0000066 3300048911 Bacteria 116839
325 Ga0496108_0025508 3300048911 Bacteria 4871
326 Ga0496108_0130755 3300048911 Bacteria 2158
327 Ga0496109_0104774 3300048912 Bacteria 2626
328 Ga0496110_0059337 3300048913 Bacteria 3372
329 Ga0496111_0145547 3300048914 Bacteria 1757
330 Ga0496112_0044260 3300048915 Bacteria 4362
331 Ga0496112_0113639 3300048915 Bacteria 2679
332 Ga0496112_0172443 3300048915 Bacteria 2128
333 Ga0496122_0028693 3300048925 Bacteria 4712
334 Ga0496123_0050117 3300048926 Bacteria 2792
335 Ga0496126_0373275 3300048929 Bacteria 1163
336 Ga0501033_0026646 3300049570 Bacteria 4349
337 Ga0501033_0135629 3300049570 Bacteria 1781
338 Ga0501034_0646882 3300049571 Bacteria 959
339 Ga0501036_0176868 3300049572 Bacteria 1797
340 Ga0501037_0222283 3300049573 Bacteria 1328
341 Ga0501043_0024699 3300049579 Bacteria 4712
342 Ga0501047_0011638 3300049581 Bacteria 8320
343 Ga0501047_0027337 3300049581 Bacteria 5495
344 Ga0501048_0145264 3300049582 Bacteria 1678
345 Ga0501080_0388583 3300049742 Bacteria 1256
346 Ga0501035_0029591 3300049822 Bacteria 4995
347 Ga0501035_0058266 3300049822 Bacteria 3443
348 Ga0501044_0037169 3300049823 Bacteria 5090
349 Ga0501044_0041818 3300049823 Bacteria 4771
350 nmdc:mga03n38_1958_c1 3300050490 Bacteria 6180
351 nmdc:mga03n38_343_c1 3300050490 Bacteria 11298
352 nmdc:mga03n38_75675_c1 3300050490 Bacteria 1569
353 nmdc:mga03n38_85730_c1 3300050490 Bacteria 1489
354 nmdc:mga00v17_2462_c1 3300050491 Bacteria 9475
355 nmdc:mga00v17_288016_c1 3300050491 Bacteria 1066
356 nmdc:mga00v17_29006_c1 3300050491 Bacteria 3245
357 nmdc:mga00v17_3305_c1 3300050491 Bacteria 8317
358 nmdc:mga00v17_42185_c1 3300050491 Bacteria 2743
359 nmdc:mga0yw44_10794_c1 3300050492 Bacteria 4681
360 nmdc:mga0yw44_17008_c1 3300050492 Bacteria 3945
361 nmdc:mga0yw44_37514_c1 3300050492 Bacteria 2861
362 nmdc:mga04h51_34050_c1 3300050495 Bacteria 1625
363 nmdc:mga07m45_95388_c1 3300050496 Bacteria 1706
364 nmdc:mga05p37_652934_c1 3300050507 Bacteria 1178
365 nmdc:mga09592_405247_c1 3300050508 Bacteria 1179
366 nmdc:mga06r32_150112_c1 3300050510 Bacteria 2309
367 nmdc:mga08y16_261705_c1 3300050511 Bacteria 1786
368 nmdc:mga08y16_65890_c1 3300050511 Bacteria 3781
369 Ga0495601_0009783 3300053077 Bacteria 5671
370 Ga0495601_0015367 3300053077 Bacteria 4627
371 Ga0495595_0124195 3300053084 Bacteria 1259
372 Ga0500559_0006254 3300053136 Bacteria 5386
373 Ga0500600_0011208 3300053149 Bacteria 5446
374 Ga0500616_0000216 3300053153 Bacteria 90400
375 2585302802 2582581313 Bacteria 10042643
376 2585317550 2582581314 Bacteria 11452267
377 2616701903 2616644814 Bacteria 11555299
378 2644262203 2643221647 Bacteria 10741251
379 2644268470 2643221647 Bacteria 10741251
380 2676203451 2675902999 Bacteria 9438463
381 2676495303 2675903060 Bacteria 10051191
382 2753264576 2751185782 Bacteria 11227053
