F435985

General Info

Members Datasets Scaffolds Average Seq Length
405 249 810 153

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100282202|Ga0307409_1002822022
Length 150
Sequence MSHLDAIADRVQIEALRGEFTDAVMMRDYDRLASLFTPDGAVRIPHVGAEATSREQIRAGVEHMQGAWDCFVQHTHPGAIELDGDIARGRAYVSELMHGPGGSHQNLAVYHDSYRRTLDGWKFAERVYEVKYVDVAPLANSAAAVAADGS

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
244 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
245 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
246 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
247 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
248 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
249 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0.74
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 3.46
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100282202 3300031995 Bacteria 1536
2 JGI25406J46586_10004839 3300003203 Bacteria 6258
3 JGI25407J50210_10016716 3300003373 Bacteria 1901
4 Ga0070658_10007596 3300005327 Bacteria 8748
5 Ga0070683_100029464 3300005329 Bacteria 4970
6 Ga0070683_100112511 3300005329 Bacteria 2569
7 Ga0070683_101184525 3300005329 Bacteria 734
8 Ga0070683_101484005 3300005329 Bacteria 652
9 Ga0070690_101082248 3300005330 Bacteria 635
10 Ga0070682_100001730 3300005337 Bacteria 12142
11 Ga0070660_100047824 3300005339 Bacteria 3284
12 Ga0070687_100112971 3300005343 Bacteria 1541
13 Ga0070668_100140444 3300005347 Bacteria 1946
14 Ga0070659_100062353 3300005366 Bacteria 2947
15 Ga0070667_100842704 3300005367 Bacteria 852
16 Ga0070709_10099482 3300005434 Bacteria 1934
17 Ga0070709_10230933 3300005434 Bacteria 1324
18 Ga0070709_10484035 3300005434 Bacteria 937
19 Ga0070709_10930848 3300005434 Bacteria 688
20 Ga0070714_100004064 3300005435 Bacteria 10996
21 Ga0070714_101065640 3300005435 Bacteria 787
22 Ga0070713_100024057 3300005436 Bacteria 4738
23 Ga0070713_100402352 3300005436 Bacteria 1279
24 Ga0070713_100727323 3300005436 Bacteria 948
25 Ga0070713_101290374 3300005436 Bacteria 707
26 Ga0070710_10000411 3300005437 Bacteria 20167
27 Ga0070711_100002526 3300005439 Bacteria 10461
28 Ga0070711_100041427 3300005439 Bacteria 3110
29 Ga0070708_100286476 3300005445 Bacteria 1550
30 Ga0070681_10207269 3300005458 Bacteria 1877
31 Ga0070681_11147496 3300005458 Bacteria 698
32 Ga0070685_10049542 3300005466 Bacteria 2423
33 Ga0070706_100005237 3300005467 Bacteria 12367
34 Ga0070706_100036424 3300005467 Bacteria 4544
35 Ga0070707_100036986 3300005468 Bacteria 4658
36 Ga0070707_101049643 3300005468 Bacteria 780
37 Ga0070698_100033798 3300005471 Bacteria 5297
38 Ga0070698_100038756 3300005471 Bacteria 4910
39 Ga0070698_100049834 3300005471 Bacteria 4273
40 Ga0070698_100073087 3300005471 Bacteria 3436
41 Ga0070698_100553860 3300005471 Bacteria 1089
42 Ga0070679_100897579 3300005530 Bacteria 830
43 Ga0070684_100002397 3300005535 Bacteria 13817
44 Ga0070686_100636032 3300005544 Bacteria 844
45 Ga0070695_100238276 3300005545 Bacteria 1319
46 Ga0070693_100126622 3300005547 Bacteria 1591
47 Ga0070665_100152662 3300005548 Bacteria 2312
48 Ga0070665_100909463 3300005548 Bacteria 893
49 Ga0068855_100385510 3300005563 Bacteria 1538
50 Ga0070664_100194434 3300005564 Bacteria 1808
51 Ga0068857_100071400 3300005577 Bacteria 3093
52 Ga0068854_100502501 3300005578 Bacteria 1021
53 Ga0068856_100092347 3300005614 Bacteria 3012
54 Ga0070702_100375354 3300005615 Bacteria 1009
55 Ga0068852_100039060 3300005616 Bacteria 3994
56 Ga0068864_100039132 3300005618 Bacteria 4052
57 Ga0068866_10026506 3300005718 Bacteria 2738
58 Ga0068860_100040754 3300005843 Bacteria 4437
59 Ga0081538_10000966 3300005981 Bacteria 30669
60 Ga0081538_10001877 3300005981 Bacteria 21195
61 Ga0081538_10012770 3300005981 Bacteria 6708
62 Ga0081538_10014818 3300005981 Bacteria 6077
