F436274

General Info

Members Datasets Scaffolds Average Seq Length
406 210 812 156

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000011|Ga0395905_0000011_391353_391871
Length 172
Sequence MLNIDPKVSLNSAKVNYFCPMEVNRFNIRVYGILIDEQKRVLVTDELIKGNPITKLPGGGLEFGEGTIDCIKREFMEETNNAVEVTGHFYTTDYFQVSAYNKAHQIISIYYLVKPVSTFQLKSTEKVFDFGEDKRYIQTFRWIPLKAISENDFTLAIDKVVGKMLKEQYAGG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 2738543023 Pedobacter sp. OK628 Isolate Unclassified
207 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
208 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
209 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
210 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 0.49
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 14.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000011 3300037471 Bacteria 424563
2 rootH1_10008187 3300003323 Bacteria 6341
3 Ga0065712_10142118 3300005290 Bacteria 1432
4 Ga0070658_10000019 3300005327 Bacteria 194742
5 Ga0070658_10056001 3300005327 Bacteria 3204
6 Ga0070658_10294586 3300005327 Bacteria 1383
7 Ga0070676_10311147 3300005328 Bacteria 1071
8 Ga0070683_100010531 3300005329 Bacteria 7950
9 Ga0070683_100016586 3300005329 Bacteria 6500
10 Ga0070683_100423098 3300005329 Bacteria 1271
11 Ga0070690_100041628 3300005330 Bacteria 2909
12 Ga0070670_100091712 3300005331 Bacteria 2612
13 Ga0070670_100306574 3300005331 Bacteria 1389
14 Ga0070670_101701900 3300005331 Unclassified 580
15 Ga0068869_100024847 3300005334 Unclassified 4153
16 Ga0068869_100137778 3300005334 Unclassified 1882
17 Ga0068869_100149885 3300005334 Bacteria 1808
18 Ga0070666_10079635 3300005335 Bacteria 2238
19 Ga0070680_100032023 3300005336 Bacteria 4230
20 Ga0070680_100034249 3300005336 Bacteria 4095
21 Ga0070680_100060149 3300005336 Bacteria 3109
22 Ga0070682_100247037 3300005337 Bacteria 1284
23 Ga0068868_100017535 3300005338 Bacteria 5338
24 Ga0068868_100711680 3300005338 Unclassified 899
25 Ga0070660_100090592 3300005339 Bacteria 2411
26 Ga0070660_100285918 3300005339 Unclassified 1350
27 Ga0070660_100702353 3300005339 Unclassified 848
28 Ga0070689_100051848 3300005340 Bacteria 3172
29 Ga0070689_100072876 3300005340 Unclassified 2685
30 Ga0070689_100602759 3300005340 Bacteria 951
31 Ga0070687_100256146 3300005343 Bacteria 1090
32 Ga0070661_100010397 3300005344 Bacteria 6469
33 Ga0070661_100220574 3300005344 Bacteria 1454
34 Ga0070661_100772548 3300005344 Bacteria 787
35 Ga0070668_100352638 3300005347 Bacteria 1246
36 Ga0070669_100168828 3300005353 Bacteria 1704
37 Ga0070669_100669612 3300005353 Unclassified 874
38 Ga0070669_100810787 3300005353 Unclassified 796
39 Ga0070675_100136296 3300005354 Bacteria 2095
40 Ga0070671_100057292 3300005355 Bacteria 3242
41 Ga0070671_100301096 3300005355 Unclassified 1365
42 Ga0070671_100641178 3300005355 Unclassified 919
43 Ga0070671_100907306 3300005355 Bacteria 770
44 Ga0070688_100087737 3300005365 Bacteria 2027
45 Ga0070688_100132853 3300005365 Bacteria 1682
46 Ga0070688_100705529 3300005365 Bacteria 782
47 Ga0070659_100032605 3300005366 Bacteria 4041
48 Ga0070659_100110696 3300005366 Bacteria 2216
49 Ga0070667_100154772 3300005367 Bacteria 2016
50 Ga0070667_100259713 3300005367 Bacteria 1555
51 Ga0070667_100583291 3300005367 Bacteria 1029
52 Ga0070667_100832985 3300005367 Bacteria 857
53 Ga0070663_100073009 3300005455 Bacteria 2502
54 Ga0070678_100033365 3300005456 Bacteria 3573
55 Ga0070678_100613921 3300005456 Bacteria 972
56 Ga0070662_100501845 3300005457 Bacteria 1012
57 Ga0070662_100793160 3300005457 Unclassified 805
58 Ga0070681_10199594 3300005458 Bacteria 1919
59 Ga0070681_10975335 3300005458 Bacteria 767
60 Ga0070685_11588007 3300005466 Unclassified 506
61 Ga0070707_101520298 3300005468 Bacteria 636
62 Ga0070679_100117592 3300005530 Bacteria 2643
63 Ga0070679_100463751 3300005530 Bacteria 1211
64 Ga0070684_100009620 3300005535 Bacteria 7619