383 2774848027 2773857921 Bacteria 9435764
384 2784585541 2784132148 Bacteria 8627943
385 2791914520 2791354901 Bacteria 8322202
386 2799185629 2799112218 Bacteria 4315149
387 2808849201 2808606359 Bacteria 9866990
388 2868088925 2868088558 Bacteria 7609351
389 2870784739 2870782633 Bacteria 9624083
390 2887479334 2887478801 Bacteria 8972725
391 2891402757 2891395885 Bacteria 9251614
392 2917738321 2917736166 Bacteria 9690793
393 2919469078 2919468124 Bacteria 9133025
394 2919719689 2919713450 Bacteria 7431245
395 2954006310 2954002825 Bacteria 9173742
396 2954386309 2954380949 Bacteria 10050426
397 2954705146 2954701450 Bacteria 10834262
398 2954711830 2954711539 Bacteria 10867210
399 2954721746 2954721474 Bacteria 10456478
400 2954740079 2954731030 Bacteria 10243860
401 2954740660 2954740390 Bacteria 10229294
402 2954758903 2954749733 Bacteria 10366972
403 2954759668 2954759201 Bacteria 9358192
404 8023623977 8023623736 Bacteria 8593882
405 8047712187 8047710418 Bacteria 11023148
406 8047717930 8047710418 Bacteria 11023148
407 Ga0495664_0044208
408 JGI25406J46586_10035864
409 Ga0070683_100171185
410 Ga0070690_100034111
411 Ga0068868_100121331
412 Ga0068868_100325614
413 Ga0070691_10082432
414 Ga0070687_100152230
415 Ga0070668_100022785
416 Ga0070668_100060212
417 Ga0070674_100273011
418 Ga0070659_100012352
419 Ga0070709_10054700
420 Ga0070714_100029126
421 Ga0070714_100222028
422 Ga0070701_10077557
423 Ga0070711_100055474
424 Ga0070663_100003643
425 Ga0070685_10306893
426 Ga0070707_100084742
427 Ga0068853_100047119
428 Ga0070686_100207078
429 Ga0070665_100018444
430 Ga0070665_100039866
431 Ga0070665_100072158
432 Ga0070665_100228534
433 Ga0070665_100233281
434 Ga0070664_100214664
435 Ga0068854_100004039
436 Ga0068856_100384219
437 Ga0070702_100002672
438 Ga0068852_100014344
439 Ga0068859_100252816
440 Ga0068864_100145297
441 Ga0068864_100563876
442 Ga0068861_100114582
443 Ga0068861_100154210
444 Ga0068858_100239181
445 Ga0068860_100093464
446 Ga0068862_100000591
447 Ga0081455_10016103
448 Ga0081455_10097725
449 Ga0081538_10000403
450 Ga0081538_10010374
451 Ga0081538_10046122
452 Ga0081539_10003356
453 Ga0081539_10023676
454 Ga0070717_10027636
455 Ga0075365_10004755
456 Ga0075365_10017942
457 Ga0075365_10040648
458 Ga0075365_10056445
459 Ga0075365_10201517
460 Ga0075368_10045114
461 Ga0075368_10058609
462 Ga0075363_100101190
463 Ga0075363_100102164
464 Ga0075364_10005760
465 Ga0075364_10028232
466 Ga0075364_10072074
467 Ga0075364_10081860
468 Ga0075432_10006322
469 Ga0075362_10008417
470 Ga0075367_10155960
471 Ga0075369_10004009
472 Ga0075370_10126634
473 Ga0075430_100020208
474 Ga0075431_100058851
475 Ga0075433_10406546
476 Ga0075429_100150408
477 Ga0097620_100252816
478 Ga0099826_10194429
479 Ga0111539_10014733
480 Ga0111539_10215750
481 Ga0105245_10126759
482 Ga0105245_10145238
483 Ga0105247_10031299
484 Ga0105243_10008484