63 Ga0081538_10042698 3300005981 Bacteria 2858
64 Ga0081539_10000214 3300005985 Bacteria 135110
65 Ga0070717_10129219 3300006028 Bacteria 2171
66 Ga0070717_10402781 3300006028 Bacteria 1229
67 Ga0070717_10604845 3300006028 Bacteria 994
68 Ga0075365_10050618 3300006038 Bacteria 2741
69 Ga0075364_10173519 3300006051 Bacteria 1458
70 Ga0070715_10012305 3300006163 Bacteria 3110
71 Ga0070716_100000316 3300006173 Bacteria 19449
72 Ga0070716_100026047 3300006173 Bacteria 3127
73 Ga0070712_100001872 3300006175 Bacteria 12845
74 Ga0070712_100111928 3300006175 Bacteria 2039
75 Ga0070712_100922190 3300006175 Bacteria 754
76 Ga0097621_100064104 3300006237 Bacteria 3021
77 Ga0097621_100535448 3300006237 Bacteria 1065
78 Ga0075428_100053619 3300006844 Bacteria 4418
79 Ga0068865_100059999 3300006881 Bacteria 2662
80 Ga0075435_101100681 3300007076 Bacteria 695
81 Ga0105245_10002375 3300009098 Bacteria 17026
82 Ga0114129_10107240 3300009147 Bacteria 3858
83 Ga0105243_11452599 3300009148 Bacteria 708
84 Ga0105238_10479797 3300009551 Bacteria 1243
85 Ga0105249_10155470 3300009553 Bacteria 2205
86 Ga0099796_10032338 3300010159 Bacteria 1713
87 Ga0105239_10005659 3300010375 Bacteria 14602
88 Ga0105246_10003076 3300011119 Bacteria 10132
89 Ga0157370_10559296 3300013104 Bacteria 1048
90 Ga0157369_10108448 3300013105 Bacteria 2953
91 Ga0157374_10293770 3300013296 Bacteria 1607
92 Ga0157374_10496625 3300013296 Bacteria 1224
93 Ga0163162_10030514 3300013306 Bacteria 5341
94 Ga0163162_10761246 3300013306 Bacteria 1087
95 Ga0157372_10052520 3300013307 Bacteria 4539
96 Ga0157375_10015955 3300013308 Bacteria 6738
97 Ga0163163_10055611 3300014325 Bacteria 3911
98 Ga0163163_10492133 3300014325 Bacteria 1288
99 Ga0163163_10906340 3300014325 Bacteria 945
100 Ga0157377_10102961 3300014745 Bacteria 1704
101 Ga0157379_10014219 3300014968 Bacteria 6981
102 Ga0157379_10310904 3300014968 Unclassified 1437
103 Ga0157379_10883875 3300014968 Bacteria 847
104 Ga0157376_10209503 3300014969 Bacteria 1799
105 Ga0206354_11237526 3300020081 Bacteria 1446
106 Ga0206353_11142057 3300020082 Bacteria 1726
107 Ga0224712_10029280 3300022467 Bacteria 1976
108 Ga0207692_10000708 3300025898 Bacteria 11730
109 Ga0207692_10070034 3300025898 Bacteria 1845
110 Ga0207642_10644263 3300025899 Bacteria 663
111 Ga0207688_10035554 3300025901 Bacteria 2760
112 Ga0207647_10059245 3300025904 Bacteria 2343
113 Ga0207685_10026951 3300025905 Bacteria 2005
114 Ga0207699_10000918 3300025906 Bacteria 14073
115 Ga0207699_10055407 3300025906 Bacteria 2359
116 Ga0207699_10292246 3300025906 Bacteria 1136
117 Ga0207699_10792180 3300025906 Bacteria 697
118 Ga0207705_10126070 3300025909 Bacteria 1903
119 Ga0207684_10061538 3300025910 Bacteria 3188
120 Ga0207684_10231750 3300025910 Bacteria 1593
121 Ga0207684_10492831 3300025910 Bacteria 1051
122 Ga0207693_10013291 3300025915 Bacteria 6641
123 Ga0207693_10330365 3300025915 Bacteria 1193
124 Ga0207663_10021902 3300025916 Bacteria 3645
125 Ga0207662_10413948 3300025918 Bacteria 916
126 Ga0207657_10025134 3300025919 Bacteria 5498
127 Ga0207652_10419119 3300025921 Bacteria 1208
128 Ga0207646_10077729 3300025922 Bacteria 2966
129 Ga0207646_10132848 3300025922 Bacteria 2241
130 Ga0207687_10013902 3300025927 Bacteria 5260
131 Ga0207700_10000662 3300025928 Bacteria 20159
132 Ga0207700_10241653 3300025928 Bacteria 1539
133 Ga0207700_10263887 3300025928 Bacteria 1476
134 Ga0207664_10001227 3300025929 Bacteria 16980
135 Ga0207664_10058540 3300025929 Bacteria 3065
136 Ga0207664_10095500 3300025929 Bacteria 2445
137 Ga0207664_10238660 3300025929 Bacteria 1582
138 Ga0207644_11288053 3300025931 Bacteria 614
139 Ga0207690_10118019 3300025932 Bacteria 1922
140 Ga0207704_10031481 3300025938 Bacteria 2989
141 Ga0207665_10000242 3300025939 Bacteria 37438
142 Ga0207665_10004673 3300025939 Bacteria 9098
