F436176

General Info

Members Datasets Scaffolds Average Seq Length
406 231 812 352

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000003|Ga0075428_100000003110
Length 347
Sequence MSAKRHRIAVIPGDGIGQEVIPAALTVLEAVASRSGFAFDLVEFPYGCAYYSKHGRMMAADAFDRLAEFPAIYFGAVGDPSVPDHVAVWELILPLRQRFDQYVNLRPMRLFPGVTSPLANRGPADIDMICVRENSEGEYAGIGGRIHAGTPYEAVEQAGLFTRHGISRIARYAFELASRRPRRELASATKSNALQHSMVLWDTVVDEVRKDYPGVAFKKYHVDALAARMVTHPQTLDVIVASNLFGDILTDLGAAISGSNINPERKYPSMFEPIHGSAPDIKGKGIANPIGAIWAGALMLDHLGEPAAHDAVVAAITKVLSSGNTKTPDMGGKASTKEMAAAIQAAI

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100000003 3300006844 Bacteria 365483
2 JGI24751J29686_10009533 3300002459 Bacteria 1997
3 Ga0065712_10070358 3300005290 Bacteria 6083
4 Ga0065712_10070543 3300005290 Bacteria 5919
5 Ga0065712_10079104 3300005290 Bacteria 3259
6 Ga0065715_10001286 3300005293 Bacteria 9820
7 Ga0065715_10177011 3300005293 Bacteria 1504
8 Ga0065707_10000894 3300005295 Bacteria 9824
9 Ga0065707_10139475 3300005295 Bacteria 1792
10 Ga0070670_100084745 3300005331 Bacteria 2723
11 Ga0070670_100088070 3300005331 Bacteria 2669
12 Ga0070670_100144624 3300005331 Bacteria 2057
13 Ga0070680_100024169 3300005336 Bacteria 4850
14 Ga0068868_100010052 3300005338 Bacteria 6837
15 Ga0070668_100172302 3300005347 Bacteria 1763
16 Ga0070669_100018395 3300005353 Bacteria 4995
17 Ga0070669_100102603 3300005353 Bacteria 2160
18 Ga0070669_100113772 3300005353 Bacteria 2056
19 Ga0070675_100200671 3300005354 Bacteria 1731
20 Ga0070675_100261034 3300005354 Bacteria 1518
21 Ga0070674_100007855 3300005356 Bacteria 6310
22 Ga0070674_100312922 3300005356 Bacteria 1256
23 Ga0070673_100035710 3300005364 Bacteria 3771
24 Ga0070673_100041662 3300005364 Bacteria 3535
25 Ga0070673_100072485 3300005364 Bacteria 2770
26 Ga0070688_100012507 3300005365 Bacteria 4757
27 Ga0070688_100151084 3300005365 Bacteria 1587
28 Ga0070659_100067025 3300005366 Bacteria 2846
29 Ga0070667_100197496 3300005367 Bacteria 1784
30 Ga0070703_10011410 3300005406 Bacteria 2509
31 Ga0070713_100003083 3300005436 Bacteria 10955
32 Ga0070711_100043021 3300005439 Bacteria 3057
33 Ga0070711_100060435 3300005439 Bacteria 2634
34 Ga0070700_100005546 3300005441 Bacteria 6688
35 Ga0070694_100042609 3300005444 Bacteria 3033
36 Ga0070694_100157009 3300005444 Bacteria 1666
37 Ga0070708_100100113 3300005445 Bacteria 2652
38 Ga0070681_10009756 3300005458 Bacteria 9448
39 Ga0068867_100017251 3300005459 Bacteria 5128
40 Ga0068867_100075302 3300005459 Bacteria 2532
41 Ga0068867_100100108 3300005459 Bacteria 2212
42 Ga0070706_100262354 3300005467 Bacteria 1612
43 Ga0070707_100012798 3300005468 Bacteria 7832
44 Ga0070698_100038364 3300005471 Bacteria 4936
45 Ga0070698_100041328 3300005471 Bacteria 4733
46 Ga0070699_100002075 3300005518 Bacteria 18133
47 Ga0070699_100010933 3300005518 Bacteria 7851
48 Ga0070679_100031022 3300005530 Bacteria 5281
49 Ga0070679_100041246 3300005530 Bacteria 4594
50 Ga0070697_100010004 3300005536 Bacteria 7401
51 Ga0070697_100039212 3300005536 Bacteria 3829
52 Ga0070697_100338804 3300005536 Bacteria 1297
53 Ga0070672_100034136 3300005543 Bacteria 3859
54 Ga0070686_100091951 3300005544 Bacteria 2031
55 Ga0070695_100019492 3300005545 Bacteria 4131
56 Ga0070695_100065980 3300005545 Bacteria 2358
57 Ga0070695_100092752 3300005545 Bacteria 2019
58 Ga0070696_100031530 3300005546 Bacteria 3633
59 Ga0070665_100008321 3300005548 Bacteria 10492
60 Ga0070665_100068411 3300005548 Bacteria 3561
61 Ga0070665_100240161 3300005548 Bacteria 1812
62 Ga0070665_100254608 3300005548 Bacteria 1756
63 Ga0070665_100391514 3300005548 Bacteria 1397
64 Ga0070704_100016250 3300005549 Bacteria 4699
65 Ga0070704_100051184 3300005549 Bacteria 2907
66 Ga0068855_100030220 3300005563 Bacteria 6480
67 Ga0070664_100199561 3300005564 Bacteria 1785
68 Ga0070664_100210663 3300005564 Bacteria 1737
69 Ga0070702_100012265 3300005615 Bacteria 4289
