F436254

General Info

Members Datasets Scaffolds Average Seq Length
406 225 812 100

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10440889|Ga0316576_104408892
Length 114
Sequence MPLGLCPMAAPEKPMNPEKLDDSHIAQSLSALNASASPPWSVVDGKLHKEFQFRDFNQAFGFMTRVALVAEAMDHHPEWFNVYKTVRVDLATHDAGGITELDFALAGRMETIAR

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
109 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
138 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
139 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
225 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.89
Metatranscriptomes 8.62
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 1.72
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 21.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10440889 3300031727 Bacteria 962
2 rootH1_10018019 3300003323 Bacteria 8421
3 rootH1_10168309 3300003323 Bacteria 6562
4 Ga0055537_1003428 3300003773 Bacteria 4877
5 Ga0065715_10902140 3300005293 Unclassified 574
6 Ga0070683_100315054 3300005329 Bacteria 1489
7 Ga0068869_100968204 3300005334 Unclassified 739
8 Ga0070680_100046360 3300005336 Bacteria 3536
9 Ga0070660_100556218 3300005339 Unclassified 957
10 Ga0070687_100645309 3300005343 Bacteria 733
11 Ga0070668_101255973 3300005347 Bacteria 672
12 Ga0070659_100003590 3300005366 Bacteria 11037
13 Ga0070667_100174450 3300005367 Unclassified 1899
14 Ga0070667_100744378 3300005367 Bacteria 908
15 Ga0070703_10003969 3300005406 Bacteria 4189
16 Ga0070709_10084328 3300005434 Unclassified 2081
17 Ga0070709_10818121 3300005434 Bacteria 732
18 Ga0070709_11349939 3300005434 Bacteria 576
19 Ga0070709_11637290 3300005434 Bacteria 525
20 Ga0070714_101806620 3300005435 Unclassified 597
21 Ga0070713_100274198 3300005436 Bacteria 1546
22 Ga0070713_100957133 3300005436 Bacteria 825
23 Ga0070713_101540235 3300005436 Bacteria 645
24 Ga0070710_10654049 3300005437 Bacteria 737
25 Ga0070710_11313283 3300005437 Bacteria 538
26 Ga0070711_100008374 3300005439 Bacteria 6334
27 Ga0070711_100292313 3300005439 Unclassified 1293
28 Ga0070705_100000969 3300005440 Bacteria 16078
29 Ga0070700_101140697 3300005441 Unclassified 648
30 Ga0070694_100013900 3300005444 Bacteria 5033
31 Ga0070694_100060239 3300005444 Unclassified 2588
32 Ga0070708_100001136 3300005445 Bacteria 20441
33 Ga0070708_101089326 3300005445 Bacteria 748
34 Ga0070708_101106864 3300005445 Unclassified 742
35 Ga0070708_101792674 3300005445 Bacteria 570
36 Ga0070706_100001301 3300005467 Bacteria 26618
37 Ga0070698_100000610 3300005471 Bacteria 38401
38 Ga0070699_100037447 3300005518 Bacteria 4198
39 Ga0070679_100010136 3300005530 Bacteria 8936
40 Ga0070679_100086443 3300005530 Bacteria 3122
41 Ga0070697_100000360 3300005536 Bacteria 35741
42 Ga0070697_101684870 3300005536 Unclassified 567
43 Ga0068853_101462418 3300005539 Bacteria 661
44 Ga0070695_100175870 3300005545 Unclassified 1513
45 Ga0070695_100395852 3300005545 Bacteria 1046
46 Ga0070695_100464158 3300005545 Unclassified 973
47 Ga0070696_100078652 3300005546 Bacteria 2332
48 Ga0070696_101272821 3300005546 Bacteria 623
49 Ga0070693_100000292 3300005547 Bacteria 23394
50 Ga0070693_100131373 3300005547 Bacteria 1566
51 Ga0070704_100010211 3300005549 Bacteria 5711
52 Ga0070704_100016261 3300005549 Unclassified 4698
53 Ga0068855_100068711 3300005563 Bacteria 4124
54 Ga0070664_101912130 3300005564 Bacteria 563
55 Ga0068856_100211719 3300005614 Bacteria 1953
56 Ga0070702_100055537 3300005615 Bacteria 2284
57 Ga0068852_100715199 3300005616 Bacteria 1012
58 Ga0068859_102896087 3300005617 Bacteria 526
59 Ga0068864_100663443 3300005618 Bacteria 1016
60 Ga0068851_10999908 3300005834 Bacteria 527
61 Ga0068863_102488327 3300005841 Unclassified 527
62 Ga0068860_100001479 3300005843 Bacteria 25377
63 Ga0068860_100556613 3300005843 Bacteria 1149
64 Ga0081540_1148210 3300005983 Unclassified 930