143 Ga0207661_10057805 3300025944 Bacteria 3120
144 Ga0207661_10176340 3300025944 Bacteria 1864
145 Ga0207667_10356435 3300025949 Bacteria 1492
146 Ga0207640_10979254 3300025981 Bacteria 743
147 Ga0207658_10618650 3300025986 Bacteria 974
148 Ga0207702_10321199 3300026078 Bacteria 1474
149 Ga0207676_10065898 3300026095 Bacteria 2886
150 Ga0207674_10017070 3300026116 Bacteria 7923
151 Ga0207698_10314109 3300026142 Bacteria 1465
152 Ga0268266_10194982 3300028379 Bacteria 1851
153 Ga0268266_11400245 3300028379 Bacteria 675
154 Ga0268264_10045783 3300028381 Bacteria 3633
155 Ga0307515_10019119 3300028794 Bacteria 12352
156 Ga0307512_10002799 3300030522 Bacteria 21251
157 Ga0307512_10044067 3300030522 Bacteria 3672
158 Ga0316181_1106578 3300030744 Bacteria 1893
159 Ga0307513_10021598 3300031456 Bacteria 7595
160 Ga0307513_10608027 3300031456 Bacteria 802
161 Ga0307508_10033376 3300031616 Bacteria 4645
162 Ga0307508_10176125 3300031616 Bacteria 1742
163 Ga0307516_10280343 3300031730 Bacteria 1349
164 Ga0307405_10191251 3300031731 Bacteria 1478
165 Ga0307413_10400535 3300031824 Bacteria 1075
166 Ga0307410_10058878 3300031852 Bacteria 2620
167 Ga0307407_10022545 3300031903 Bacteria 3269
168 Ga0307409_100636555 3300031995 Bacteria 1058
169 Ga0307409_100718230 3300031995 Bacteria 1000
170 Ga0307416_102387130 3300032002 Bacteria 628
171 Ga0307411_10273826 3300032005 Bacteria 1340
172 Ga0307415_100267509 3300032126 Bacteria 1398
173 Ga0307507_10047237 3300033179 Bacteria 4208
174 Ga0373959_0153404 3300034820 Bacteria 584
175 Ga0373934_0000464 3300035086 Bacteria 14174
176 Ga0373940_0373966 3300035088 Bacteria 504
177 Ga0373944_0000494 3300035089 Bacteria 9176
178 Ga0373944_0028238 3300035089 Bacteria 1669
179 Ga0373923_0013041 3300035111 Bacteria 3088
180 Ga0373932_0312571 3300035112 Bacteria 589
181 Ga0373936_0000113 3300035113 Bacteria 28216
182 Ga0373936_0017310 3300035113 Bacteria 2774
183 Ga0373945_0000159 3300035116 Bacteria 17448
184 Ga0373945_0340517 3300035116 Bacteria 649
185 Ga0373953_0000990 3300035117 Bacteria 7988
186 Ga0373953_0023545 3300035117 Bacteria 2331
187 Ga0373954_0015751 3300035118 Bacteria 3381
188 Ga0373956_0000341 3300035119 Bacteria 18807
189 Ga0373956_0023373 3300035119 Bacteria 2652
190 Ga0373956_0288829 3300035119 Bacteria 781
191 Ga0373957_0000371 3300035120 Bacteria 11376
192 Ga0373957_0053752 3300035120 Bacteria 1545
193 Ga0373943_0403956 3300035170 Bacteria 789
194 Ga0373946_0003577 3300035171 Bacteria 5514
195 Ga0373946_0468788 3300035171 Bacteria 643
196 Ga0373955_0000222 3300035172 Bacteria 23967
197 Ga0373955_0146347 3300035172 Bacteria 1388
198 Ga0373955_0285398 3300035172 Bacteria 993
199 Ga0373924_0002069 3300035410 Bacteria 6699
200 Ga0373924_0035079 3300035410 Bacteria 2034
201 Ga0373924_0253525 3300035410 Bacteria 779
202 Ga0373935_0021442 3300035692 Bacteria 3955
203 Ga0373935_0144256 3300035692 Bacteria 1610
204 Ga0373935_0737480 3300035692 Bacteria 725
205 Ga0373927_0000672 3300035695 Bacteria 26044
206 Ga0373933_0000848 3300035724 Bacteria 18692
207 Ga0373933_0030974 3300035724 Bacteria 3100
208 Ga0373947_0000311 3300035725 Bacteria 27567
209 Ga0373947_0030320 3300035725 Bacteria 3178
210 Ga0373937_0001634 3300036401 Bacteria 18834
211 Ga0373937_0131379 3300036401 Bacteria 2338
212 Ga0373937_0451502 3300036401 Bacteria 1221
213 Ga0373937_0840471 3300036401 Bacteria 866
214 Ga0373925_0016376 3300037068 Bacteria 5369
215 Ga0373925_0059371 3300037068 Bacteria 2869
216 Ga0373925_0122354 3300037068 Bacteria 2021
217 Ga0395898_0102067 3300037466 Bacteria 2754
218 Ga0395901_0173058 3300038443 Bacteria 2265
219 Ga0395901_1373007 3300038443 Bacteria 666
220 Ga0450907_061603 3300042146 Bacteria 648
221 Ga0466961_0222997 3300044693 Bacteria 1162
222 Ga0466957_0168630 3300044842 Bacteria 1425
223 Ga0451576_0396574 3300045051 Bacteria 1447