70 Ga0068859_100005205 3300005617 Bacteria 13216
71 Ga0068859_100195728 3300005617 Bacteria 2106
72 Ga0068859_100350496 3300005617 Bacteria 1571
73 Ga0068864_100190706 3300005618 Bacteria 1879
74 Ga0068866_10142717 3300005718 Bacteria 1377
75 Ga0068861_100001513 3300005719 Bacteria 14718
76 Ga0068861_100170835 3300005719 Bacteria 1802
77 Ga0068863_100079945 3300005841 Bacteria 3097
78 Ga0068863_100163940 3300005841 Bacteria 2131
79 Ga0068858_100014454 3300005842 Bacteria 7438
80 Ga0068858_100030096 3300005842 Bacteria 5042
81 Ga0068858_100183756 3300005842 Bacteria 1975
82 Ga0068860_100183405 3300005843 Bacteria 2023
83 Ga0068862_100031431 3300005844 Bacteria 4482
84 Ga0068862_100040347 3300005844 Bacteria 3968
85 Ga0081455_10001424 3300005937 Bacteria 29569
86 Ga0070717_10009835 3300006028 Bacteria 7202
87 Ga0075364_10008651 3300006051 Bacteria 6087
88 Ga0075362_10000445 3300006177 Bacteria 11997
89 Ga0075367_10032474 3300006178 Bacteria 3004
90 Ga0075366_10023604 3300006195 Bacteria 3584
91 Ga0097621_100003820 3300006237 Bacteria 10439
92 Ga0097621_100029383 3300006237 Bacteria 4341
93 Ga0097621_100043790 3300006237 Bacteria 3609
94 Ga0097621_100079361 3300006237 Bacteria 2728
95 Ga0068871_100000783 3300006358 Bacteria 21404
96 Ga0068871_100002214 3300006358 Bacteria 13207
97 Ga0068871_100041050 3300006358 Bacteria 3708
98 Ga0075428_100001453 3300006844 Bacteria 25347
99 Ga0075428_100042177 3300006844 Bacteria 5018
100 Ga0075430_100004088 3300006846 Bacteria 12313
101 Ga0075431_100000913 3300006847 Bacteria 26025
102 Ga0075431_100125314 3300006847 Bacteria 2651
103 Ga0075431_100431852 3300006847 Bacteria 1315
104 Ga0075434_100076267 3300006871 Bacteria 3347
105 Ga0075429_100154847 3300006880 Bacteria 2007
106 Ga0075429_100281416 3300006880 Bacteria 1457
107 Ga0068865_100013554 3300006881 Bacteria 5156
108 Ga0068865_100025255 3300006881 Bacteria 3906
109 Ga0068865_100273660 3300006881 Bacteria 1342
110 Ga0075436_100003144 3300006914 Bacteria 11321
111 Ga0075436_100019911 3300006914 Bacteria 4602
112 Ga0075436_100105265 3300006914 Bacteria 1967
113 Ga0097620_100005205 3300006931 Bacteria 13216
114 Ga0097620_100195742 3300006931 Bacteria 2106
115 Ga0097620_100350471 3300006931 Bacteria 1571
116 Ga0075435_100003305 3300007076 Bacteria 10935
117 Ga0075435_100004177 3300007076 Bacteria 9907
118 Ga0075435_100026553 3300007076 Bacteria 4520
119 Ga0075435_100097189 3300007076 Bacteria 2437
120 Ga0105240_10038337 3300009093 Bacteria 6147
121 Ga0105240_10152563 3300009093 Bacteria 2750
122 Ga0111539_10000001 3300009094 Bacteria 1035431
123 Ga0111539_10198244 3300009094 Bacteria 2342
124 Ga0111539_10238577 3300009094 Bacteria 2116
125 Ga0105245_10007987 3300009098 Bacteria 9255
126 Ga0105245_10008450 3300009098 Bacteria 8989
127 Ga0114129_10017643 3300009147 Bacteria 10162
128 Ga0114129_10017888 3300009147 Bacteria 10090
129 Ga0114129_10035504 3300009147 Bacteria 7042
130 Ga0114129_10065667 3300009147 Bacteria 5064
131 Ga0114129_10078160 3300009147 Bacteria 4603
132 Ga0114129_10083177 3300009147 Bacteria 4447
133 Ga0114129_10137725 3300009147 Bacteria 3348
134 Ga0114129_10162243 3300009147 Bacteria 3052
135 Ga0114129_10708285 3300009147 Bacteria 1293
136 Ga0105243_10043479 3300009148 Bacteria 3521
137 Ga0105242_10006725 3300009176 Bacteria 8872
138 Ga0105242_10012615 3300009176 Bacteria 6507
139 Ga0105242_10059142 3300009176 Bacteria 3144
140 Ga0105248_10004072 3300009177 Bacteria 16157
141 Ga0105238_10273392 3300009551 Bacteria 1670
142 Ga0105249_10173335 3300009553 Bacteria 2093
143 Ga0105246_10203556 3300011119 Bacteria 1540
144 Ga0105246_10251732 3300011119 Bacteria 1402
145 Ga0157374_10022651 3300013296 Bacteria 5606
146 Ga0157374_10114787 3300013296 Bacteria 2593
147 Ga0163162_10574109 3300013306 Bacteria 1255
148 Ga0157375_10231152 3300013308 Bacteria 2008
149 Ga0163163_10020580 3300014325 Bacteria 6217