65 Ga0070684_100014653 3300005535 Bacteria 6358
66 Ga0070684_100336634 3300005535 Bacteria 1387
67 Ga0068853_100004508 3300005539 Bacteria 10803
68 Ga0068853_100014765 3300005539 Bacteria 6410
69 Ga0068853_100028915 3300005539 Bacteria 4666
70 Ga0068853_100121157 3300005539 Bacteria 2334
71 Ga0070672_100150139 3300005543 Bacteria 1927
72 Ga0070672_100308047 3300005543 Unclassified 1344
73 Ga0070686_100629272 3300005544 Bacteria 849
74 Ga0070704_100174578 3300005549 Bacteria 1713
75 Ga0070664_100001985 3300005564 Bacteria 16400
76 Ga0070664_100030316 3300005564 Bacteria 4512
77 Ga0070664_100321407 3300005564 Bacteria 1402
78 Ga0070664_100858772 3300005564 Bacteria 850
79 Ga0068857_100054276 3300005577 Bacteria 3555
80 Ga0068857_100060236 3300005577 Bacteria 3372
81 Ga0068857_100087992 3300005577 Bacteria 2779
82 Ga0068857_100346136 3300005577 Bacteria 1376
83 Ga0068857_100366751 3300005577 Bacteria 1336
84 Ga0070702_100204398 3300005615 Bacteria 1310
85 Ga0068852_100405164 3300005616 Bacteria 1342
86 Ga0068852_101050765 3300005616 Bacteria 834
87 Ga0068859_100255365 3300005617 Bacteria 1843
88 Ga0068859_100411464 3300005617 Bacteria 1448
89 Ga0068859_100745232 3300005617 Unclassified 1069
90 Ga0068859_100855766 3300005617 Bacteria 995
91 Ga0068859_101390684 3300005617 Bacteria 774
92 Ga0068864_100002992 3300005618 Bacteria 13977
93 Ga0068864_100767520 3300005618 Bacteria 946
94 Ga0068864_101366350 3300005618 Bacteria 710
95 Ga0068866_10041577 3300005718 Bacteria 2282
96 Ga0068866_10976772 3300005718 Bacteria 600
97 Ga0068861_100181575 3300005719 Bacteria 1752
98 Ga0068851_10710608 3300005834 Bacteria 619
99 Ga0068858_100135013 3300005842 Bacteria 2315
100 Ga0068858_101093836 3300005842 Unclassified 782
101 Ga0068860_100068974 3300005843 Bacteria 3360
102 Ga0068860_101470779 3300005843 Unclassified 703
103 Ga0068862_100114174 3300005844 Bacteria 2374
104 Ga0068862_100404980 3300005844 Bacteria 1277
105 Ga0068862_101670100 3300005844 Bacteria 645
106 Ga0075366_10077043 3300006195 Bacteria 1990
107 Ga0075366_10281142 3300006195 Unclassified 1017
108 Ga0075366_10478594 3300006195 Unclassified 769
109 Ga0097621_100095276 3300006237 Bacteria 2496
110 Ga0097621_100263080 3300006237 Bacteria 1514
111 Ga0097621_100715690 3300006237 Bacteria 923
112 Ga0097621_100919843 3300006237 Bacteria 815
113 Ga0075370_10235454 3300006353 Bacteria 1084
114 Ga0075370_10710665 3300006353 Unclassified 611
115 Ga0068871_101975871 3300006358 Bacteria 555
116 Ga0075429_100143882 3300006880 Bacteria 2087
117 Ga0068865_100295460 3300006881 Unclassified 1294
118 Ga0097620_100255372 3300006931 Bacteria 1843
119 Ga0097620_100411472 3300006931 Bacteria 1448
120 Ga0097620_100745270 3300006931 Unclassified 1069
121 Ga0097620_100855573 3300006931 Bacteria 995
122 Ga0097620_101390518 3300006931 Bacteria 774
123 Ga0105251_10111756 3300009011 Bacteria 1244
124 Ga0105240_10024075 3300009093 Bacteria 8039
125 Ga0105240_10678277 3300009093 Bacteria 1127
126 Ga0105240_11308934 3300009093 Bacteria 764
127 Ga0111539_10189795 3300009094 Bacteria 2398
128 Ga0111539_10458565 3300009094 Bacteria 1484
129 Ga0111539_11385519 3300009094 Bacteria 816
130 Ga0105245_10381120 3300009098 Unclassified 1404
131 Ga0105245_11067772 3300009098 Bacteria 853
132 Ga0105243_11473813 3300009148 Bacteria 703
133 Ga0105241_10007988 3300009174 Bacteria 7782
134 Ga0105241_10230347 3300009174 Bacteria 1562
135 Ga0105241_10358660 3300009174 Bacteria 1268
136 Ga0105241_10436965 3300009174 Bacteria 1155
137 Ga0105242_10007005 3300009176 Bacteria 8705
138 Ga0105242_10206352 3300009176 Bacteria 1748
139 Ga0105242_10215070 3300009176 Unclassified 1715
140 Ga0105242_13029401 3300009176 Bacteria 520
141 Ga0105248_10880041 3300009177 Bacteria 1011
142 Ga0105237_10000193 3300009545 Bacteria 86593
143 Ga0105237_11389712 3300009545 Bacteria 708
144 Ga0105237_11984163 3300009545 Bacteria 590