224 Ga0495617_066127 3300046452 Bacteria 1192
225 Ga0495592_0001091 3300046454 Bacteria 18834
226 Ga0495592_0273809 3300046454 Bacteria 1106
227 Ga0495603_0005637 3300046455 Bacteria 7483
228 Ga0495603_0219189 3300046455 Bacteria 1098
229 Ga0495629_0001029 3300046459 Bacteria 22347
230 Ga0495629_0004327 3300046459 Bacteria 10645
231 Ga0495629_0050027 3300046459 Bacteria 2928
232 Ga0495641_0019611 3300046461 Bacteria 3453
233 Ga0495641_0027928 3300046461 Bacteria 2736
234 Ga0495651_0001382 3300046462 Bacteria 18834
235 Ga0495651_0039388 3300046462 Bacteria 3679
236 Ga0495651_0210295 3300046462 Bacteria 1354
237 Ga0495653_0005648 3300046463 Bacteria 10211
238 Ga0495582_0031312 3300046473 Bacteria 2923
239 Ga0495582_0044261 3300046473 Bacteria 2452
240 Ga0495605_0099706 3300046474 Bacteria 1337
241 Ga0495639_0033060 3300046475 Bacteria 2309
242 Ga0495662_0010024 3300046476 Bacteria 4649
243 Ga0495662_0148095 3300046476 Bacteria 1156
244 Ga0495662_0401543 3300046476 Bacteria 673
245 Ga0495662_0411106 3300046476 Bacteria 664
246 Ga0495664_0003384 3300046477 Bacteria 8662
247 Ga0495664_0024744 3300046477 Bacteria 3490
248 Ga0495664_0375255 3300046477 Bacteria 855
249 Ga0495585_0266705 3300046492 Bacteria 850
250 Ga0495594_0004715 3300046499 Bacteria 7027
251 Ga0495583_0020410 3300046506 Bacteria 3433
252 Ga0495606_0036390 3300046507 Bacteria 3353
253 Ga0495608_0001140 3300046511 Bacteria 18806
254 Ga0495608_0033249 3300046511 Bacteria 3487
255 Ga0495608_0323841 3300046511 Bacteria 952
256 Ga0495610_0051872 3300046512 Bacteria 1994
257 Ga0495610_0124472 3300046512 Bacteria 1126
258 Ga0495618_0005128 3300046514 Bacteria 8001
259 Ga0495618_0050719 3300046514 Bacteria 2622
260 Ga0495618_0887637 3300046514 Bacteria 515
261 Ga0495620_0001008 3300046515 Bacteria 17392
262 Ga0495628_0003233 3300046516 Bacteria 14600
263 Ga0495628_0070380 3300046516 Bacteria 2727
264 Ga0495628_0892974 3300046516 Bacteria 617
265 Ga0495630_0022863 3300046517 Bacteria 4617
266 Ga0495630_0029995 3300046517 Bacteria 4044
267 Ga0495631_0105117 3300046518 Bacteria 1215
268 Ga0495637_0179010 3300046520 Bacteria 787
269 Ga0495643_0001130 3300046522 Bacteria 26294
270 Ga0495643_0352503 3300046522 Bacteria 659
271 Ga0495648_0014740 3300046524 Bacteria 5701
272 Ga0495642_0048705 3300046528 Bacteria 1739
273 Ga0495652_0002465 3300046529 Bacteria 19022
274 Ga0495652_0074303 3300046529 Bacteria 2827
275 Ga0495652_0556734 3300046529 Bacteria 788
276 Ga0495665_0049294 3300046531 Bacteria 2233
277 Ga0495640_0028968 3300046533 Bacteria 3981
278 Ga0495640_0292117 3300046533 Bacteria 1013
279 Ga0495587_0000981 3300046536 Bacteria 18711
280 Ga0495587_0025456 3300046536 Bacteria 3615
281 Ga0495587_0225129 3300046536 Bacteria 1057
282 Ga0495597_0147136 3300046542 Bacteria 968
283 Ga0495597_0363707 3300046542 Bacteria 554
284 Ga0495645_0010516 3300046543 Bacteria 6489
285 Ga0495645_0019617 3300046543 Bacteria 4869
286 Ga0495645_0353315 3300046543 Bacteria 946
287 Ga0495622_0064113 3300046557 Bacteria 1699
288 Ga0495667_0000915 3300046559 Bacteria 19070
289 Ga0495667_0001895 3300046559 Bacteria 13881
290 Ga0495667_0057395 3300046559 Bacteria 2558
291 Ga0495667_0367225 3300046559 Bacteria 908
292 Ga0495667_0702903 3300046559 Bacteria 626
293 Ga0495668_0007675 3300046616 Bacteria 6864
294 Ga0495634_0016744 3300046642 Bacteria 5237
295 Ga0495634_0053461 3300046642 Bacteria 2705
296 Ga0495634_0126862 3300046642 Bacteria 1630
297 Ga0495611_0089562 3300046648 Bacteria 1421
298 Ga0495625_0178194 3300046660 Bacteria 1415
299 Ga0495635_0000385 3300046663 Bacteria 28002
300 Ga0495635_0069180 3300046663 Bacteria 2420
301 Ga0495635_0687092 3300046663 Bacteria 664
302 Ga0495588_0002502 3300046674 Bacteria 7873
303 Ga0495657_0001708 3300046675 Bacteria 18828
304 Ga0495657_0011996 3300046675 Bacteria 6452