65 Ga0070717_10038779 3300006028 Bacteria 3873
66 Ga0070717_10141950 3300006028 Unclassified 2072
67 Ga0075363_100033794 3300006048 Bacteria 2666
68 Ga0075364_10128132 3300006051 Bacteria 1702
69 Ga0075364_10338781 3300006051 Bacteria 1025
70 Ga0070715_10056419 3300006163 Unclassified 1709
71 Ga0070715_10328585 3300006163 Bacteria 828
72 Ga0070715_10705042 3300006163 Unclassified 603
73 Ga0070715_11020477 3300006163 Unclassified 516
74 Ga0070715_11071151 3300006163 Unclassified 506
75 Ga0070716_100002429 3300006173 Bacteria 8580
76 Ga0070716_100073843 3300006173 Unclassified 2013
77 Ga0070716_100304575 3300006173 Bacteria 1110
78 Ga0070716_100373304 3300006173 Unclassified 1017
79 Ga0070716_100379295 3300006173 Unclassified 1010
80 Ga0070716_100384060 3300006173 Unclassified 1005
81 Ga0070716_100647139 3300006173 Bacteria 801
82 Ga0070712_100108366 3300006175 Unclassified 2068
83 Ga0070712_100272063 3300006175 Unclassified 1361
84 Ga0070712_100445281 3300006175 Bacteria 1078
85 Ga0075362_10007952 3300006177 Bacteria 4037
86 Ga0075367_10173171 3300006178 Bacteria 1345
87 Ga0075434_100619575 3300006871 Bacteria 1101
88 Ga0075436_100000439 3300006914 Bacteria 26709
89 Ga0075436_100017760 3300006914 Bacteria 4871
90 Ga0075436_100636153 3300006914 Bacteria 787
91 Ga0097620_102896214 3300006931 Bacteria 526
92 Ga0099794_10000496 3300007265 Bacteria 13198
93 Ga0099794_10005090 3300007265 Bacteria 5241
94 Ga0099794_10066402 3300007265 Unclassified 1760
95 Ga0099794_10118438 3300007265 Bacteria 1331
96 Ga0099794_10392168 3300007265 Bacteria 725
97 Ga0099794_10793308 3300007265 Unclassified 507
98 Ga0099795_10097365 3300007788 Bacteria 1149
99 Ga0099795_10170784 3300007788 Unclassified 903
100 Ga0099795_10210875 3300007788 Unclassified 823
101 Ga0099795_10604691 3300007788 Bacteria 522
102 Ga0111539_10685927 3300009094 Unclassified 1192
103 Ga0105245_10659403 3300009098 Unclassified 1077
104 Ga0105242_10898111 3300009176 Bacteria 886
105 Ga0105248_10047114 3300009177 Bacteria 4833
106 Ga0105237_10176920 3300009545 Unclassified 2134
107 Ga0105249_10882975 3300009553 Bacteria 961
108 Ga0099796_10214505 3300010159 Unclassified 786
109 Ga0105239_10121429 3300010375 Bacteria 2902
110 Ga0105246_11195670 3300011119 Bacteria 699
111 Ga0157378_10000582 3300013297 Bacteria 34326
112 Ga0163162_10046407 3300013306 Bacteria 4354
113 Ga0157375_12040132 3300013308 Bacteria 682
114 Ga0157375_13217280 3300013308 Bacteria 545
115 Ga0157380_10370132 3300014326 Bacteria 1348
116 Ga0157379_10143033 3300014968 Unclassified 2156
117 Ga0157376_10844121 3300014969 Unclassified 931
118 Ga0209565_1000044 3300025263 Bacteria 229969
119 Ga0209673_1005794 3300025273 Bacteria 6137
120 Ga0209564_1002003 3300025295 Bacteria 17802
121 Ga0207653_10001109 3300025885 Bacteria 8829
122 Ga0207692_10822380 3300025898 Unclassified 608
123 Ga0207692_11078837 3300025898 Unclassified 531
124 Ga0207685_10468809 3300025905 Bacteria 658
125 Ga0207685_10823762 3300025905 Unclassified 512
126 Ga0207699_10030434 3300025906 Unclassified 3021
127 Ga0207699_10278882 3300025906 Unclassified 1161
128 Ga0207699_10996512 3300025906 Bacteria 619
129 Ga0207699_11158960 3300025906 Unclassified 572
130 Ga0207645_10635735 3300025907 Unclassified 725
131 Ga0207684_10003935 3300025910 Bacteria 14214
132 Ga0207684_11477197 3300025910 Bacteria 554
133 Ga0207693_10031123 3300025915 Unclassified 4215
134 Ga0207693_10082698 3300025915 Unclassified 2514
135 Ga0207693_10429287 3300025915 Bacteria 1033
136 Ga0207663_10082849 3300025916 Bacteria 2105
137 Ga0207663_10123016 3300025916 Bacteria 1780
138 Ga0207663_10335592 3300025916 Unclassified 1140
139 Ga0207663_11239622 3300025916 Bacteria 601
140 Ga0207660_10685474 3300025917 Bacteria 836
141 Ga0207657_10872910 3300025919 Bacteria 694
142 Ga0207652_10018068 3300025921 Bacteria 5781
143 Ga0207652_10169529 3300025921 Bacteria 1958