150 Ga0163163_10047087 3300014325 Bacteria 4237
151 Ga0163163_10103148 3300014325 Bacteria 2876
152 Ga0157380_10106166 3300014326 Bacteria 2350
153 Ga0157376_10004230 3300014969 Bacteria 9963
154 Ga0157376_10024342 3300014969 Bacteria 4751
155 Ga0157376_10419356 3300014969 Bacteria 1298
156 Ga0157376_10499348 3300014969 Bacteria 1195
157 Ga0207697_10000133 3300025315 Bacteria 35922
158 Ga0207682_10025974 3300025893 Bacteria 2324
159 Ga0207642_10038537 3300025899 Bacteria 2069
160 Ga0207645_10005463 3300025907 Bacteria 9199
161 Ga0207645_10162030 3300025907 Bacteria 1463
162 Ga0207684_10002038 3300025910 Bacteria 20809
163 Ga0207684_10005761 3300025910 Bacteria 11372
164 Ga0207707_10003425 3300025912 Bacteria 14065
165 Ga0207707_10217513 3300025912 Bacteria 1663
166 Ga0207707_10256134 3300025912 Bacteria 1519
167 Ga0207695_10421356 3300025913 Bacteria 1219
168 Ga0207663_10148086 3300025916 Bacteria 1643
169 Ga0207660_10018548 3300025917 Bacteria 4639
170 Ga0207660_10057710 3300025917 Bacteria 2780
171 Ga0207660_10089048 3300025917 Bacteria 2284
172 Ga0207657_10002155 3300025919 Bacteria 21326
173 Ga0207652_10023460 3300025921 Bacteria 5112
174 Ga0207652_10029873 3300025921 Bacteria 4561
175 Ga0207646_10000810 3300025922 Bacteria 40719
176 Ga0207646_10035057 3300025922 Bacteria 4534
177 Ga0207646_10040481 3300025922 Bacteria 4190
178 Ga0207681_10031342 3300025923 Bacteria 3472
179 Ga0207694_10250510 3300025924 Bacteria 1449
180 Ga0207650_10085091 3300025925 Bacteria 2405
181 Ga0207650_10094649 3300025925 Bacteria 2289
182 Ga0207659_10049735 3300025926 Bacteria 2975
183 Ga0207659_10214608 3300025926 Bacteria 1544
184 Ga0207687_10040001 3300025927 Bacteria 3212
185 Ga0207687_10070759 3300025927 Bacteria 2491
186 Ga0207700_10002471 3300025928 Bacteria 10606
187 Ga0207664_10043699 3300025929 Bacteria 3506
188 Ga0207644_10200026 3300025931 Bacteria 1576
189 Ga0207644_10375369 3300025931 Bacteria 1159
190 Ga0207706_10157387 3300025933 Bacteria 1998
191 Ga0207686_10004325 3300025934 Bacteria 7611
192 Ga0207686_10035326 3300025934 Bacteria 2999
193 Ga0207686_10105538 3300025934 Bacteria 1890
194 Ga0207709_10130094 3300025935 Bacteria 1714
195 Ga0207669_10026594 3300025937 Bacteria 3151
196 Ga0207669_10155885 3300025937 Bacteria 1606
197 Ga0207704_10022742 3300025938 Bacteria 3365
198 Ga0207704_10036796 3300025938 Bacteria 2819
199 Ga0207704_10110860 3300025938 Bacteria 1855
200 Ga0207704_10126068 3300025938 Bacteria 1763
201 Ga0207665_10033197 3300025939 Bacteria 3420
202 Ga0207691_10029931 3300025940 Bacteria 5091
203 Ga0207711_10012222 3300025941 Bacteria 7140
204 Ga0207711_10044590 3300025941 Bacteria 3786
205 Ga0207711_10074643 3300025941 Bacteria 2950
206 Ga0207711_10151587 3300025941 Bacteria 2092
207 Ga0207711_10240355 3300025941 Bacteria 1660
208 Ga0207711_10397808 3300025941 Bacteria 1280
209 Ga0207689_10036500 3300025942 Bacteria 4079
210 Ga0207689_10265752 3300025942 Bacteria 1420
211 Ga0207679_10177947 3300025945 Bacteria 1757
212 Ga0207679_10332049 3300025945 Bacteria 1320
213 Ga0207667_10073149 3300025949 Bacteria 3562
214 Ga0207651_10010138 3300025960 Bacteria 5204
215 Ga0207651_10227373 3300025960 Bacteria 1512
216 Ga0207712_10085088 3300025961 Bacteria 2313
217 Ga0207668_10079795 3300025972 Bacteria 2369
218 Ga0207668_10234014 3300025972 Bacteria 1483
219 Ga0207640_10032547 3300025981 Bacteria 3234
220 Ga0207677_10047894 3300026023 Bacteria 2874
221 Ga0207703_10031898 3300026035 Bacteria 4169
222 Ga0207703_10036547 3300026035 Bacteria 3911
223 Ga0207708_10011490 3300026075 Bacteria 6597
224 Ga0207708_10025351 3300026075 Bacteria 4485
225 Ga0207708_10340193 3300026075 Bacteria 1229
226 Ga0207641_10138977 3300026088 Bacteria 2189
227 Ga0207648_10004435 3300026089 Bacteria 14401
228 Ga0207648_10013380 3300026089 Bacteria 7635
229 Ga0207648_10060287 3300026089 Bacteria 3309