305 Ga0495657_0023866 3300046675 Bacteria 4365
306 Ga0495657_0036635 3300046675 Bacteria 3389
307 Ga0495599_0000707 3300046678 Bacteria 18834
308 Ga0495599_0229585 3300046678 Bacteria 1133
309 Ga0495623_0003451 3300046679 Bacteria 10457
310 Ga0495646_0011532 3300046680 Bacteria 5612
311 Ga0495646_0333138 3300046680 Bacteria 797
312 Ga0495647_0218941 3300046681 Bacteria 840
313 Ga0495658_0071439 3300046683 Bacteria 2016
314 Ga0495613_0015869 3300046689 Bacteria 5608
315 Ga0495613_0039656 3300046689 Bacteria 3491
316 Ga0495613_0094016 3300046689 Bacteria 2169
317 Ga0495613_0122509 3300046689 Bacteria 1866
318 Ga0495624_0006724 3300046690 Bacteria 8123
319 Ga0495624_0010943 3300046690 Bacteria 6253
320 Ga0495624_0103677 3300046690 Bacteria 1750
321 Ga0495671_0217206 3300046692 Bacteria 926
322 Ga0495589_0081935 3300046794 Bacteria 1569
323 Ga0495600_0001389 3300046809 Bacteria 13373
324 Ga0495660_0026177 3300046810 Bacteria 3308
325 Ga0495581_0004991 3300047315 Bacteria 7683
326 Ga0495581_0016827 3300047315 Bacteria 4251
327 Ga0495581_0032693 3300047315 Bacteria 3012
328 Ga0495604_0001527 3300047317 Bacteria 19055
329 Ga0495604_0037379 3300047317 Bacteria 3825
330 Ga0495636_0047261 3300047318 Bacteria 1797
331 Ga0495636_0066568 3300047318 Bacteria 1532
332 Ga0495674_0000484 3300047319 Bacteria 36214
333 Ga0495674_0281080 3300047319 Bacteria 1363
334 Ga0495674_0481465 3300047319 Bacteria 994
335 Ga0495676_0002287 3300047321 Bacteria 17000
336 Ga0495676_0029978 3300047321 Bacteria 4624
337 Ga0495676_0057492 3300047321 Bacteria 3067
338 Ga0495676_0381540 3300047321 Bacteria 937
339 Ga0495676_0402240 3300047321 Bacteria 908
340 Ga0495680_0002494 3300047322 Bacteria 18812
341 Ga0495680_0034778 3300047322 Bacteria 4065
342 Ga0495680_0294130 3300047322 Bacteria 1141
343 Ga0495683_0133071 3300047323 Bacteria 1171
344 Ga0495687_007645 3300047443 Bacteria 6327
345 Ga0495687_075773 3300047443 Bacteria 1333
346 Ga0495675_0128435 3300047444 Bacteria 1576
347 Ga0495677_0064886 3300047445 Bacteria 1357
348 Ga0495685_023199 3300047447 Bacteria 2135
349 Ga0495685_124230 3300047447 Bacteria 846
350 Ga0495681_0127659 3300047470 Bacteria 1085
351 Ga0495684_0032244 3300047471 Bacteria 4021
352 Ga0495684_0170083 3300047471 Bacteria 1621
353 Ga0495686_0192718 3300047472 Bacteria 1174
354 Ga0495593_0006956 3300047673 Bacteria 6628
355 Ga0495593_0007625 3300047673 Bacteria 6319
356 Ga0495593_0141319 3300047673 Bacteria 1219
357 Ga0495593_0264471 3300047673 Bacteria 861
358 Ga0495602_0002471 3300048088 Bacteria 18834
359 Ga0495614_0026873 3300048089 Bacteria 2481
360 Ga0495614_0037908 3300048089 Bacteria 2069
361 Ga0495614_0068194 3300048089 Bacteria 1531
362 Ga0495614_0110569 3300048089 Bacteria 1206
363 Ga0496101_0215123 3300048904 Bacteria 1490
364 Ga0496102_0052488 3300048905 Bacteria 3715
365 Ga0496103_0253570 3300048906 Bacteria 1132
366 Ga0496104_0001455 3300048907 Bacteria 20467
367 Ga0496104_1477344 3300048907 Bacteria 583
368 Ga0496105_0004751 3300048908 Bacteria 10252
369 Ga0496108_0010587 3300048911 Bacteria 7485
370 Ga0496109_0470258 3300048912 Bacteria 1187
371 Ga0496110_0076896 3300048913 Bacteria 2968
372 Ga0496110_0719970 3300048913 Bacteria 900
373 Ga0496111_0005468 3300048914 Bacteria 8145
374 Ga0496112_0804756 3300048915 Bacteria 864
375 Ga0496113_0004823 3300048916 Bacteria 8341
376 Ga0496113_0726992 3300048916 Bacteria 791
377 Ga0496126_0379595 3300048929 Bacteria 1151
378 Ga0501047_0017463 3300049581 Bacteria 6873
379 Ga0501047_0182719 3300049581 Bacteria 1963
380 Ga0501070_0152315 3300049586 Bacteria 1908
381 Ga0501217_118068 3300049661 Bacteria 768
382 nmdc:mga05p37_668109_c1 3300050507 Bacteria 1160
383 nmdc:mga05p37_72343_c1 3300050507 Bacteria 4242
384 Ga0495601_0032836 3300053077 Bacteria 3232
385 Ga0495601_0264327 3300053077 Bacteria 1123