144 Ga0207650_11156879 3300025925 Bacteria 659
145 Ga0207700_10036610 3300025928 Bacteria 3547
146 Ga0207700_10818134 3300025928 Unclassified 833
147 Ga0207700_11035146 3300025928 Bacteria 734
148 Ga0207664_11389405 3300025929 Unclassified 623
149 Ga0207706_11027216 3300025933 Bacteria 692
150 Ga0207686_11114557 3300025934 Bacteria 644
151 Ga0207670_11284010 3300025936 Unclassified 620
152 Ga0207704_10403243 3300025938 Unclassified 1080
153 Ga0207665_10000141 3300025939 Bacteria 48575
154 Ga0207665_10166986 3300025939 Bacteria 1587
155 Ga0207665_10203451 3300025939 Bacteria 1444
156 Ga0207665_10401611 3300025939 Unclassified 1044
157 Ga0207665_10464042 3300025939 Bacteria 974
158 Ga0207665_10734568 3300025939 Bacteria 777
159 Ga0207711_10088527 3300025941 Unclassified 2719
160 Ga0207661_10400922 3300025944 Bacteria 1244
161 Ga0207679_12125760 3300025945 Bacteria 510
162 Ga0207667_10021122 3300025949 Bacteria 7220
163 Ga0207712_11268010 3300025961 Bacteria 658
164 Ga0207668_11333131 3300025972 Bacteria 646
165 Ga0207658_10482901 3300025986 Unclassified 1101
166 Ga0207658_11440364 3300025986 Bacteria 630
167 Ga0207703_10847853 3300026035 Unclassified 874
168 Ga0207702_10354176 3300026078 Bacteria 1405
169 Ga0207641_10389625 3300026088 Unclassified 1336
170 Ga0207676_10623363 3300026095 Bacteria 1038
171 Ga0207698_11164111 3300026142 Bacteria 785
172 Ga0209179_1063456 3300027512 Bacteria 804
173 Ga0209588_1007778 3300027671 Unclassified 3165
174 Ga0209588_1008569 3300027671 Bacteria 3034
175 Ga0265354_1003302 3300028016 Unclassified 1822
176 Ga0265357_1001282 3300028023 Bacteria 1804
177 Ga0265357_1013606 3300028023 Bacteria 847
178 Ga0268265_10235628 3300028380 Bacteria 1612
179 Ga0268264_10006621 3300028381 Bacteria 9744
180 Ga0265337_1007858 3300028556 Bacteria 3949
181 Ga0265319_1017743 3300028563 Bacteria 2699
182 Ga0265323_10008770 3300028653 Bacteria 4157
183 Ga0265322_10166996 3300028654 Unclassified 629
184 Ga0265338_10112266 3300028800 Bacteria 2192
185 Ga0265777_119043 3300030877 Bacteria 557
186 Ga0265770_1007487 3300030878 Unclassified 1538
187 Ga0265760_10003043 3300031090 Bacteria 4896
188 Ga0265760_10025130 3300031090 Unclassified 1738
189 Ga0265332_10008015 3300031238 Bacteria 4758
190 Ga0265320_10028036 3300031240 Bacteria 2928
191 Ga0265325_10000978 3300031241 Bacteria 20528
192 Ga0265325_10013220 3300031241 Bacteria 4704
193 Ga0265329_10250340 3300031242 Unclassified 591
194 Ga0265340_10000145 3300031247 Bacteria 36069
195 Ga0265339_10123691 3300031249 Bacteria 1327
196 Ga0265339_10169003 3300031249 Bacteria 1096
197 Ga0265331_10003450 3300031250 Bacteria 10218
198 Ga0265316_10010047 3300031344 Bacteria 8659
199 Ga0265313_10173245 3300031595 Bacteria 910
200 Ga0316575_10051155 3300031665 Bacteria 1645
201 Ga0316575_10059850 3300031665 Bacteria 1520
202 Ga0316579_10030914 3300031691 Bacteria 2448
203 Ga0316579_10095589 3300031691 Unclassified 1420
204 Ga0316579_10172834 3300031691 Bacteria 1044
205 Ga0316579_10244606 3300031691 Bacteria 868
206 Ga0265314_10000015 3300031711 Bacteria 397180
207 Ga0265342_10000837 3300031712 Bacteria 30783
208 Ga0316576_10000531 3300031727 Bacteria 17862
209 Ga0316576_10002808 3300031727 Bacteria 10015
210 Ga0316576_10023593 3300031727 Bacteria 4287
211 Ga0316576_10049524 3300031727 Bacteria 3051
212 Ga0316576_10087253 3300031727 Bacteria 2321
213 Ga0316576_10095870 3300031727 Bacteria 2213
214 Ga0316578_10005914 3300031728 Bacteria 5986
215 Ga0316578_10026329 3300031728 Bacteria 3279
216 Ga0316578_10032004 3300031728 Bacteria 3001
217 Ga0316578_10080712 3300031728 Bacteria 1935
218 Ga0316578_10130698 3300031728 Bacteria 1511
219 Ga0316578_10189066 3300031728 Bacteria 1240
220 Ga0316578_10259164 3300031728 Bacteria 1042
221 Ga0316578_10705816 3300031728 Bacteria 587
222 Ga0316577_10018279 3300031733 Bacteria 3875
223 Ga0316577_10037590 3300031733 Bacteria 2706