145 Ga0105238_10133314 3300009551 Bacteria 2462
146 Ga0105238_10143348 3300009551 Bacteria 2366
147 Ga0105249_10357600 3300009553 Bacteria 1481
148 Ga0105249_10776777 3300009553 Bacteria 1021
149 Ga0105249_11033589 3300009553 Bacteria 891
150 Ga0105249_12545936 3300009553 Bacteria 584
151 Ga0105239_10245870 3300010375 Bacteria 2009
152 Ga0105239_11579276 3300010375 Bacteria 759
153 Ga0105246_10156391 3300011119 Bacteria 1732
154 Ga0157373_10018891 3300013100 Bacteria 5016
155 Ga0157373_10089998 3300013100 Bacteria 2161
156 Ga0157373_10636933 3300013100 Unclassified 778
157 Ga0157371_10009697 3300013102 Bacteria 7558
158 Ga0157371_10018644 3300013102 Bacteria 5127
159 Ga0157371_10042607 3300013102 Bacteria 3235
160 Ga0157371_10087772 3300013102 Bacteria 2202
161 Ga0157371_10584599 3300013102 Bacteria 830
162 Ga0157370_10191253 3300013104 Bacteria 1899
163 Ga0157370_10422838 3300013104 Bacteria 1226
164 Ga0157370_10526937 3300013104 Bacteria 1084
165 Ga0157370_10835687 3300013104 Unclassified 837
166 Ga0157369_10013999 3300013105 Bacteria 9063
167 Ga0157369_10209104 3300013105 Bacteria 2046
168 Ga0157374_10013141 3300013296 Bacteria 7222
169 Ga0157374_10023490 3300013296 Bacteria 5515
170 Ga0157374_10027323 3300013296 Bacteria 5145
171 Ga0157374_10184284 3300013296 Bacteria 2040
172 Ga0157374_10301390 3300013296 Bacteria 1586
173 Ga0157378_10016719 3300013297 Bacteria 6429
174 Ga0157378_10059089 3300013297 Bacteria 3420
175 Ga0157378_10318097 3300013297 Unclassified 1511
176 Ga0157378_10543526 3300013297 Unclassified 1166
177 Ga0163162_10118048 3300013306 Bacteria 2755
178 Ga0163162_10143812 3300013306 Bacteria 2499
179 Ga0163162_10156322 3300013306 Unclassified 2400
180 Ga0163162_10196877 3300013306 Bacteria 2144
181 Ga0163162_10326418 3300013306 Bacteria 1667
182 Ga0163162_10389099 3300013306 Bacteria 1527
183 Ga0163162_10657438 3300013306 Bacteria 1171
184 Ga0163162_10689349 3300013306 Bacteria 1144
185 Ga0163162_10863415 3300013306 Unclassified 1020
186 Ga0157372_10024446 3300013307 Bacteria 6562
187 Ga0157372_10368708 3300013307 Bacteria 1673
188 Ga0157372_10420019 3300013307 Bacteria 1558
189 Ga0157372_10576061 3300013307 Bacteria 1312
190 Ga0157372_10651551 3300013307 Bacteria 1226
191 Ga0157372_10711226 3300013307 Bacteria 1169
192 Ga0157372_11031902 3300013307 Bacteria 952
193 Ga0157372_11432109 3300013307 Bacteria 796
194 Ga0157375_10002980 3300013308 Bacteria 14711
195 Ga0157375_10030152 3300013308 Bacteria 5111
196 Ga0157375_10049671 3300013308 Bacteria 4111
197 Ga0157375_10127200 3300013308 Bacteria 2664
198 Ga0157375_10136795 3300013308 Bacteria 2575
199 Ga0157375_10350679 3300013308 Bacteria 1642
200 Ga0157375_10487285 3300013308 Unclassified 1398
201 Ga0157375_10641145 3300013308 Bacteria 1219
202 Ga0157375_10743698 3300013308 Bacteria 1132
203 Ga0157375_11029478 3300013308 Bacteria 962
204 Ga0163163_10000176 3300014325 Bacteria 66751
205 Ga0163163_10125169 3300014325 Bacteria 2608
206 Ga0163163_10339226 3300014325 Bacteria 1558
207 Ga0163163_10904988 3300014325 Bacteria 946
208 Ga0157380_10000156 3300014326 Bacteria 39392
209 Ga0157377_10018439 3300014745 Bacteria 3626
210 Ga0157377_10025096 3300014745 Bacteria 3176
211 Ga0157377_10100658 3300014745 Bacteria 1721
212 Ga0157377_10268288 3300014745 Bacteria 1113
213 Ga0157379_10123875 3300014968 Bacteria 2326
214 Ga0157379_10471748 3300014968 Bacteria 1161
215 Ga0157379_10529670 3300014968 Unclassified 1094
216 Ga0157379_10831717 3300014968 Bacteria 873
217 Ga0157376_10176515 3300014969 Bacteria 1949
218 Ga0157376_10208686 3300014969 Bacteria 1802
219 Ga0157376_10407344 3300014969 Bacteria 1316
220 Ga0157376_11875025 3300014969 Unclassified 636
221 Ga0163161_10216815 3300017792 Unclassified 1480
222 Ga0207682_10059977 3300025893 Bacteria 1590
223 Ga0207688_10100445 3300025901 Bacteria 1670
224 Ga0207647_10030122 3300025904 Unclassified 3504
225 Ga0207645_10007389 3300025907 Bacteria 7770