230 Ga0207676_10031967 3300026095 Bacteria 3961
231 Ga0207675_100002149 3300026118 Bacteria 19583
232 Ga0207675_100032309 3300026118 Bacteria 4875
233 Ga0207675_100156851 3300026118 Bacteria 2169
234 Ga0207683_10005688 3300026121 Bacteria 10693
235 Ga0207683_10257826 3300026121 Bacteria 1592
236 Ga0207683_10332410 3300026121 Bacteria 1393
237 Ga0207428_10000002 3300027907 Bacteria 854851
238 Ga0268266_10016404 3300028379 Bacteria 6332
239 Ga0268265_10028654 3300028380 Bacteria 3990
240 Ga0268265_10200341 3300028380 Bacteria 1731
241 Ga0268264_10167829 3300028381 Bacteria 1983
242 Ga0268264_10253169 3300028381 Bacteria 1637
243 Ga0268264_10291863 3300028381 Bacteria 1532
244 Ga0307408_100025461 3300031548 Bacteria 4054
245 Ga0307408_100235284 3300031548 Bacteria 1502
246 Ga0307413_10017060 3300031824 Bacteria 3773
247 Ga0307413_10057271 3300031824 Bacteria 2382
248 Ga0307410_10054059 3300031852 Bacteria 2720
249 Ga0307410_10056305 3300031852 Bacteria 2673
250 Ga0307410_10092760 3300031852 Bacteria 2147
251 Ga0307406_10132633 3300031901 Bacteria 1751
252 Ga0307406_10220503 3300031901 Bacteria 1409
253 Ga0307407_10028265 3300031903 Bacteria 2996
254 Ga0307407_10081850 3300031903 Bacteria 1955
255 Ga0307407_10100044 3300031903 Bacteria 1797
256 Ga0307409_100029557 3300031995 Bacteria 3923
257 Ga0307409_100039038 3300031995 Bacteria 3519
258 Ga0307409_100117280 3300031995 Bacteria 2246
259 Ga0307416_100219413 3300032002 Bacteria 1822
260 Ga0307416_100299036 3300032002 Bacteria 1598
261 Ga0307416_100650339 3300032002 Bacteria 1139
262 Ga0307411_10006596 3300032005 Bacteria 5824
263 Ga0307411_10093514 3300032005 Bacteria 2105
264 Ga0307411_10093755 3300032005 Bacteria 2103
265 Ga0307415_100131409 3300032126 Bacteria 1896
266 Ga0316585_10022885 3300032137 Bacteria 1924
267 Ga0373930_0000408 3300034816 Bacteria 5699
268 Ga0373959_0001589 3300034820 Bacteria 3613
269 Ga0373938_0003042 3300034957 Bacteria 2722
270 Ga0373928_0001787 3300035084 Bacteria 4181
271 Ga0373929_0000136 3300035085 Bacteria 12486
272 Ga0373940_0036521 3300035088 Bacteria 1334
273 Ga0373949_0000556 3300035090 Bacteria 12277
274 Ga0373951_0000414 3300035091 Bacteria 12575
275 Ga0373952_0000552 3300035092 Bacteria 6597
276 Ga0373923_0007753 3300035111 Bacteria 3792
277 Ga0373932_0001178 3300035112 Bacteria 7476
278 Ga0373939_0001051 3300035114 Bacteria 6801
279 Ga0373941_0000101 3300035115 Bacteria 14297
280 Ga0373960_0000074 3300035121 Bacteria 14453
281 Ga0373943_0006992 3300035170 Bacteria 5063
282 Ga0373946_0015547 3300035171 Bacteria 2888
283 Ga0373946_0022181 3300035171 Bacteria 2469
284 Ga0373955_0012864 3300035172 Bacteria 4034
285 Ga0373955_0207648 3300035172 Bacteria 1167
286 Ga0373942_0001075 3300035207 Bacteria 7330
287 Ga0373962_0000481 3300035242 Bacteria 8833
288 Ga0373931_0005467 3300035691 Bacteria 5881
289 Ga0373931_0160372 3300035691 Bacteria 1318
290 Ga0373937_0004641 3300036401 Bacteria 11666
291 Ga0373937_0096240 3300036401 Bacteria 2746
292 Ga0373937_0291070 3300036401 Bacteria 1543
293 Ga0373937_0541319 3300036401 Bacteria 1106
294 Ga0316584_0003899 3300036712 Bacteria 9795
295 Ga0373925_0001019 3300037068 Bacteria 25348
296 Ga0373925_0015408 3300037068 Bacteria 5527
297 Ga0373925_0152778 3300037068 Bacteria 1814
298 Ga0436364_1192133 3300037853 Bacteria 2975
299 Ga0400483_265560 3300039062 Bacteria 9326
300 Ga0439446_0001704 3300042156 Bacteria 5096
301 Ga0439435_0015513 3300042436 Bacteria 1898
302 Ga0439460_0064620 3300042461 Bacteria 1123
303 Ga0451576_0034359 3300045051 Bacteria 5385
304 Ga0451576_0574793 3300045051 Bacteria 1184
305 Ga0466967_0132299 3300045976 Bacteria 2317
306 Ga0495629_0130665 3300046459 Bacteria 1749
307 Ga0495651_0124970 3300046462 Bacteria 1885
308 Ga0495608_0018934 3300046511 Bacteria 4745
309 Ga0495608_0095035 3300046511 Bacteria 1926
310 Ga0495628_0019609 3300046516 Bacteria 5587