224 Ga0316577_10081807 3300031733 Bacteria 1806
225 Ga0316577_10087949 3300031733 Bacteria 1738
226 Ga0307413_10784771 3300031824 Bacteria 799
227 Ga0316583_10000831 3300032133 Bacteria 9818
228 Ga0316583_10004500 3300032133 Bacteria 4973
229 Ga0316585_10000953 3300032137 Bacteria 7413
230 Ga0316585_10028582 3300032137 Bacteria 1744
231 Ga0316580_10004799 3300032139 Bacteria 3929
232 Ga0316580_10005354 3300032139 Bacteria 3741
233 Ga0316580_10055806 3300032139 Bacteria 1214
234 Ga0316580_10121595 3300032139 Bacteria 799
235 Ga0316580_10124033 3300032139 Bacteria 791
236 Ga0316580_10216859 3300032139 Bacteria 590
237 Ga0316593_10000224 3300032168 Bacteria 9004
238 Ga0316593_10007250 3300032168 Bacteria 3037
239 Ga0316593_10076358 3300032168 Bacteria 1164
240 Ga0316593_10201549 3300032168 Bacteria 736
241 Ga0316593_10233752 3300032168 Bacteria 685
242 Ga0316592_1004461 3300033524 Bacteria 2603
243 Ga0316592_1011832 3300033524 Bacteria 1780
244 Ga0316592_1016463 3300033524 Bacteria 1545
245 Ga0316592_1017325 3300033524 Bacteria 1511
246 Ga0316592_1025494 3300033524 Bacteria 1274
247 Ga0316592_1034643 3300033524 Bacteria 1106
248 Ga0316592_1046079 3300033524 Bacteria 971
249 Ga0316586_1002458 3300033527 Bacteria 2311
250 Ga0316586_1003352 3300033527 Bacteria 2095
251 Ga0316586_1007788 3300033527 Bacteria 1570
252 Ga0316586_1064625 3300033527 Bacteria 668
253 Ga0316588_1010376 3300033528 Bacteria 1963
254 Ga0316588_1011270 3300033528 Bacteria 1903
255 Ga0316588_1051036 3300033528 Bacteria 1003
256 Ga0316588_1164775 3300033528 Unclassified 572
257 Ga0316587_1003162 3300033529 Bacteria 2281
258 Ga0316587_1003185 3300033529 Bacteria 2276
259 Ga0316587_1068293 3300033529 Bacteria 664
260 Ga0316587_1094650 3300033529 Unclassified 572
261 Ga0316596_1002018 3300033541 Bacteria 4266
262 Ga0316596_1002923 3300033541 Bacteria 3703
263 Ga0316596_1003943 3300033541 Bacteria 3289
264 Ga0316596_1004432 3300033541 Bacteria 3151
265 Ga0316596_1007503 3300033541 Bacteria 2580
266 Ga0316596_1126189 3300033541 Bacteria 698
267 Ga0316596_1136807 3300033541 Bacteria 670
268 Ga0316212_1001345 3300033547 Unclassified 3333
269 Ga0373926_0271037 3300035083 Bacteria 660
270 Ga0373934_0211469 3300035086 Bacteria 799
271 Ga0373944_0153811 3300035089 Bacteria 812
272 Ga0373953_0016808 3300035117 Bacteria 2678
273 Ga0373953_0067182 3300035117 Bacteria 1474
274 Ga0373953_0569642 3300035117 Unclassified 504
275 Ga0373954_0005844 3300035118 Bacteria 5343
276 Ga0373954_0023061 3300035118 Bacteria 2827
277 Ga0373954_0071930 3300035118 Bacteria 1644
278 Ga0373954_0092743 3300035118 Bacteria 1452
279 Ga0373954_0146322 3300035118 Bacteria 1153
280 Ga0373956_0001602 3300035119 Bacteria 9331
281 Ga0373956_0007280 3300035119 Bacteria 4456
282 Ga0373956_0179436 3300035119 Bacteria 1001
283 Ga0373956_0424949 3300035119 Unclassified 634
284 Ga0373957_0006142 3300035120 Bacteria 3769
285 Ga0373957_0275050 3300035120 Unclassified 711
286 Ga0373960_0033733 3300035121 Bacteria 1444
287 Ga0373955_0000157 3300035172 Bacteria 27419
288 Ga0373955_0023724 3300035172 Unclassified 3129
289 Ga0373955_0074496 3300035172 Bacteria 1905
290 Ga0373955_0259614 3300035172 Bacteria 1043
291 Ga0316574_0001320 3300035398 Bacteria 11617
292 Ga0316574_0070482 3300035398 Bacteria 2207
293 Ga0316574_0549870 3300035398 Bacteria 716
294 Ga0316574_0673187 3300035398 Bacteria 636
295 Ga0316574_0696151 3300035398 Bacteria 623
296 Ga0373931_0072717 3300035691 Bacteria 1881
297 Ga0373935_0306210 3300035692 Bacteria 1124
298 Ga0373927_0003080 3300035695 Bacteria 12086
299 Ga0373927_0011758 3300035695 Bacteria 5827
300 Ga0373927_0408984 3300035695 Bacteria 895
301 Ga0373927_0800412 3300035695 Unclassified 623
302 Ga0373933_0000778 3300035724 Bacteria 19433
303 Ga0373933_0035647 3300035724 Bacteria 2907
304 Ga0373933_0228681 3300035724 Unclassified 1194