386 Ga0495612_0001879 3300053078 Bacteria 8638
387 Ga0495612_0292942 3300053078 Bacteria 729
388 Ga0495595_0000359 3300053084 Bacteria 17316
389 Ga0495595_0001955 3300053084 Bacteria 8005
390 Ga0495619_0031078 3300053085 Bacteria 3458
391 Ga0495619_0306489 3300053085 Bacteria 1100
392 Ga0500644_0007019 3300053088 Bacteria 2916
393 Ga0500651_0112633 3300053093 Bacteria 1659
394 Ga0500641_0111540 3300053096 Bacteria 1177
395 Ga0500569_044176 3300053109 Bacteria 1318
396 Ga0500652_179419 3300053131 Bacteria 868
397 Ga0500633_0166569 3300053160 Bacteria 827
398 Ga0466962_0117063 3300061719 Bacteria 1284
399 2616702582 2616644814 Bacteria 11555299
400 2644439085 2643221678 Bacteria 9540101
401 2676484289 2675903059 Bacteria 8644972
402 2812358254 2811994879 Bacteria 9313447
403 2946067593 2946064051 Bacteria 8957905
404 2990062128 2990059506 Bacteria 9321252
405 8056055928 8056054917 Bacteria 5736694
406 Ga0307409_100282202
407 JGI25406J46586_10004839
408 JGI25407J50210_10016716
409 Ga0070658_10007596
410 Ga0070683_100029464
411 Ga0070683_100112511
412 Ga0070683_101184525
413 Ga0070683_101484005
414 Ga0070690_101082248
415 Ga0070682_100001730
416 Ga0070660_100047824
417 Ga0070687_100112971
418 Ga0070668_100140444
419 Ga0070659_100062353
420 Ga0070667_100842704
421 Ga0070709_10099482
422 Ga0070709_10230933
423 Ga0070709_10484035
424 Ga0070709_10930848
425 Ga0070714_100004064
426 Ga0070714_101065640
427 Ga0070713_100024057
428 Ga0070713_100402352
429 Ga0070713_100727323
430 Ga0070713_101290374
431 Ga0070710_10000411
432 Ga0070711_100002526
433 Ga0070711_100041427
434 Ga0070708_100286476
435 Ga0070681_10207269
436 Ga0070681_11147496
437 Ga0070685_10049542
438 Ga0070706_100005237
439 Ga0070706_100036424
440 Ga0070707_100036986
441 Ga0070707_101049643
442 Ga0070698_100033798
443 Ga0070698_100038756
444 Ga0070698_100049834
445 Ga0070698_100073087
446 Ga0070698_100553860
447 Ga0070679_100897579
448 Ga0070684_100002397
449 Ga0070686_100636032
450 Ga0070695_100238276
451 Ga0070693_100126622
452 Ga0070665_100152662
453 Ga0070665_100909463
454 Ga0068855_100385510
455 Ga0070664_100194434
456 Ga0068857_100071400
457 Ga0068854_100502501
458 Ga0068856_100092347
459 Ga0070702_100375354
460 Ga0068852_100039060
461 Ga0068864_100039132
462 Ga0068866_10026506
463 Ga0068860_100040754
464 Ga0081538_10000966
465 Ga0081538_10001877
466 Ga0081538_10012770
467 Ga0081538_10014818
468 Ga0081538_10042698
469 Ga0081539_10000214
470 Ga0070717_10129219
471 Ga0070717_10402781
472 Ga0070717_10604845
473 Ga0075365_10050618
474 Ga0075364_10173519
475 Ga0070715_10012305
476 Ga0070716_100000316
477 Ga0070716_100026047
478 Ga0070712_100001872
479 Ga0070712_100111928
480 Ga0070712_100922190
481 Ga0097621_100064104
482 Ga0097621_100535448
483 Ga0075428_100053619
484 Ga0068865_100059999
485 Ga0075435_101100681
486 Ga0105245_10002375
487 Ga0114129_10107240
488 Ga0105243_11452599
489 Ga0105238_10479797
490 Ga0105249_10155470
491 Ga0099796_10032338
492 Ga0105239_10005659
493 Ga0105246_10003076
494 Ga0157370_10559296
495 Ga0157369_10108448
496 Ga0157374_10293770
497 Ga0157374_10496625
498 Ga0163162_10030514
499 Ga0163162_10761246
500 Ga0157372_10052520
501 Ga0157375_10015955
502 Ga0163163_10055611
503 Ga0163163_10492133
504 Ga0163163_10906340
505 Ga0157377_10102961
506 Ga0157379_10014219
507 Ga0157379_10310904
508 Ga0157379_10883875
509 Ga0157376_10209503
510 Ga0206354_11237526
511 Ga0206353_11142057
512 Ga0224712_10029280
513 Ga0207692_10000708
514 Ga0207692_10070034
515 Ga0207642_10644263
516 Ga0207688_10035554
517 Ga0207647_10059245
518 Ga0207685_10026951
519 Ga0207699_10000918
520 Ga0207699_10055407
521 Ga0207699_10292246
522 Ga0207699_10792180
523 Ga0207705_10126070
524 Ga0207684_10061538
525 Ga0207684_10231750
526 Ga0207684_10492831
527 Ga0207693_10013291
528 Ga0207693_10330365
529 Ga0207663_10021902