311 Ga0495628_0129182 3300046516 Bacteria 1934
312 Ga0495630_0027255 3300046517 Bacteria 4236
313 Ga0495652_0098550 3300046529 Bacteria 2376
314 Ga0495586_0115844 3300046535 Bacteria 1494
315 Ga0495645_0001183 3300046543 Bacteria 17811
316 Ga0495645_0027038 3300046543 Bacteria 4167
317 Ga0495633_0040626 3300046558 Bacteria 2215
318 Ga0495647_0086139 3300046681 Bacteria 1281
319 Ga0495658_0080451 3300046683 Bacteria 1911
320 Ga0495658_0151810 3300046683 Bacteria 1423
321 Ga0495669_0003123 3300046684 Bacteria 6815
322 Ga0495613_0000819 3300046689 Bacteria 24089
323 Ga0495600_0097837 3300046809 Bacteria 1913
324 Ga0495581_0083253 3300047315 Bacteria 1853
325 Ga0495604_0093513 3300047317 Bacteria 2224
326 Ga0495674_0029578 3300047319 Bacteria 4987
327 Ga0495674_0172425 3300047319 Bacteria 1804
328 Ga0495684_0000235 3300047471 Bacteria 43518
329 Ga0496100_0442520 3300048903 Bacteria 995
330 Ga0496102_0536868 3300048905 Bacteria 1092
331 Ga0496104_0042217 3300048907 Bacteria 4279
332 Ga0496108_0122160 3300048911 Bacteria 2234
333 Ga0496109_0195592 3300048912 Bacteria 1900
334 Ga0496109_0449245 3300048912 Bacteria 1218
335 Ga0496110_0031725 3300048913 Bacteria 4561
336 Ga0496112_0021001 3300048915 Bacteria 6201
337 Ga0496112_0327583 3300048915 Bacteria 1476
338 Ga0496113_0035011 3300048916 Bacteria 3669
339 Ga0496115_0190953 3300048918 Bacteria 1692
340 Ga0501034_0008745 3300049571 Bacteria 10659
341 Ga0501034_0043603 3300049571 Bacteria 4539
342 Ga0501034_0087025 3300049571 Bacteria 3125
343 Ga0501034_0400451 3300049571 Bacteria 1295
344 Ga0501036_0241731 3300049572 Bacteria 1514
345 Ga0501047_0362140 3300049581 Bacteria 1286
346 Ga0501048_0086670 3300049582 Bacteria 2209
347 Ga0501048_0297419 3300049582 Bacteria 1148
348 Ga0501067_0081173 3300049583 Bacteria 1798
349 Ga0501071_0189065 3300049587 Bacteria 1544
350 Ga0501072_0059945 3300049588 Bacteria 3001
351 Ga0501073_0233992 3300049589 Bacteria 1269
352 Ga0501074_0154330 3300049590 Bacteria 1641
353 Ga0501076_0140707 3300049592 Bacteria 1960
354 Ga0501076_0147146 3300049592 Bacteria 1916
355 Ga0501079_0046559 3300049741 Bacteria 3347
356 Ga0501080_0342393 3300049742 Bacteria 1351
357 Ga0501044_0003092 3300049823 Bacteria 18842
358 Ga0501045_0275930 3300049824 Bacteria 1251
359 Ga0501045_0341123 3300049824 Bacteria 1115
360 nmdc:mga00v17_14485_c1 3300050491 Bacteria 4402
361 nmdc:mga0k408_43884_c1 3300050493 Bacteria 2578
362 nmdc:mga05p37_17597_c1 3300050507 Bacteria 8626
363 nmdc:mga05p37_19883_c1 3300050507 Bacteria 8122
364 nmdc:mga05p37_209159_c1 3300050507 Bacteria 2359
365 nmdc:mga05p37_26387_c1 3300050507 Bacteria 7065
366 nmdc:mga05p37_37131_c1 3300050507 Bacteria 5976
367 nmdc:mga05p37_402068_c1 3300050507 Bacteria 1599
368 nmdc:mga09592_251445_c1 3300050508 Bacteria 1532
369 nmdc:mga09592_93072_c1 3300050508 Bacteria 2577
370 nmdc:mga0qj67_351199_c1 3300050509 Bacteria 1192
371 nmdc:mga0qj67_7086_c1 3300050509 Bacteria 8270
372 nmdc:mga06r32_28104_c1 3300050510 Bacteria 5260
373 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
374 nmdc:mga08y16_435304_c1 3300050511 Bacteria 1339
375 nmdc:mga08y16_8464_c1 3300050511 Bacteria 10772
376 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
377 nmdc:mga0n895_205817_c1 3300050512 Bacteria 1998
378 nmdc:mga0n895_429752_c1 3300050512 Bacteria 1335
379 nmdc:mga0n895_62441_c1 3300050512 Bacteria 3682
380 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
381 nmdc:mga0rr50_3040_c1 3300050513 Bacteria 9597
382 nmdc:mga0rr50_494698_c1 3300050513 Bacteria 1039
383 nmdc:mga08x19_20176_c1 3300050514 Bacteria 4103
384 nmdc:mga08x19_2537_c1 3300050514 Bacteria 11101
385 nmdc:mga08x19_43868_c1 3300050514 Bacteria 2853
386 Ga0495601_0154434 3300053077 Bacteria 1499
387 Ga0495595_0084765 3300053084 Bacteria 1514
388 Ga0495619_0012750 3300053085 Bacteria 5291
389 Ga0495619_0049036 3300053085 Bacteria 2783