485 Ga0105243_10133014
486 Ga0105243_10712155
487 Ga0105248_10010722
488 Ga0105248_10464741
489 Ga0105237_10231190
490 Ga0105249_10012619
491 Ga0105249_10143666
492 Ga0105239_10092042
493 Ga0105239_10093432
494 Ga0105239_10418184
495 Ga0105246_10129014
496 Ga0157369_10168457
497 Ga0157374_10315494
498 Ga0157378_10234390
499 Ga0163162_10428383
500 Ga0157375_10117295
501 Ga0157375_10288025
502 Ga0157379_10137689
503 Ga0157379_10188034
504 Ga0157379_10428867
505 Ga0157376_10018263
506 Ga0207710_10021868
507 Ga0207688_10059282
508 Ga0207680_10003455
509 Ga0207647_10034015
510 Ga0207643_10059606
511 Ga0207654_10002701
512 Ga0207693_10015135
513 Ga0207662_10059963
514 Ga0207646_10242363
515 Ga0207687_10095033
516 Ga0207687_10133415
517 Ga0207690_10159279
518 Ga0207690_10318156
519 Ga0207709_10084774
520 Ga0207670_10066693
521 Ga0207669_10180992
522 Ga0207711_10048383
523 Ga0207711_10116623
524 Ga0207679_10089435
525 Ga0207712_10062272
526 Ga0207712_10071659
527 Ga0207668_10005669
528 Ga0207668_10028517
529 Ga0207668_10045225
530 Ga0207658_10001606
531 Ga0207658_10030264
532 Ga0207658_10109713
533 Ga0207677_10128292
534 Ga0207639_10120583
535 Ga0207678_10002060
536 Ga0207678_10071040
537 Ga0207678_10145149
538 Ga0207708_10022166
539 Ga0207702_10382574
540 Ga0207641_10348598
541 Ga0207641_10476066
542 Ga0207648_10043223
543 Ga0207676_10505521
544 Ga0207675_100062795
545 Ga0207675_100201459
546 Ga0207698_10059318
547 Ga0268266_10002551
548 Ga0268266_10023152
549 Ga0268266_10134801
550 Ga0268266_10153259
551 Ga0268266_10413823
552 Ga0268265_10000868
553 Ga0268265_10019211
554 Ga0268265_10158152
555 Ga0268265_10408554
556 Ga0268264_10115254
557 Ga0268264_10183236
558 Ga0268264_10276498
559 Ga0268264_10305930
560 Ga0307515_10044464
561 Ga0307511_10047936
562 Ga0307512_10091962
563 Ga0307509_10097721
564 Ga0307508_10051574
565 Ga0307514_10016237
566 Ga0307516_10000888
567 Ga0307516_10025893
568 Ga0307516_10045274
569 Ga0307410_10010655
570 Ga0307409_100007357
571 Ga0307409_100041116
572 Ga0307416_100016150
573 Ga0307414_10614514
574 Ga0307415_100000639
575 Ga0307415_100044048
576 Ga0307415_100286590
577 Ga0307507_10006790
578 Ga0307510_10000278
579 Ga0373926_0012944
580 Ga0373936_0003333
581 Ga0373946_0016377
582 Ga0373935_0004192
583 Ga0373933_0115611
584 Ga0373947_0012056
585 Ga0395899_0010058
586 Ga0395900_0041395
587 Ga0395900_0074338
588 Ga0395900_0118844
589 Ga0395900_0139916
590 Ga0395898_0009817
591 Ga0395898_0021436
592 Ga0395898_0039808
593 Ga0395898_0109661
594 Ga0395898_0220907
595 Ga0395905_0002804
596 Ga0395905_0315340
597 Ga0395901_0017001
598 Ga0395901_0091642
599 Ga0395901_0205775
600 Ga0395901_0467453
601 Ga0436365_1525294
602 Ga0451837_1334826
603 Ga0451853_2308981
604 Ga0439448_0015522
605 Ga0450903_011930
606 Ga0466969_0043199
607 Ga0466966_0019774
608 Ga0466961_0018996
609 Ga0466961_0054422