530 Ga0207662_10413948
531 Ga0207657_10025134
532 Ga0207652_10419119
533 Ga0207646_10077729
534 Ga0207646_10132848
535 Ga0207687_10013902
536 Ga0207700_10000662
537 Ga0207700_10241653
538 Ga0207700_10263887
539 Ga0207664_10001227
540 Ga0207664_10058540
541 Ga0207664_10095500
542 Ga0207664_10238660
543 Ga0207644_11288053
544 Ga0207690_10118019
545 Ga0207704_10031481
546 Ga0207665_10000242
547 Ga0207665_10004673
548 Ga0207661_10057805
549 Ga0207661_10176340
550 Ga0207667_10356435
551 Ga0207640_10979254
552 Ga0207658_10618650
553 Ga0207702_10321199
554 Ga0207676_10065898
555 Ga0207674_10017070
556 Ga0207698_10314109
557 Ga0268266_10194982
558 Ga0268266_11400245
559 Ga0268264_10045783
560 Ga0307515_10019119
561 Ga0307512_10002799
562 Ga0307512_10044067
563 Ga0316181_1106578
564 Ga0307513_10021598
565 Ga0307513_10608027
566 Ga0307508_10033376
567 Ga0307508_10176125
568 Ga0307516_10280343
569 Ga0307405_10191251
570 Ga0307413_10400535
571 Ga0307410_10058878
572 Ga0307407_10022545
573 Ga0307409_100636555
574 Ga0307409_100718230
575 Ga0307416_102387130
576 Ga0307411_10273826
577 Ga0307415_100267509
578 Ga0307507_10047237
579 Ga0373959_0153404
580 Ga0373934_0000464
581 Ga0373940_0373966
582 Ga0373944_0000494
583 Ga0373944_0028238
584 Ga0373923_0013041
585 Ga0373932_0312571
586 Ga0373936_0000113
587 Ga0373936_0017310
588 Ga0373945_0000159
589 Ga0373945_0340517
590 Ga0373953_0000990
591 Ga0373953_0023545
592 Ga0373954_0015751
593 Ga0373956_0000341
594 Ga0373956_0023373
595 Ga0373956_0288829
596 Ga0373957_0000371
597 Ga0373957_0053752
598 Ga0373943_0403956
599 Ga0373946_0003577
600 Ga0373946_0468788
601 Ga0373955_0000222
602 Ga0373955_0146347
603 Ga0373955_0285398
604 Ga0373924_0002069
605 Ga0373924_0035079
606 Ga0373924_0253525
607 Ga0373935_0021442
608 Ga0373935_0144256
609 Ga0373935_0737480
610 Ga0373927_0000672
611 Ga0373933_0000848
612 Ga0373933_0030974
613 Ga0373947_0000311
614 Ga0373947_0030320
615 Ga0373937_0001634
616 Ga0373937_0131379
617 Ga0373937_0451502
618 Ga0373937_0840471
619 Ga0373925_0016376
620 Ga0373925_0059371
621 Ga0373925_0122354
622 Ga0395898_0102067
623 Ga0395901_0173058
624 Ga0395901_1373007
625 Ga0450907_061603
626 Ga0466961_0222997
627 Ga0466957_0168630
628 Ga0451576_0396574
629 Ga0495617_066127
630 Ga0495592_0001091
631 Ga0495592_0273809
632 Ga0495603_0005637
633 Ga0495603_0219189
634 Ga0495629_0001029
635 Ga0495629_0004327
636 Ga0495629_0050027
637 Ga0495641_0019611
638 Ga0495641_0027928
639 Ga0495651_0001382
640 Ga0495651_0039388
641 Ga0495651_0210295
642 Ga0495653_0005648
643 Ga0495582_0031312
644 Ga0495582_0044261
645 Ga0495605_0099706
646 Ga0495639_0033060
647 Ga0495662_0010024
648 Ga0495662_0148095
649 Ga0495662_0401543
650 Ga0495662_0411106
651 Ga0495664_0003384
652 Ga0495664_0024744
653 Ga0495664_0375255
654 Ga0495585_0266705
655 Ga0495594_0004715
656 Ga0495583_0020410
657 Ga0495606_0036390
658 Ga0495608_0001140
659 Ga0495608_0033249
660 Ga0495608_0323841
661 Ga0495610_0051872
662 Ga0495610_0124472
663 Ga0495618_0005128
664 Ga0495618_0050719
665 Ga0495618_0887637
666 Ga0495620_0001008
667 Ga0495628_0003233
668 Ga0495628_0070380
669 Ga0495628_0892974
670 Ga0495630_0022863
671 Ga0495630_0029995
672 Ga0495631_0105117
673 Ga0495637_0179010
674 Ga0495643_0001130
675 Ga0495643_0352503
676 Ga0495648_0014740
677 Ga0495642_0048705
678 Ga0495652_0002465
679 Ga0495652_0074303
680 Ga0495652_0556734
681 Ga0495665_0049294
682 Ga0495640_0028968
683 Ga0495640_0292117
684 Ga0495587_0000981
685 Ga0495587_0025456
686 Ga0495587_0225129
687 Ga0495597_0147136
688 Ga0495597_0363707
689 Ga0495645_0010516
690 Ga0495645_0019617
691 Ga0495645_0353315
692 Ga0495622_0064113
693 Ga0495667_0000915
694 Ga0495667_0001895
695 Ga0495667_0057395
696 Ga0495667_0367225
697 Ga0495667_0702903
698 Ga0495668_0007675
699 Ga0495634_0016744
700 Ga0495634_0053461