390 Ga0495619_0049604 3300053085 Bacteria 2769
391 Ga0500555_000258 3300053103 Bacteria 23303
392 Ga0500616_0001849 3300053153 Bacteria 19174
393 Ga0500645_000060 3300053730 Bacteria 89018
394 Ga0501084_0011682 3300054114 Bacteria 7271
395 Ga0501084_0153141 3300054114 Bacteria 1944
396 Ga0501084_0378643 3300054114 Bacteria 1196
397 Ga0590071_000380 3300059421 Bacteria 13035
398 Ga0590071_000890 3300059421 Bacteria 8300
399 Ga0590074_002618 3300059423 Bacteria 2953
400 Ga0590075_000108 3300059424 Bacteria 21310
401 Ga0590075_001091 3300059424 Bacteria 7004
402 Ga0590075_019483 3300059424 Bacteria 1684
403 Ga0590077_000670 3300059426 Bacteria 9109
404 Ga0501082_0390654 3300060353 Bacteria 1214
405 Ga0530510_0098374 3300061734 Bacteria 2139
406 2883357695 2883354860 Bacteria 5865246
407 Ga0075428_100000003
408 JGI24751J29686_10009533
409 Ga0065712_10070358
410 Ga0065712_10070543
411 Ga0065712_10079104
412 Ga0065715_10001286
413 Ga0065715_10177011
414 Ga0065707_10000894
415 Ga0065707_10139475
416 Ga0070670_100084745
417 Ga0070670_100088070
418 Ga0070670_100144624
419 Ga0070680_100024169
420 Ga0068868_100010052
421 Ga0070668_100172302
422 Ga0070669_100018395
423 Ga0070669_100102603
424 Ga0070669_100113772
425 Ga0070675_100200671
426 Ga0070675_100261034
427 Ga0070674_100007855
428 Ga0070674_100312922
429 Ga0070673_100035710
430 Ga0070673_100041662
431 Ga0070673_100072485
432 Ga0070688_100012507
433 Ga0070688_100151084
434 Ga0070659_100067025
435 Ga0070667_100197496
436 Ga0070703_10011410
437 Ga0070713_100003083
438 Ga0070711_100043021
439 Ga0070711_100060435
440 Ga0070700_100005546
441 Ga0070694_100042609
442 Ga0070694_100157009
443 Ga0070708_100100113
444 Ga0070681_10009756
445 Ga0068867_100017251
446 Ga0068867_100075302
447 Ga0068867_100100108
448 Ga0070706_100262354
449 Ga0070707_100012798
450 Ga0070698_100038364
451 Ga0070698_100041328
452 Ga0070699_100002075
453 Ga0070699_100010933
454 Ga0070679_100031022
455 Ga0070679_100041246
456 Ga0070697_100010004
457 Ga0070697_100039212
458 Ga0070697_100338804
459 Ga0070672_100034136
460 Ga0070686_100091951
461 Ga0070695_100019492
462 Ga0070695_100065980
463 Ga0070695_100092752
464 Ga0070696_100031530
465 Ga0070665_100008321
466 Ga0070665_100068411
467 Ga0070665_100240161
468 Ga0070665_100254608
469 Ga0070665_100391514
470 Ga0070704_100016250
471 Ga0070704_100051184
472 Ga0068855_100030220
473 Ga0070664_100199561
474 Ga0070664_100210663
475 Ga0070702_100012265
476 Ga0068859_100005205
477 Ga0068859_100195728
478 Ga0068859_100350496
479 Ga0068864_100190706
480 Ga0068866_10142717
481 Ga0068861_100001513
482 Ga0068861_100170835
483 Ga0068863_100079945
484 Ga0068863_100163940
485 Ga0068858_100014454
486 Ga0068858_100030096
487 Ga0068858_100183756
488 Ga0068860_100183405
489 Ga0068862_100031431
490 Ga0068862_100040347
491 Ga0081455_10001424
492 Ga0070717_10009835
493 Ga0075364_10008651
494 Ga0075362_10000445
495 Ga0075367_10032474
496 Ga0075366_10023604
497 Ga0097621_100003820
498 Ga0097621_100029383
499 Ga0097621_100043790
500 Ga0097621_100079361
501 Ga0068871_100000783
502 Ga0068871_100002214
503 Ga0068871_100041050
504 Ga0075428_100001453
505 Ga0075428_100042177
506 Ga0075430_100004088
507 Ga0075431_100000913
508 Ga0075431_100125314
509 Ga0075431_100431852
510 Ga0075434_100076267
511 Ga0075429_100154847
512 Ga0075429_100281416
513 Ga0068865_100013554
514 Ga0068865_100025255
515 Ga0068865_100273660
516 Ga0075436_100003144
517 Ga0075436_100019911
518 Ga0075436_100105265
519 Ga0097620_100005205
520 Ga0097620_100195742
521 Ga0097620_100350471
522 Ga0075435_100003305
523 Ga0075435_100004177
524 Ga0075435_100026553
525 Ga0075435_100097189
526 Ga0105240_10038337
527 Ga0105240_10152563
528 Ga0111539_10000001
529 Ga0111539_10198244
530 Ga0111539_10238577
531 Ga0105245_10007987
532 Ga0105245_10008450
533 Ga0114129_10017643
534 Ga0114129_10017888
535 Ga0114129_10035504
536 Ga0114129_10065667