305 Ga0373933_0749779 3300035724 Bacteria 642
306 Ga0373947_1044414 3300035725 Unclassified 557
307 Ga0373947_1116936 3300035725 Bacteria 537
308 Ga0373937_0002004 3300036401 Bacteria 17035
309 Ga0373937_0003771 3300036401 Bacteria 12813
310 Ga0373937_0011025 3300036401 Bacteria 7924
311 Ga0373937_0015035 3300036401 Bacteria 6836
312 Ga0373937_0058073 3300036401 Bacteria 3555
313 Ga0373937_1025185 3300036401 Bacteria 774
314 Ga0316582_0007880 3300036647 Bacteria 5690
315 Ga0316582_0025952 3300036647 Bacteria 3523
316 Ga0316582_0064935 3300036647 Bacteria 2349
317 Ga0316582_0830349 3300036647 Bacteria 633
318 Ga0316584_0000057 3300036712 Bacteria 42823
319 Ga0316584_0003041 3300036712 Bacteria 10798
320 Ga0316584_0049983 3300036712 Bacteria 3125
321 Ga0316584_0134541 3300036712 Bacteria 1845
322 Ga0316584_0234365 3300036712 Bacteria 1345
323 Ga0316584_0267655 3300036712 Bacteria 1244
324 Ga0316584_0585202 3300036712 Bacteria 775
325 Ga0373925_0000884 3300037068 Bacteria 27376
326 Ga0373925_0107566 3300037068 Bacteria 2151
327 Ga0373925_0283283 3300037068 Bacteria 1335
328 Ga0373925_0846439 3300037068 Unclassified 754
329 Ga0373925_1678601 3300037068 Unclassified 519
330 Ga0436360_0084728 3300039438 Bacteria 840
331 Ga0451807_1785413 3300041486 Bacteria 770
332 Ga0451839_0145085 3300041496 Unclassified 795
333 Ga0451845_0805210 3300041501 Unclassified 607
334 Ga0451849_0657894 3300041505 Bacteria 666
335 Ga0451576_0896099 3300045051 Bacteria 931
336 Ga0495592_0116724 3300046454 Bacteria 1883
337 Ga0495629_0026325 3300046459 Bacteria 4133
338 Ga0495651_0071186 3300046462 Unclassified 2644
339 Ga0495651_0215913 3300046462 Unclassified 1331
340 Ga0495651_0698104 3300046462 Bacteria 633
341 Ga0495653_0110341 3300046463 Bacteria 1978
342 Ga0495580_0022682 3300046472 Bacteria 4616
343 Ga0495580_0087150 3300046472 Bacteria 2175
344 Ga0495580_0142481 3300046472 Bacteria 1661
345 Ga0495582_0035319 3300046473 Bacteria 2749
346 Ga0495582_0633666 3300046473 Unclassified 619
347 Ga0495664_0109361 3300046477 Bacteria 1668
348 Ga0495618_0072681 3300046514 Bacteria 2189
349 Ga0495628_0071041 3300046516 Bacteria 2714
350 Ga0495628_0313174 3300046516 Bacteria 1160
351 Ga0495630_0263647 3300046517 Unclassified 1316
352 Ga0495665_0218391 3300046531 Unclassified 986
353 Ga0495587_0000510 3300046536 Bacteria 27033
354 Ga0495645_0703184 3300046543 Bacteria 613
355 Ga0495622_0130688 3300046557 Bacteria 1144
356 Ga0495657_0078721 3300046675 Bacteria 2136
357 Ga0495657_0803660 3300046675 Unclassified 537
358 Ga0495599_0141766 3300046678 Bacteria 1491
359 Ga0495623_0341273 3300046679 Bacteria 818
360 Ga0495613_0378154 3300046689 Unclassified 969
361 Ga0495600_0886241 3300046809 Bacteria 527
362 Ga0495600_0890619 3300046809 Bacteria 526
363 Ga0495604_0000275 3300047317 Bacteria 45903
364 Ga0495680_0543857 3300047322 Bacteria 783
365 Ga0495680_0549628 3300047322 Unclassified 778
366 Ga0495684_0006634 3300047471 Bacteria 8978
367 Ga0495684_0162114 3300047471 Bacteria 1667
368 Ga0495602_0047657 3300048088 Bacteria 3859
369 Ga0496100_0548125 3300048903 Bacteria 894
370 Ga0496102_0001293 3300048905 Bacteria 22508
371 Ga0496104_1180087 3300048907 Bacteria 669
372 Ga0496107_0111677 3300048910 Unclassified 2009
373 Ga0496112_1201219 3300048915 Bacteria 675
374 Ga0496115_0971017 3300048918 Unclassified 651
375 Ga0501034_0012804 3300049571 Bacteria 8653
376 Ga0501034_0034266 3300049571 Bacteria 5148
377 Ga0501037_0367027 3300049573 Bacteria 991
378 Ga0501046_0788271 3300049580 Bacteria 666
379 Ga0501047_0553654 3300049581 Bacteria 974
380 Ga0501069_0221298 3300049585 Bacteria 1100
381 Ga0501070_0038031 3300049586 Bacteria 4016
382 Ga0501070_0547723 3300049586 Bacteria 926
383 Ga0501071_0019455 3300049587 Bacteria 4712
384 Ga0501071_1171237 3300049587 Bacteria 594
385 Ga0501074_0297235 3300049590 Bacteria 1147
386 Ga0501080_0247371 3300049742 Bacteria 1626