610 Ga0466961_0186781
611 Ga0466963_0339013
612 Ga0466964_0102664
613 Ga0466968_0000307
614 Ga0466970_0008805
615 Ga0466970_0030167
616 Ga0466970_0055322
617 Ga0466970_0057577
618 Ga0466970_0066862
619 Ga0466957_0006666
620 Ga0466957_0035198
621 Ga0466957_0036521
622 Ga0466957_0172373
623 Ga0466960_0012392
624 Ga0466960_0061681
625 Ga0466959_0151982
626 Ga0466958_0273326
627 Ga0466967_0501521
628 Ga0495592_0013955
629 Ga0495592_0225415
630 Ga0495603_0015507
631 Ga0495603_0188909
632 Ga0495651_0001754
633 Ga0495651_0018743
634 Ga0495651_0043097
635 Ga0495653_0012302
636 Ga0495653_0014128
637 Ga0495580_0291919
638 Ga0495582_0036652
639 Ga0495605_0001907
640 Ga0495662_0112690
641 Ga0495662_0159047
642 Ga0495664_0003243
643 Ga0495585_0008856
644 Ga0495585_0036101
645 Ga0495594_0009229
646 Ga0495607_0003892
647 Ga0495583_0003645
648 Ga0495606_0002084
649 Ga0495608_0023281
650 Ga0495610_0045543
651 Ga0495616_0003054
652 Ga0495618_0034420
653 Ga0495620_0001583
654 Ga0495628_0002815
655 Ga0495628_0006983
656 Ga0495628_0020286
657 Ga0495628_0036597
658 Ga0495628_0075339
659 Ga0495631_0010312
660 Ga0495666_0004321
661 Ga0495652_0001490
662 Ga0495652_0004928
663 Ga0495640_0016204
664 Ga0495597_0017605
665 Ga0495645_0231770
666 Ga0495645_0277245
667 Ga0495622_0010448
668 Ga0495667_0004568
669 Ga0495667_0007055
670 Ga0495656_0046517
671 Ga0495634_0081774
672 Ga0495611_0012155
673 Ga0495625_0011492
674 Ga0495635_0000572
675 Ga0495635_0135804
676 Ga0495661_0095574
677 Ga0495657_0010022
678 Ga0495657_0032947
679 Ga0495657_0037921
680 Ga0495599_0002468
681 Ga0495646_0013932
682 Ga0495646_0141294
683 Ga0495613_0015669
684 Ga0495613_0016678
685 Ga0495613_0066629
686 Ga0495624_0001764
687 Ga0495624_0010370
688 Ga0495624_0064090
689 Ga0495649_0011072
690 Ga0495589_0015561
691 Ga0495600_0006566
692 Ga0495660_0002102
693 Ga0495660_0010442
694 Ga0495581_0054842
695 Ga0495581_0108433
696 Ga0495604_0032615
697 Ga0495604_0062296
698 Ga0495604_0219303
699 Ga0495604_0275064
700 Ga0495674_0024790
701 Ga0495674_0067044
702 Ga0495676_0010726
703 Ga0495676_0011833
704 Ga0495676_0028811
705 Ga0495676_0035614
706 Ga0495680_0008382
707 Ga0495680_0011348
708 Ga0495680_0011596
709 Ga0495683_0001033
710 Ga0495683_0001924
711 Ga0495687_005671
712 Ga0495675_0001664
713 Ga0495675_0182273
714 Ga0495685_001898
715 Ga0495685_007882
716 Ga0495685_025224
717 Ga0495684_0001821
718 Ga0495684_0115280
719 Ga0495593_0009615
720 Ga0495593_0032378
721 Ga0495593_0047872
722 Ga0495602_0019986
723 Ga0495602_0037568
724 Ga0495602_0320928
725 Ga0495614_0002370
726 Ga0496100_0061209
727 Ga0496104_0110072
728 Ga0496105_0245700
729 Ga0496108_0000008
730 Ga0496108_0000066
731 Ga0496108_0025508
732 Ga0496108_0130755
733 Ga0496109_0104774
734 Ga0496110_0059337
735 Ga0496111_0145547
736 Ga0496112_0044260
737 Ga0496112_0113639
738 Ga0496112_0172443
739 Ga0496122_0028693