537 Ga0114129_10078160
538 Ga0114129_10083177
539 Ga0114129_10137725
540 Ga0114129_10162243
541 Ga0114129_10708285
542 Ga0105243_10043479
543 Ga0105242_10006725
544 Ga0105242_10012615
545 Ga0105242_10059142
546 Ga0105248_10004072
547 Ga0105238_10273392
548 Ga0105249_10173335
549 Ga0105246_10203556
550 Ga0105246_10251732
551 Ga0157374_10022651
552 Ga0157374_10114787
553 Ga0163162_10574109
554 Ga0157375_10231152
555 Ga0163163_10020580
556 Ga0163163_10047087
557 Ga0163163_10103148
558 Ga0157380_10106166
559 Ga0157376_10004230
560 Ga0157376_10024342
561 Ga0157376_10419356
562 Ga0157376_10499348
563 Ga0207697_10000133
564 Ga0207682_10025974
565 Ga0207642_10038537
566 Ga0207645_10005463
567 Ga0207645_10162030
568 Ga0207684_10002038
569 Ga0207684_10005761
570 Ga0207707_10003425
571 Ga0207707_10217513
572 Ga0207707_10256134
573 Ga0207695_10421356
574 Ga0207663_10148086
575 Ga0207660_10018548
576 Ga0207660_10057710
577 Ga0207660_10089048
578 Ga0207657_10002155
579 Ga0207652_10023460
580 Ga0207652_10029873
581 Ga0207646_10000810
582 Ga0207646_10035057
583 Ga0207646_10040481
584 Ga0207681_10031342
585 Ga0207694_10250510
586 Ga0207650_10085091
587 Ga0207650_10094649
588 Ga0207659_10049735
589 Ga0207659_10214608
590 Ga0207687_10040001
591 Ga0207687_10070759
592 Ga0207700_10002471
593 Ga0207664_10043699
594 Ga0207644_10200026
595 Ga0207644_10375369
596 Ga0207706_10157387
597 Ga0207686_10004325
598 Ga0207686_10035326
599 Ga0207686_10105538
600 Ga0207709_10130094
601 Ga0207669_10026594
602 Ga0207669_10155885
603 Ga0207704_10022742
604 Ga0207704_10036796
605 Ga0207704_10110860
606 Ga0207704_10126068
607 Ga0207665_10033197
608 Ga0207691_10029931
609 Ga0207711_10012222
610 Ga0207711_10044590
611 Ga0207711_10074643
612 Ga0207711_10151587
613 Ga0207711_10240355
614 Ga0207711_10397808
615 Ga0207689_10036500
616 Ga0207689_10265752
617 Ga0207679_10177947
618 Ga0207679_10332049
619 Ga0207667_10073149
620 Ga0207651_10010138
621 Ga0207651_10227373
622 Ga0207712_10085088
623 Ga0207668_10079795
624 Ga0207668_10234014
625 Ga0207640_10032547
626 Ga0207677_10047894
627 Ga0207703_10031898
628 Ga0207703_10036547
629 Ga0207708_10011490
630 Ga0207708_10025351
631 Ga0207708_10340193
632 Ga0207641_10138977
633 Ga0207648_10004435
634 Ga0207648_10013380
635 Ga0207648_10060287
636 Ga0207676_10031967
637 Ga0207675_100002149
638 Ga0207675_100032309
639 Ga0207675_100156851
640 Ga0207683_10005688
641 Ga0207683_10257826
642 Ga0207683_10332410
643 Ga0207428_10000002
644 Ga0268266_10016404
645 Ga0268265_10028654
646 Ga0268265_10200341
647 Ga0268264_10167829
648 Ga0268264_10253169
649 Ga0268264_10291863
650 Ga0307408_100025461
651 Ga0307408_100235284
652 Ga0307413_10017060
653 Ga0307413_10057271
654 Ga0307410_10054059
655 Ga0307410_10056305
656 Ga0307410_10092760
657 Ga0307406_10132633
658 Ga0307406_10220503
659 Ga0307407_10028265
660 Ga0307407_10081850
661 Ga0307407_10100044
662 Ga0307409_100029557
663 Ga0307409_100039038
664 Ga0307409_100117280
665 Ga0307416_100219413
666 Ga0307416_100299036
667 Ga0307416_100650339
668 Ga0307411_10006596
669 Ga0307411_10093514
670 Ga0307411_10093755
671 Ga0307415_100131409
672 Ga0316585_10022885
673 Ga0373930_0000408
674 Ga0373959_0001589
675 Ga0373938_0003042
676 Ga0373928_0001787
677 Ga0373929_0000136
678 Ga0373940_0036521
679 Ga0373949_0000556
680 Ga0373951_0000414
681 Ga0373952_0000552
682 Ga0373923_0007753
683 Ga0373932_0001178
684 Ga0373939_0001051
685 Ga0373941_0000101
686 Ga0373960_0000074
687 Ga0373943_0006992
688 Ga0373946_0015547
689 Ga0373946_0022181
690 Ga0373955_0012864
691 Ga0373955_0207648
692 Ga0373942_0001075
693 Ga0373962_0000481
694 Ga0373931_0005467
695 Ga0373931_0160372
696 Ga0373937_0004641
697 Ga0373937_0096240
698 Ga0373937_0291070
699 Ga0373937_0541319
700 Ga0316584_0003899
701 Ga0373925_0001019
702 Ga0373925_0015408
703 Ga0373925_0152778
704 Ga0436364_1192133
705 Ga0400483_265560