226 Ga0207705_10000069 3300025909 Bacteria 133094
227 Ga0207705_10415919 3300025909 Bacteria 1040
228 Ga0207654_10144760 3300025911 Bacteria 1520
229 Ga0207654_10302088 3300025911 Bacteria 1089
230 Ga0207707_10248746 3300025912 Bacteria 1544
231 Ga0207695_10018519 3300025913 Bacteria 8049
232 Ga0207695_10415599 3300025913 Bacteria 1229
233 Ga0207671_10000657 3300025914 Bacteria 45082
234 Ga0207671_10477143 3300025914 Unclassified 994
235 Ga0207671_10828114 3300025914 Bacteria 733
236 Ga0207660_10055628 3300025917 Bacteria 2828
237 Ga0207660_10068306 3300025917 Bacteria 2577
238 Ga0207660_10253398 3300025917 Bacteria 1390
239 Ga0207657_10088626 3300025919 Bacteria 2586
240 Ga0207657_10099651 3300025919 Bacteria 2413
241 Ga0207649_10003053 3300025920 Bacteria 9195
242 Ga0207649_10045420 3300025920 Bacteria 2693
243 Ga0207649_10885954 3300025920 Bacteria 699
244 Ga0207652_10124637 3300025921 Bacteria 2294
245 Ga0207652_10135441 3300025921 Bacteria 2199
246 Ga0207652_10272340 3300025921 Bacteria 1527
247 Ga0207681_10050477 3300025923 Bacteria 2815
248 Ga0207681_10610344 3300025923 Unclassified 902
249 Ga0207694_10307434 3300025924 Bacteria 1306
250 Ga0207650_10478378 3300025925 Bacteria 1039
251 Ga0207650_11327174 3300025925 Unclassified 612
252 Ga0207659_10500010 3300025926 Bacteria 1029
253 Ga0207687_10597810 3300025927 Unclassified 929
254 Ga0207644_10106833 3300025931 Bacteria 2111
255 Ga0207644_10253704 3300025931 Unclassified 1404
256 Ga0207644_10569953 3300025931 Unclassified 938
257 Ga0207644_10909547 3300025931 Bacteria 738
258 Ga0207690_10113325 3300025932 Bacteria 1957
259 Ga0207690_10914770 3300025932 Bacteria 728
260 Ga0207706_10030947 3300025933 Bacteria 4772
261 Ga0207706_10037886 3300025933 Bacteria 4279
262 Ga0207686_10032426 3300025934 Bacteria 3109
263 Ga0207686_10054716 3300025934 Unclassified 2501
264 Ga0207670_10023655 3300025936 Bacteria 3828
265 Ga0207669_10121250 3300025937 Bacteria 1776
266 Ga0207669_11039356 3300025937 Bacteria 690
267 Ga0207669_11886859 3300025937 Bacteria 511
268 Ga0207704_10215268 3300025938 Unclassified 1417
269 Ga0207691_10096599 3300025940 Bacteria 2641
270 Ga0207689_10007333 3300025942 Bacteria 9673
271 Ga0207689_10095378 3300025942 Unclassified 2443
272 Ga0207661_10001489 3300025944 Bacteria 15853
273 Ga0207661_10046653 3300025944 Bacteria 3436
274 Ga0207661_10525080 3300025944 Bacteria 1083
275 Ga0207679_10096745 3300025945 Bacteria 2298
276 Ga0207679_10137861 3300025945 Bacteria 1967
277 Ga0207679_10514843 3300025945 Bacteria 1069
278 Ga0207679_10521569 3300025945 Bacteria 1063
279 Ga0207667_10676648 3300025949 Bacteria 1036
280 Ga0207668_10737984 3300025972 Bacteria 868
281 Ga0207640_10565567 3300025981 Bacteria 957
282 Ga0207658_10119371 3300025986 Bacteria 2099
283 Ga0207658_10392593 3300025986 Unclassified 1218
284 Ga0207658_10682305 3300025986 Bacteria 927
285 Ga0207658_11169293 3300025986 Unclassified 703
286 Ga0207677_10325427 3300026023 Bacteria 1279
287 Ga0207703_10490132 3300026035 Bacteria 1152
288 Ga0207639_10067706 3300026041 Bacteria 2779
289 Ga0207639_10089823 3300026041 Bacteria 2456
290 Ga0207639_10503850 3300026041 Bacteria 1107
291 Ga0207678_10099422 3300026067 Bacteria 2485
292 Ga0207708_10302461 3300026075 Bacteria 1301
293 Ga0207708_10350643 3300026075 Bacteria 1211
294 Ga0207702_10010234 3300026078 Bacteria 7854
295 Ga0207641_10965004 3300026088 Bacteria 848
296 Ga0207648_10023846 3300026089 Bacteria 5472
297 Ga0207676_10012723 3300026095 Bacteria 6036
298 Ga0207676_11053331 3300026095 Unclassified 803
299 Ga0207676_11309676 3300026095 Bacteria 719
300 Ga0207674_10003604 3300026116 Bacteria 18880
301 Ga0207674_10026446 3300026116 Bacteria 6162
302 Ga0207674_10029767 3300026116 Bacteria 5745
303 Ga0207674_10069011 3300026116 Bacteria 3555
304 Ga0207674_10224072 3300026116 Bacteria 1829
305 Ga0207674_10276255 3300026116 Bacteria 1628