701 Ga0495634_0126862
702 Ga0495611_0089562
703 Ga0495625_0178194
704 Ga0495635_0000385
705 Ga0495635_0069180
706 Ga0495635_0687092
707 Ga0495588_0002502
708 Ga0495657_0001708
709 Ga0495657_0011996
710 Ga0495657_0023866
711 Ga0495657_0036635
712 Ga0495599_0000707
713 Ga0495599_0229585
714 Ga0495623_0003451
715 Ga0495646_0011532
716 Ga0495646_0333138
717 Ga0495647_0218941
718 Ga0495658_0071439
719 Ga0495613_0015869
720 Ga0495613_0039656
721 Ga0495613_0094016
722 Ga0495613_0122509
723 Ga0495624_0006724
724 Ga0495624_0010943
725 Ga0495624_0103677
726 Ga0495671_0217206
727 Ga0495589_0081935
728 Ga0495600_0001389
729 Ga0495660_0026177
730 Ga0495581_0004991
731 Ga0495581_0016827
732 Ga0495581_0032693
733 Ga0495604_0001527
734 Ga0495604_0037379
735 Ga0495636_0047261
736 Ga0495636_0066568
737 Ga0495674_0000484
738 Ga0495674_0281080
739 Ga0495674_0481465
740 Ga0495676_0002287
741 Ga0495676_0029978
742 Ga0495676_0057492
743 Ga0495676_0381540
744 Ga0495676_0402240
745 Ga0495680_0002494
746 Ga0495680_0034778
747 Ga0495680_0294130
748 Ga0495683_0133071
749 Ga0495687_007645
750 Ga0495687_075773
751 Ga0495675_0128435
752 Ga0495677_0064886
753 Ga0495685_023199
754 Ga0495685_124230
755 Ga0495681_0127659
756 Ga0495684_0032244
757 Ga0495684_0170083
758 Ga0495686_0192718
759 Ga0495593_0006956
760 Ga0495593_0007625
761 Ga0495593_0141319
762 Ga0495593_0264471
763 Ga0495602_0002471
764 Ga0495614_0026873
765 Ga0495614_0037908
766 Ga0495614_0068194
767 Ga0495614_0110569
768 Ga0496101_0215123
769 Ga0496102_0052488
770 Ga0496103_0253570
771 Ga0496104_0001455
772 Ga0496104_1477344
773 Ga0496105_0004751
774 Ga0496108_0010587
775 Ga0496109_0470258
776 Ga0496110_0076896
777 Ga0496110_0719970
778 Ga0496111_0005468
779 Ga0496112_0804756
780 Ga0496113_0004823
781 Ga0496113_0726992
782 Ga0496126_0379595
783 Ga0501047_0017463
784 Ga0501047_0182719
785 Ga0501070_0152315
786 Ga0501217_118068
787 nmdc:mga05p37_668109_c1
788 nmdc:mga05p37_72343_c1
789 Ga0495601_0032836
790 Ga0495601_0264327
791 Ga0495612_0001879
792 Ga0495612_0292942
793 Ga0495595_0000359
794 Ga0495595_0001955
795 Ga0495619_0031078
796 Ga0495619_0306489
797 Ga0500644_0007019
798 Ga0500651_0112633
799 Ga0500641_0111540
800 Ga0500569_044176
801 Ga0500652_179419
802 Ga0500633_0166569
803 Ga0466962_0117063
804 2616702582
805 2644439085
806 2676484289
807 2812358254
808 2946067593
809 2990062128
810 8056055928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

5

127

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b8l-assembly2.cif.gz_F crystal structure of a putative aromatic ring hydroxylase (saro_3538) from novosphingobium aromaticivorans dsm at 1.75 a resolution 0.9138 7 137
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.9112 2 135
4gb5-assembly1.cif.gz_A crystal structure of kfla4162 protein from kribbella flavida 0.9097 6 135
5ieo-assembly1.cif.gz_A structure of cdl2.3a, a computationally designed vitamin-d3 binder 0.8962 12 133
8abv-assembly1.cif.gz_A crystal structure of spldpa in complex with erythro-dgpd 0.8945 3 137
ID Description Score Start End Superfamily
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9246 1 136 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9124 6 135 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9124 8 141 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9052 4 135 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8995 1 136 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4R4U9C6-F1-model_v4 DUF4440 domain-containing protein 0.9898 1 144
AF-A0A2I0SN70-F1-model_v4 Nuclear transport factor 2 family protein 0.9866 1 144
AF-A0A160NT98-F1-model_v4 SnoaL-like domain-containing protein 0.9864 2 145
AF-A0A1T3NQM6-F1-model_v4 DUF4440 domain-containing protein 0.986 3 145
AF-A0A3N1SW30-F1-model_v4 Ketosteroid isomerase-like protein 0.9853 1 145 GO:0016853

Map