706 Ga0439446_0001704
707 Ga0439435_0015513
708 Ga0439460_0064620
709 Ga0451576_0034359
710 Ga0451576_0574793
711 Ga0466967_0132299
712 Ga0495629_0130665
713 Ga0495651_0124970
714 Ga0495608_0018934
715 Ga0495608_0095035
716 Ga0495628_0019609
717 Ga0495628_0129182
718 Ga0495630_0027255
719 Ga0495652_0098550
720 Ga0495586_0115844
721 Ga0495645_0001183
722 Ga0495645_0027038
723 Ga0495633_0040626
724 Ga0495647_0086139
725 Ga0495658_0080451
726 Ga0495658_0151810
727 Ga0495669_0003123
728 Ga0495613_0000819
729 Ga0495600_0097837
730 Ga0495581_0083253
731 Ga0495604_0093513
732 Ga0495674_0029578
733 Ga0495674_0172425
734 Ga0495684_0000235
735 Ga0496100_0442520
736 Ga0496102_0536868
737 Ga0496104_0042217
738 Ga0496108_0122160
739 Ga0496109_0195592
740 Ga0496109_0449245
741 Ga0496110_0031725
742 Ga0496112_0021001
743 Ga0496112_0327583
744 Ga0496113_0035011
745 Ga0496115_0190953
746 Ga0501034_0008745
747 Ga0501034_0043603
748 Ga0501034_0087025
749 Ga0501034_0400451
750 Ga0501036_0241731
751 Ga0501047_0362140
752 Ga0501048_0086670
753 Ga0501048_0297419
754 Ga0501067_0081173
755 Ga0501071_0189065
756 Ga0501072_0059945
757 Ga0501073_0233992
758 Ga0501074_0154330
759 Ga0501076_0140707
760 Ga0501076_0147146
761 Ga0501079_0046559
762 Ga0501080_0342393
763 Ga0501044_0003092
764 Ga0501045_0275930
765 Ga0501045_0341123
766 nmdc:mga00v17_14485_c1
767 nmdc:mga0k408_43884_c1
768 nmdc:mga05p37_17597_c1
769 nmdc:mga05p37_19883_c1
770 nmdc:mga05p37_209159_c1
771 nmdc:mga05p37_26387_c1
772 nmdc:mga05p37_37131_c1
773 nmdc:mga05p37_402068_c1
774 nmdc:mga09592_251445_c1
775 nmdc:mga09592_93072_c1
776 nmdc:mga0qj67_351199_c1
777 nmdc:mga0qj67_7086_c1
778 nmdc:mga06r32_28104_c1
779 nmdc:mga08y16_3_c1
780 nmdc:mga08y16_435304_c1
781 nmdc:mga08y16_8464_c1
782 nmdc:mga0n895_10_c1
783 nmdc:mga0n895_205817_c1
784 nmdc:mga0n895_429752_c1
785 nmdc:mga0n895_62441_c1
786 nmdc:mga0rr50_20_c1
787 nmdc:mga0rr50_3040_c1
788 nmdc:mga0rr50_494698_c1
789 nmdc:mga08x19_20176_c1
790 nmdc:mga08x19_2537_c1
791 nmdc:mga08x19_43868_c1
792 Ga0495601_0154434
793 Ga0495595_0084765
794 Ga0495619_0012750
795 Ga0495619_0049036
796 Ga0495619_0049604
797 Ga0500555_000258
798 Ga0500616_0001849
799 Ga0500645_000060
800 Ga0501084_0011682
801 Ga0501084_0153141
802 Ga0501084_0378643
803 Ga0590071_000380
804 Ga0590071_000890
805 Ga0590074_002618
806 Ga0590075_000108
807 Ga0590075_001091
808 Ga0590075_019483
809 Ga0590077_000670
810 Ga0501082_0390654
811 Ga0530510_0098374
812 2883357695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

7

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmx-assembly1.cif.gz_X crystal structure of tartrate dehydrogenase from pseudomonas putida complexed with nadh 0.9533 13 360
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.9384 13 361
2g4o-assembly1.cif.gz_A anomalous substructure of 3-isopropylmalate dehydrogenase 0.933 13 361
6lky-assembly1.cif.gz_B crystal structure of isocitrate dehydrogenase from methylococcus capsulatus 0.9297 13 360
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.9245 11 361
ID Description Score Start End Superfamily
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.964 11 360 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9425 13 361 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9371 13 361 3.40.718.10
af_P76251_1_360_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9353 11 360 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9264 13 360 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A382X5Y5-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9765 12 109
AF-A0A3B9S1N1-F1-model_v4 Tartrate dehydrogenase 0.975 11 181
AF-A0A7Z9UXS5-F1-model_v4 Tartrate dehydrogenase 0.9748 10 107
AF-A0A3D5FWU8-F1-model_v4 deleted 0.9724 12 110
AF-A0A3N5YZP0-F1-model_v4 D-malate dehydrogenase (decarboxylating) (EC 1.1.1.83) 0.972 26 360 GO:0000287
GO:0046553
GO:0051287

Map