306 Ga0207675_100003242 3300026118 Bacteria 15948
307 Ga0207683_10010880 3300026121 Bacteria 7761
308 Ga0207698_10198858 3300026142 Bacteria 1793
309 Ga0207698_10661339 3300026142 Bacteria 1036
310 Ga0207428_10231579 3300027907 Bacteria 1382
311 Ga0207428_10839690 3300027907 Bacteria 651
312 Ga0268266_10148716 3300028379 Bacteria 2109
313 Ga0268265_10117569 3300028380 Unclassified 2184
314 Ga0268265_10376659 3300028380 Bacteria 1304
315 Ga0268265_11163771 3300028380 Bacteria 768
316 Ga0268264_10248972 3300028381 Bacteria 1650
317 Ga0265336_10006060 3300028666 Bacteria 4396
318 Ga0307517_10012762 3300028786 Bacteria 11488
319 Ga0307515_10000001 3300028794 Bacteria 4259510
320 Ga0307515_10002940 3300028794 Bacteria 36133
321 Ga0307515_10242211 3300028794 Bacteria 1572
322 Ga0265327_10047371 3300031251 Bacteria 2269
323 Ga0307509_10101308 3300031507 Bacteria 2915
324 Ga0307412_10183465 3300031911 Bacteria 1576
325 Ga0307510_10016576 3300033180 Bacteria 8698
326 Ga0373934_0204495 3300035086 Bacteria 813
327 Ga0373953_0109752 3300035117 Bacteria 1166
328 Ga0373943_0294895 3300035170 Bacteria 920
329 Ga0373924_0023377 3300035410 Unclassified 2424
330 Ga0373933_0006824 3300035724 Bacteria 6215
331 Ga0373937_0006391 3300036401 Bacteria 10170
332 Ga0395899_0078619 3300037312 Bacteria 2404
333 Ga0395900_0000358 3300037418 Bacteria 66350
334 Ga0395900_0340169 3300037418 Bacteria 1476
335 Ga0395898_0155066 3300037466 Bacteria 2191
336 Ga0395905_0001131 3300037471 Bacteria 33375
337 Ga0395905_0027016 3300037471 Bacteria 5412
338 Ga0395901_0004727 3300038443 Bacteria 13748
339 Ga0400489_49014 3300039093 Unclassified 1119
340 Ga0451802_1291506 3300041460 Bacteria 1470
341 Ga0451807_2080684 3300041486 Unclassified 732
342 Ga0466972_0000159 3300044658 Bacteria 54274
343 Ga0466968_0479347 3300044735 Bacteria 618
344 Ga0466970_0000562 3300044765 Bacteria 18148
345 Ga0495592_0013800 3300046454 Bacteria 6144
346 Ga0495592_0300829 3300046454 Unclassified 1043
347 Ga0495638_0204118 3300046460 Bacteria 1114
348 Ga0495651_0360359 3300046462 Bacteria 958
349 Ga0495662_0312355 3300046476 Bacteria 773
350 Ga0495608_0017974 3300046511 Bacteria 4886
351 Ga0495628_0042506 3300046516 Bacteria 3625
352 Ga0495630_0015693 3300046517 Bacteria 5535
353 Ga0495632_0225815 3300046519 Bacteria 846
354 Ga0495667_0094195 3300046559 Bacteria 1939
355 Ga0495634_0433394 3300046642 Bacteria 777
356 Ga0495625_0059347 3300046660 Bacteria 2715
357 Ga0495635_0041387 3300046663 Bacteria 3183
358 Ga0495657_0250217 3300046675 Bacteria 1067
359 Ga0495604_0101692 3300047317 Bacteria 2111
360 Ga0495683_0072706 3300047323 Bacteria 1687
361 Ga0495675_0217389 3300047444 Bacteria 1158
362 Ga0495684_0134756 3300047471 Bacteria 1854
363 Ga0495686_0006170 3300047472 Bacteria 9265
364 Ga0495686_0013794 3300047472 Bacteria 5599
365 Ga0496121_0018257 3300048924 Bacteria 7087
366 Ga0496126_0011452 3300048929 Bacteria 9178
367 Ga0501032_0000947 3300049569 Bacteria 23434
368 Ga0501034_0019093 3300049571 Bacteria 7019
369 Ga0501034_0294209 3300049571 Unclassified 1561
370 Ga0501034_0393073 3300049571 Unclassified 1310
371 Ga0501036_0039263 3300049572 Bacteria 4006
372 Ga0501037_0242815 3300049573 Bacteria 1262
373 Ga0501038_0018795 3300049574 Bacteria 6238
374 Ga0501039_0033080 3300049575 Bacteria 3989
375 Ga0501043_0057021 3300049579 Bacteria 3067
376 Ga0501043_0427975 3300049579 Bacteria 997
377 Ga0501046_0005083 3300049580 Bacteria 11795
378 Ga0501047_0032712 3300049581 Bacteria 5021
379 Ga0501067_0261994 3300049583 Bacteria 962
380 Ga0501070_0049245 3300049586 Bacteria 3499
381 Ga0501072_0252936 3300049588 Bacteria 1403
382 Ga0501073_0019741 3300049589 Bacteria 4864
383 Ga0501074_0012376 3300049590 Bacteria 6202
384 Ga0501080_0056535 3300049742 Bacteria 3653
385 Ga0501083_0041120 3300049744 Bacteria 3136
386 Ga0501035_0126883 3300049822 Bacteria 2227
387 Ga0501044_0030590 3300049823 Bacteria 5673