387 Ga0501083_0073847 3300049744 Bacteria 2267
388 Ga0501271_060275 3300049768 Bacteria 531
389 Ga0501035_0103741 3300049822 Bacteria 2494
390 Ga0501044_0248294 3300049823 Bacteria 1722
391 nmdc:mga03683_18829_c1 3300050489 Bacteria 2630
392 nmdc:mga03n38_15898_c1 3300050490 Bacteria 2916
393 nmdc:mga00v17_114259_c1 3300050491 Bacteria 1715
394 nmdc:mga0k408_48888_c1 3300050493 Bacteria 2448
395 nmdc:mga0qj67_617335_c1 3300050509 Bacteria 866
396 nmdc:mga08y16_1415878_c1 3300050511 Bacteria 658
397 nmdc:mga0n895_1442955_c1 3300050512 Bacteria 656
398 nmdc:mga08x19_294_c1 3300050514 Bacteria 36798
399 nmdc:mga08x19_590512_c1 3300050514 Bacteria 787
400 Ga0495595_0121548 3300053084 Unclassified 1272
401 Ga0495619_0090468 3300053085 Unclassified 2072
402 Ga0495619_0142448 3300053085 Bacteria 1651
403 Ga0495619_0231851 3300053085 Bacteria 1279
404 Ga0501082_1000273 3300060353 Bacteria 731
405 2792839303 2791355137 Bacteria 9654227
406 2904617526 2904615490 Bacteria 10047340
407 Ga0316576_10440889
408 rootH1_10018019
409 rootH1_10168309
410 Ga0055537_1003428
411 Ga0065715_10902140
412 Ga0070683_100315054
413 Ga0068869_100968204
414 Ga0070680_100046360
415 Ga0070660_100556218
416 Ga0070687_100645309
417 Ga0070668_101255973
418 Ga0070659_100003590
419 Ga0070667_100174450
420 Ga0070667_100744378
421 Ga0070703_10003969
422 Ga0070709_10084328
423 Ga0070709_10818121
424 Ga0070709_11349939
425 Ga0070709_11637290
426 Ga0070714_101806620
427 Ga0070713_100274198
428 Ga0070713_100957133
429 Ga0070713_101540235
430 Ga0070710_10654049
431 Ga0070710_11313283
432 Ga0070711_100008374
433 Ga0070711_100292313
434 Ga0070705_100000969
435 Ga0070700_101140697
436 Ga0070694_100013900
437 Ga0070694_100060239
438 Ga0070708_100001136
439 Ga0070708_101089326
440 Ga0070708_101106864
441 Ga0070708_101792674
442 Ga0070706_100001301
443 Ga0070698_100000610
444 Ga0070699_100037447
445 Ga0070679_100010136
446 Ga0070679_100086443
447 Ga0070697_100000360
448 Ga0070697_101684870
449 Ga0068853_101462418
450 Ga0070695_100175870
451 Ga0070695_100395852
452 Ga0070695_100464158
453 Ga0070696_100078652
454 Ga0070696_101272821
455 Ga0070693_100000292
456 Ga0070693_100131373
457 Ga0070704_100010211
458 Ga0070704_100016261
459 Ga0068855_100068711
460 Ga0070664_101912130
461 Ga0068856_100211719
462 Ga0070702_100055537
463 Ga0068852_100715199
464 Ga0068859_102896087
465 Ga0068864_100663443
466 Ga0068851_10999908
467 Ga0068863_102488327
468 Ga0068860_100001479
469 Ga0068860_100556613
470 Ga0081540_1148210
471 Ga0070717_10038779
472 Ga0070717_10141950
473 Ga0075363_100033794
474 Ga0075364_10128132
475 Ga0075364_10338781
476 Ga0070715_10056419
477 Ga0070715_10328585
478 Ga0070715_10705042
479 Ga0070715_11020477
480 Ga0070715_11071151
481 Ga0070716_100002429
482 Ga0070716_100073843
483 Ga0070716_100304575
484 Ga0070716_100373304
485 Ga0070716_100379295
486 Ga0070716_100384060
487 Ga0070716_100647139
488 Ga0070712_100108366
489 Ga0070712_100272063
490 Ga0070712_100445281
491 Ga0075362_10007952
492 Ga0075367_10173171
493 Ga0075434_100619575
494 Ga0075436_100000439
495 Ga0075436_100017760
496 Ga0075436_100636153
497 Ga0097620_102896214
498 Ga0099794_10000496
499 Ga0099794_10005090
500 Ga0099794_10066402
501 Ga0099794_10118438
502 Ga0099794_10392168
503 Ga0099794_10793308
504 Ga0099795_10097365
505 Ga0099795_10170784
506 Ga0099795_10210875
507 Ga0099795_10604691
508 Ga0111539_10685927
509 Ga0105245_10659403
510 Ga0105242_10898111
511 Ga0105248_10047114
512 Ga0105237_10176920
513 Ga0105249_10882975
514 Ga0099796_10214505
515 Ga0105239_10121429
516 Ga0105246_11195670
517 Ga0157378_10000582
518 Ga0163162_10046407
519 Ga0157375_12040132
520 Ga0157375_13217280
521 Ga0157380_10370132
522 Ga0157379_10143033
523 Ga0157376_10844121
524 Ga0209565_1000044
525 Ga0209673_1005794
526 Ga0209564_1002003
527 Ga0207653_10001109
528 Ga0207692_10822380