740 Ga0496123_0050117
741 Ga0496126_0373275
742 Ga0501033_0026646
743 Ga0501033_0135629
744 Ga0501034_0646882
745 Ga0501036_0176868
746 Ga0501037_0222283
747 Ga0501043_0024699
748 Ga0501047_0011638
749 Ga0501047_0027337
750 Ga0501048_0145264
751 Ga0501080_0388583
752 Ga0501035_0029591
753 Ga0501035_0058266
754 Ga0501044_0037169
755 Ga0501044_0041818
756 nmdc:mga03n38_1958_c1
757 nmdc:mga03n38_343_c1
758 nmdc:mga03n38_75675_c1
759 nmdc:mga03n38_85730_c1
760 nmdc:mga00v17_2462_c1
761 nmdc:mga00v17_288016_c1
762 nmdc:mga00v17_29006_c1
763 nmdc:mga00v17_3305_c1
764 nmdc:mga00v17_42185_c1
765 nmdc:mga0yw44_10794_c1
766 nmdc:mga0yw44_17008_c1
767 nmdc:mga0yw44_37514_c1
768 nmdc:mga04h51_34050_c1
769 nmdc:mga07m45_95388_c1
770 nmdc:mga05p37_652934_c1
771 nmdc:mga09592_405247_c1
772 nmdc:mga06r32_150112_c1
773 nmdc:mga08y16_261705_c1
774 nmdc:mga08y16_65890_c1
775 Ga0495601_0009783
776 Ga0495601_0015367
777 Ga0495595_0124195
778 Ga0500559_0006254
779 Ga0500600_0011208
780 Ga0500616_0000216
781 2585302802
782 2585317550
783 2616701903
784 2644262203
785 2644268470
786 2676203451
787 2676495303
788 2753264576
789 2774848027
790 2784585541
791 2791914520
792 2799185629
793 2808849201
794 2868088925
795 2870784739
796 2887479334
797 2891402757
798 2917738321
799 2919469078
800 2919719689
801 2954006310
802 2954386309
803 2954705146
804 2954711830
805 2954721746
806 2954740079
807 2954740660
808 2954758903
809 2954759668
810 8023623977
811 8047712187
812 8047717930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

216

338

0.9

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

185

291

0.86

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

55

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8838 1 291
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8736 1 290
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.8733 1 290
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8724 1 291
7kc2-assembly1.cif.gz_A symmetry in yeast alcohol dehydrogenase 1 -closed form with nadh 0.8667 2 290
ID Description Score Start End Superfamily
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9839 1 92 3.90.180.10
af_Q54II4_2_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9541 2 106 3.90.180.10
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9499 3 106 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9469 16 106 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.943 15 106 3.90.180.10
ID Description Score Start End GO Terms
AF-Q0JDV3-F1-model_v4 Os04g0372700 protein 0.9828 1 92
AF-A0A0L8MXM1-F1-model_v4 deleted 0.9742 1 107
AF-J9SIX0-F1-model_v4 NADPH:quinone reductase-related Zn-dependent oxidoreductase 0.9739 112 291
AF-A0A2V6Q412-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9692 1 106
AF-A0A6G3WQ14-F1-model_v4 NADP-dependent oxidoreductase 0.9689 1 106 GO:0016628

Map