388 nmdc:mga0k408_132439_c1 3300050493 Unclassified 1480
389 nmdc:mga0k408_76556_c1 3300050493 Bacteria 1955
390 nmdc:mga07m45_122343_c1 3300050496 Bacteria 1503
391 nmdc:mga09592_166311_c1 3300050508 Bacteria 1906
392 nmdc:mga08y16_190353_c1 3300050511 Bacteria 2128
393 nmdc:mga08y16_261478_c1 3300050511 Bacteria 1787
394 nmdc:mga08y16_347999_c1 3300050511 Bacteria 1523
395 nmdc:mga0rr50_1328522_c1 3300050513 Unclassified 609
396 Ga0500644_0012781 3300053088 Bacteria 2331
397 Ga0500562_016733 3300053108 Unclassified 1887
398 Ga0500594_0344915 3300053118 Bacteria 501
399 Ga0500589_041975 3300053147 Bacteria 2134
400 Ga0500616_0370559 3300053153 Bacteria 578
401 Ga0500645_008906 3300053730 Bacteria 3395
402 2739301305 2738543023 Bacteria 6767879
403 2919192040 2919191525 Bacteria 5765973
404 2929156436 2929154850 Bacteria 6753285
405 8054310606 8054307821 Bacteria 5212224
406 8055589077 8055588893 Bacteria 3619545
407 Ga0395905_0000011
408 rootH1_10008187
409 Ga0065712_10142118
410 Ga0070658_10000019
411 Ga0070658_10056001
412 Ga0070658_10294586
413 Ga0070676_10311147
414 Ga0070683_100010531
415 Ga0070683_100016586
416 Ga0070683_100423098
417 Ga0070690_100041628
418 Ga0070670_100091712
419 Ga0070670_100306574
420 Ga0070670_101701900
421 Ga0068869_100024847
422 Ga0068869_100137778
423 Ga0068869_100149885
424 Ga0070666_10079635
425 Ga0070680_100032023
426 Ga0070680_100034249
427 Ga0070680_100060149
428 Ga0070682_100247037
429 Ga0068868_100017535
430 Ga0068868_100711680
431 Ga0070660_100090592
432 Ga0070660_100285918
433 Ga0070660_100702353
434 Ga0070689_100051848
435 Ga0070689_100072876
436 Ga0070689_100602759
437 Ga0070687_100256146
438 Ga0070661_100010397
439 Ga0070661_100220574
440 Ga0070661_100772548
441 Ga0070668_100352638
442 Ga0070669_100168828
443 Ga0070669_100669612
444 Ga0070669_100810787
445 Ga0070675_100136296
446 Ga0070671_100057292
447 Ga0070671_100301096
448 Ga0070671_100641178
449 Ga0070671_100907306
450 Ga0070688_100087737
451 Ga0070688_100132853
452 Ga0070688_100705529
453 Ga0070659_100032605
454 Ga0070659_100110696
455 Ga0070667_100154772
456 Ga0070667_100259713
457 Ga0070667_100583291
458 Ga0070667_100832985
459 Ga0070663_100073009
460 Ga0070678_100033365
461 Ga0070678_100613921
462 Ga0070662_100501845
463 Ga0070662_100793160
464 Ga0070681_10199594
465 Ga0070681_10975335
466 Ga0070685_11588007
467 Ga0070707_101520298
468 Ga0070679_100117592
469 Ga0070679_100463751
470 Ga0070684_100009620
471 Ga0070684_100014653
472 Ga0070684_100336634
473 Ga0068853_100004508
474 Ga0068853_100014765
475 Ga0068853_100028915
476 Ga0068853_100121157
477 Ga0070672_100150139
478 Ga0070672_100308047
479 Ga0070686_100629272
480 Ga0070704_100174578
481 Ga0070664_100001985
482 Ga0070664_100030316
483 Ga0070664_100321407
484 Ga0070664_100858772
485 Ga0068857_100054276
486 Ga0068857_100060236
487 Ga0068857_100087992
488 Ga0068857_100346136
489 Ga0068857_100366751
490 Ga0070702_100204398
491 Ga0068852_100405164
492 Ga0068852_101050765
493 Ga0068859_100255365
494 Ga0068859_100411464
495 Ga0068859_100745232
496 Ga0068859_100855766
497 Ga0068859_101390684
498 Ga0068864_100002992
499 Ga0068864_100767520
500 Ga0068864_101366350
501 Ga0068866_10041577
502 Ga0068866_10976772
503 Ga0068861_100181575
504 Ga0068851_10710608
505 Ga0068858_100135013
506 Ga0068858_101093836
507 Ga0068860_100068974
508 Ga0068860_101470779
509 Ga0068862_100114174
510 Ga0068862_100404980
511 Ga0068862_101670100
512 Ga0075366_10077043
513 Ga0075366_10281142
514 Ga0075366_10478594
515 Ga0097621_100095276
516 Ga0097621_100263080
517 Ga0097621_100715690
518 Ga0097621_100919843
519 Ga0075370_10235454
520 Ga0075370_10710665
521 Ga0068871_101975871
522 Ga0075429_100143882
523 Ga0068865_100295460
524 Ga0097620_100255372
525 Ga0097620_100411472
526 Ga0097620_100745270
527 Ga0097620_100855573
528 Ga0097620_101390518
529 Ga0105251_10111756
530 Ga0105240_10024075