529 Ga0207692_11078837
530 Ga0207685_10468809
531 Ga0207685_10823762
532 Ga0207699_10030434
533 Ga0207699_10278882
534 Ga0207699_10996512
535 Ga0207699_11158960
536 Ga0207645_10635735
537 Ga0207684_10003935
538 Ga0207684_11477197
539 Ga0207693_10031123
540 Ga0207693_10082698
541 Ga0207693_10429287
542 Ga0207663_10082849
543 Ga0207663_10123016
544 Ga0207663_10335592
545 Ga0207663_11239622
546 Ga0207660_10685474
547 Ga0207657_10872910
548 Ga0207652_10018068
549 Ga0207652_10169529
550 Ga0207650_11156879
551 Ga0207700_10036610
552 Ga0207700_10818134
553 Ga0207700_11035146
554 Ga0207664_11389405
555 Ga0207706_11027216
556 Ga0207686_11114557
557 Ga0207670_11284010
558 Ga0207704_10403243
559 Ga0207665_10000141
560 Ga0207665_10166986
561 Ga0207665_10203451
562 Ga0207665_10401611
563 Ga0207665_10464042
564 Ga0207665_10734568
565 Ga0207711_10088527
566 Ga0207661_10400922
567 Ga0207679_12125760
568 Ga0207667_10021122
569 Ga0207712_11268010
570 Ga0207668_11333131
571 Ga0207658_10482901
572 Ga0207658_11440364
573 Ga0207703_10847853
574 Ga0207702_10354176
575 Ga0207641_10389625
576 Ga0207676_10623363
577 Ga0207698_11164111
578 Ga0209179_1063456
579 Ga0209588_1007778
580 Ga0209588_1008569
581 Ga0265354_1003302
582 Ga0265357_1001282
583 Ga0265357_1013606
584 Ga0268265_10235628
585 Ga0268264_10006621
586 Ga0265337_1007858
587 Ga0265319_1017743
588 Ga0265323_10008770
589 Ga0265322_10166996
590 Ga0265338_10112266
591 Ga0265777_119043
592 Ga0265770_1007487
593 Ga0265760_10003043
594 Ga0265760_10025130
595 Ga0265332_10008015
596 Ga0265320_10028036
597 Ga0265325_10000978
598 Ga0265325_10013220
599 Ga0265329_10250340
600 Ga0265340_10000145
601 Ga0265339_10123691
602 Ga0265339_10169003
603 Ga0265331_10003450
604 Ga0265316_10010047
605 Ga0265313_10173245
606 Ga0316575_10051155
607 Ga0316575_10059850
608 Ga0316579_10030914
609 Ga0316579_10095589
610 Ga0316579_10172834
611 Ga0316579_10244606
612 Ga0265314_10000015
613 Ga0265342_10000837
614 Ga0316576_10000531
615 Ga0316576_10002808
616 Ga0316576_10023593
617 Ga0316576_10049524
618 Ga0316576_10087253
619 Ga0316576_10095870
620 Ga0316578_10005914
621 Ga0316578_10026329
622 Ga0316578_10032004
623 Ga0316578_10080712
624 Ga0316578_10130698
625 Ga0316578_10189066
626 Ga0316578_10259164
627 Ga0316578_10705816
628 Ga0316577_10018279
629 Ga0316577_10037590
630 Ga0316577_10081807
631 Ga0316577_10087949
632 Ga0307413_10784771
633 Ga0316583_10000831
634 Ga0316583_10004500
635 Ga0316585_10000953
636 Ga0316585_10028582
637 Ga0316580_10004799
638 Ga0316580_10005354
639 Ga0316580_10055806
640 Ga0316580_10121595
641 Ga0316580_10124033
642 Ga0316580_10216859
643 Ga0316593_10000224
644 Ga0316593_10007250
645 Ga0316593_10076358
646 Ga0316593_10201549
647 Ga0316593_10233752
648 Ga0316592_1004461
649 Ga0316592_1011832
650 Ga0316592_1016463
651 Ga0316592_1017325
652 Ga0316592_1025494
653 Ga0316592_1034643
654 Ga0316592_1046079
655 Ga0316586_1002458
656 Ga0316586_1003352
657 Ga0316586_1007788
658 Ga0316586_1064625
659 Ga0316588_1010376
660 Ga0316588_1011270
661 Ga0316588_1051036
662 Ga0316588_1164775
663 Ga0316587_1003162
664 Ga0316587_1003185
665 Ga0316587_1068293
666 Ga0316587_1094650
667 Ga0316596_1002018
668 Ga0316596_1002923
669 Ga0316596_1003943
670 Ga0316596_1004432
671 Ga0316596_1007503
672 Ga0316596_1126189
673 Ga0316596_1136807
674 Ga0316212_1001345
675 Ga0373926_0271037
676 Ga0373934_0211469
677 Ga0373944_0153811
678 Ga0373953_0016808
679 Ga0373953_0067182
680 Ga0373953_0569642
681 Ga0373954_0005844
682 Ga0373954_0023061
683 Ga0373954_0071930
684 Ga0373954_0092743
685 Ga0373954_0146322
686 Ga0373956_0001602
687 Ga0373956_0007280
688 Ga0373956_0179436
689 Ga0373956_0424949
690 Ga0373957_0006142
691 Ga0373957_0275050
692 Ga0373960_0033733
693 Ga0373955_0000157
694 Ga0373955_0023724
695 Ga0373955_0074496
696 Ga0373955_0259614
697 Ga0316574_0001320
698 Ga0316574_0070482