531 Ga0105240_10678277
532 Ga0105240_11308934
533 Ga0111539_10189795
534 Ga0111539_10458565
535 Ga0111539_11385519
536 Ga0105245_10381120
537 Ga0105245_11067772
538 Ga0105243_11473813
539 Ga0105241_10007988
540 Ga0105241_10230347
541 Ga0105241_10358660
542 Ga0105241_10436965
543 Ga0105242_10007005
544 Ga0105242_10206352
545 Ga0105242_10215070
546 Ga0105242_13029401
547 Ga0105248_10880041
548 Ga0105237_10000193
549 Ga0105237_11389712
550 Ga0105237_11984163
551 Ga0105238_10133314
552 Ga0105238_10143348
553 Ga0105249_10357600
554 Ga0105249_10776777
555 Ga0105249_11033589
556 Ga0105249_12545936
557 Ga0105239_10245870
558 Ga0105239_11579276
559 Ga0105246_10156391
560 Ga0157373_10018891
561 Ga0157373_10089998
562 Ga0157373_10636933
563 Ga0157371_10009697
564 Ga0157371_10018644
565 Ga0157371_10042607
566 Ga0157371_10087772
567 Ga0157371_10584599
568 Ga0157370_10191253
569 Ga0157370_10422838
570 Ga0157370_10526937
571 Ga0157370_10835687
572 Ga0157369_10013999
573 Ga0157369_10209104
574 Ga0157374_10013141
575 Ga0157374_10023490
576 Ga0157374_10027323
577 Ga0157374_10184284
578 Ga0157374_10301390
579 Ga0157378_10016719
580 Ga0157378_10059089
581 Ga0157378_10318097
582 Ga0157378_10543526
583 Ga0163162_10118048
584 Ga0163162_10143812
585 Ga0163162_10156322
586 Ga0163162_10196877
587 Ga0163162_10326418
588 Ga0163162_10389099
589 Ga0163162_10657438
590 Ga0163162_10689349
591 Ga0163162_10863415
592 Ga0157372_10024446
593 Ga0157372_10368708
594 Ga0157372_10420019
595 Ga0157372_10576061
596 Ga0157372_10651551
597 Ga0157372_10711226
598 Ga0157372_11031902
599 Ga0157372_11432109
600 Ga0157375_10002980
601 Ga0157375_10030152
602 Ga0157375_10049671
603 Ga0157375_10127200
604 Ga0157375_10136795
605 Ga0157375_10350679
606 Ga0157375_10487285
607 Ga0157375_10641145
608 Ga0157375_10743698
609 Ga0157375_11029478
610 Ga0163163_10000176
611 Ga0163163_10125169
612 Ga0163163_10339226
613 Ga0163163_10904988
614 Ga0157380_10000156
615 Ga0157377_10018439
616 Ga0157377_10025096
617 Ga0157377_10100658
618 Ga0157377_10268288
619 Ga0157379_10123875
620 Ga0157379_10471748
621 Ga0157379_10529670
622 Ga0157379_10831717
623 Ga0157376_10176515
624 Ga0157376_10208686
625 Ga0157376_10407344
626 Ga0157376_11875025
627 Ga0163161_10216815
628 Ga0207682_10059977
629 Ga0207688_10100445
630 Ga0207647_10030122
631 Ga0207645_10007389
632 Ga0207705_10000069
633 Ga0207705_10415919
634 Ga0207654_10144760
635 Ga0207654_10302088
636 Ga0207707_10248746
637 Ga0207695_10018519
638 Ga0207695_10415599
639 Ga0207671_10000657
640 Ga0207671_10477143
641 Ga0207671_10828114
642 Ga0207660_10055628
643 Ga0207660_10068306
644 Ga0207660_10253398
645 Ga0207657_10088626
646 Ga0207657_10099651
647 Ga0207649_10003053
648 Ga0207649_10045420
649 Ga0207649_10885954
650 Ga0207652_10124637
651 Ga0207652_10135441
652 Ga0207652_10272340
653 Ga0207681_10050477
654 Ga0207681_10610344
655 Ga0207694_10307434
656 Ga0207650_10478378
657 Ga0207650_11327174
658 Ga0207659_10500010
659 Ga0207687_10597810
660 Ga0207644_10106833
661 Ga0207644_10253704
662 Ga0207644_10569953
663 Ga0207644_10909547
664 Ga0207690_10113325
665 Ga0207690_10914770
666 Ga0207706_10030947
667 Ga0207706_10037886
668 Ga0207686_10032426
669 Ga0207686_10054716
670 Ga0207670_10023655
671 Ga0207669_10121250
672 Ga0207669_11039356
673 Ga0207669_11886859
674 Ga0207704_10215268
675 Ga0207691_10096599
676 Ga0207689_10007333
677 Ga0207689_10095378
678 Ga0207661_10001489
679 Ga0207661_10046653
680 Ga0207661_10525080
681 Ga0207679_10096745
682 Ga0207679_10137861
683 Ga0207679_10514843
684 Ga0207679_10521569
685 Ga0207667_10676648
686 Ga0207668_10737984
687 Ga0207640_10565567
688 Ga0207658_10119371
689 Ga0207658_10392593
690 Ga0207658_10682305
691 Ga0207658_11169293
692 Ga0207677_10325427
693 Ga0207703_10490132
694 Ga0207639_10067706
695 Ga0207639_10089823
696 Ga0207639_10503850
697 Ga0207678_10099422
698 Ga0207708_10302461
699 Ga0207708_10350643
700 Ga0207702_10010234