699 Ga0316574_0549870
700 Ga0316574_0673187
701 Ga0316574_0696151
702 Ga0373931_0072717
703 Ga0373935_0306210
704 Ga0373927_0003080
705 Ga0373927_0011758
706 Ga0373927_0408984
707 Ga0373927_0800412
708 Ga0373933_0000778
709 Ga0373933_0035647
710 Ga0373933_0228681
711 Ga0373933_0749779
712 Ga0373947_1044414
713 Ga0373947_1116936
714 Ga0373937_0002004
715 Ga0373937_0003771
716 Ga0373937_0011025
717 Ga0373937_0015035
718 Ga0373937_0058073
719 Ga0373937_1025185
720 Ga0316582_0007880
721 Ga0316582_0025952
722 Ga0316582_0064935
723 Ga0316582_0830349
724 Ga0316584_0000057
725 Ga0316584_0003041
726 Ga0316584_0049983
727 Ga0316584_0134541
728 Ga0316584_0234365
729 Ga0316584_0267655
730 Ga0316584_0585202
731 Ga0373925_0000884
732 Ga0373925_0107566
733 Ga0373925_0283283
734 Ga0373925_0846439
735 Ga0373925_1678601
736 Ga0436360_0084728
737 Ga0451807_1785413
738 Ga0451839_0145085
739 Ga0451845_0805210
740 Ga0451849_0657894
741 Ga0451576_0896099
742 Ga0495592_0116724
743 Ga0495629_0026325
744 Ga0495651_0071186
745 Ga0495651_0215913
746 Ga0495651_0698104
747 Ga0495653_0110341
748 Ga0495580_0022682
749 Ga0495580_0087150
750 Ga0495580_0142481
751 Ga0495582_0035319
752 Ga0495582_0633666
753 Ga0495664_0109361
754 Ga0495618_0072681
755 Ga0495628_0071041
756 Ga0495628_0313174
757 Ga0495630_0263647
758 Ga0495665_0218391
759 Ga0495587_0000510
760 Ga0495645_0703184
761 Ga0495622_0130688
762 Ga0495657_0078721
763 Ga0495657_0803660
764 Ga0495599_0141766
765 Ga0495623_0341273
766 Ga0495613_0378154
767 Ga0495600_0886241
768 Ga0495600_0890619
769 Ga0495604_0000275
770 Ga0495680_0543857
771 Ga0495680_0549628
772 Ga0495684_0006634
773 Ga0495684_0162114
774 Ga0495602_0047657
775 Ga0496100_0548125
776 Ga0496102_0001293
777 Ga0496104_1180087
778 Ga0496107_0111677
779 Ga0496112_1201219
780 Ga0496115_0971017
781 Ga0501034_0012804
782 Ga0501034_0034266
783 Ga0501037_0367027
784 Ga0501046_0788271
785 Ga0501047_0553654
786 Ga0501069_0221298
787 Ga0501070_0038031
788 Ga0501070_0547723
789 Ga0501071_0019455
790 Ga0501071_1171237
791 Ga0501074_0297235
792 Ga0501080_0247371
793 Ga0501083_0073847
794 Ga0501271_060275
795 Ga0501035_0103741
796 Ga0501044_0248294
797 nmdc:mga03683_18829_c1
798 nmdc:mga03n38_15898_c1
799 nmdc:mga00v17_114259_c1
800 nmdc:mga0k408_48888_c1
801 nmdc:mga0qj67_617335_c1
802 nmdc:mga08y16_1415878_c1
803 nmdc:mga0n895_1442955_c1
804 nmdc:mga08x19_294_c1
805 nmdc:mga08x19_590512_c1
806 Ga0495595_0121548
807 Ga0495619_0090468
808 Ga0495619_0142448
809 Ga0495619_0231851
810 Ga0501082_1000273
811 2792839303
812 2904617526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

18

112

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9843 6 95
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9664 5 99
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9549 3 97
1dco-assembly1.cif.gz_D dcoh, a bifunctional protein-binding transcriptional coactivator 0.95 7 99
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9483 3 97
ID Description Score Start End Superfamily
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9664 5 99 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9646 7 94 3.30.1360.20
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9525 5 94 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9499 3 95 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9471 5 99 3.30.1360.20
ID Description Score Start End GO Terms
AF-K8GI06-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.001 2 95 GO:0006729
GO:0008124
AF-A0A401IFU9-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.001 5 97 GO:0006729
GO:0008124
AF-A0A6L8ESX5-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1 3 95 GO:0006729
GO:0008124
AF-A0A7J9QST3-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9957 5 95 GO:0006729
GO:0008124
AF-A0A7C2YL46-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9955 3 97 GO:0006729
GO:0008124

Map