701 Ga0207641_10965004
702 Ga0207648_10023846
703 Ga0207676_10012723
704 Ga0207676_11053331
705 Ga0207676_11309676
706 Ga0207674_10003604
707 Ga0207674_10026446
708 Ga0207674_10029767
709 Ga0207674_10069011
710 Ga0207674_10224072
711 Ga0207674_10276255
712 Ga0207675_100003242
713 Ga0207683_10010880
714 Ga0207698_10198858
715 Ga0207698_10661339
716 Ga0207428_10231579
717 Ga0207428_10839690
718 Ga0268266_10148716
719 Ga0268265_10117569
720 Ga0268265_10376659
721 Ga0268265_11163771
722 Ga0268264_10248972
723 Ga0265336_10006060
724 Ga0307517_10012762
725 Ga0307515_10000001
726 Ga0307515_10002940
727 Ga0307515_10242211
728 Ga0265327_10047371
729 Ga0307509_10101308
730 Ga0307412_10183465
731 Ga0307510_10016576
732 Ga0373934_0204495
733 Ga0373953_0109752
734 Ga0373943_0294895
735 Ga0373924_0023377
736 Ga0373933_0006824
737 Ga0373937_0006391
738 Ga0395899_0078619
739 Ga0395900_0000358
740 Ga0395900_0340169
741 Ga0395898_0155066
742 Ga0395905_0001131
743 Ga0395905_0027016
744 Ga0395901_0004727
745 Ga0400489_49014
746 Ga0451802_1291506
747 Ga0451807_2080684
748 Ga0466972_0000159
749 Ga0466968_0479347
750 Ga0466970_0000562
751 Ga0495592_0013800
752 Ga0495592_0300829
753 Ga0495638_0204118
754 Ga0495651_0360359
755 Ga0495662_0312355
756 Ga0495608_0017974
757 Ga0495628_0042506
758 Ga0495630_0015693
759 Ga0495632_0225815
760 Ga0495667_0094195
761 Ga0495634_0433394
762 Ga0495625_0059347
763 Ga0495635_0041387
764 Ga0495657_0250217
765 Ga0495604_0101692
766 Ga0495683_0072706
767 Ga0495675_0217389
768 Ga0495684_0134756
769 Ga0495686_0006170
770 Ga0495686_0013794
771 Ga0496121_0018257
772 Ga0496126_0011452
773 Ga0501032_0000947
774 Ga0501034_0019093
775 Ga0501034_0294209
776 Ga0501034_0393073
777 Ga0501036_0039263
778 Ga0501037_0242815
779 Ga0501038_0018795
780 Ga0501039_0033080
781 Ga0501043_0057021
782 Ga0501043_0427975
783 Ga0501046_0005083
784 Ga0501047_0032712
785 Ga0501067_0261994
786 Ga0501070_0049245
787 Ga0501072_0252936
788 Ga0501073_0019741
789 Ga0501074_0012376
790 Ga0501080_0056535
791 Ga0501083_0041120
792 Ga0501035_0126883
793 Ga0501044_0030590
794 nmdc:mga0k408_132439_c1
795 nmdc:mga0k408_76556_c1
796 nmdc:mga07m45_122343_c1
797 nmdc:mga09592_166311_c1
798 nmdc:mga08y16_190353_c1
799 nmdc:mga08y16_261478_c1
800 nmdc:mga08y16_347999_c1
801 nmdc:mga0rr50_1328522_c1
802 Ga0500644_0012781
803 Ga0500562_016733
804 Ga0500594_0344915
805 Ga0500589_041975
806 Ga0500616_0370559
807 Ga0500645_008906
808 2739301305
809 2919192040
810 2929156436
811 8054310606
812 8055589077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

25

163

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dku-assembly8.cif.gz_H crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1 0.8002 1 151
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.7878 3 148
4dyw-assembly1.cif.gz_A crystal structure of mutt nudix hydrolase from burkholderia pseudomallei 0.7813 3 148
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.779 1 152
3ef5-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp 0.7785 3 155
ID Description Score Start End Superfamily
3id9A00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8098 6 97 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7956 7 150 3.90.79.10
4kyxB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7737 1 152 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7732 1 152 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.773 7 150 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A357Z7S3-F1-model_v4 NUDIX hydrolase 0.9829 1 106 GO:0005506
GO:0016705
GO:0016787
AF-A0A5B8V4I7-F1-model_v4 NUDIX domain-containing protein 0.9817 1 150 GO:0016787
AF-A0A3C0ILI1-F1-model_v4 NUDIX hydrolase 0.9787 1 152 GO:0016787
AF-A0A0D6L413-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9746 1 89 GO:0003677
GO:0005634
AF-A0A357Z7S3-F1-model_v4 NUDIX hydrolase 0.9738 1 106 GO:0005506
GO:0016705
GO:0016787

Map