F435963

General Info

Members Datasets Scaffolds Average Seq Length
405 215 810 292

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10468865|Ga0207661_104688651
Length 331
Sequence LAKAASRNPIGIRNGSKVTNKETQKGRKGETVLSPVRRSADSPIHPLLIGAHMSIRGGASIAIERARSIGCTAMQVFVKNNMQWFARPLTREEIRAFLNHIQRGELLSAFGHANYLINLATTNPRFHANSIRALAEELVRADQLELPFLVMHPGAHLGAGEEAGLKKISDSIDEVFRKIPKVKTKIALEITAGQGSCIGHRFEHLAHIIASVREPERLRVCLDTAHLFAAGYEINSESGVRKTFREFDRIIGRDRLIAIHVNDSKTPRGSRVDRHEHIGKGRIGLEAFRFIMRSPRFRKIPKVLETPKGKDLAEDVVNLKTLQRLARGRQS

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
211 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.42
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10468865 3300025944 Bacteria 1148
2 JGI24737J22298_10013536 3300001990 Unclassified 2654
3 JGI24748J21848_1000002 3300002074 Bacteria 426946
4 JGI24035J26624_1001230 3300002126 Bacteria 2437
5 JGI24035J26624_1002461 3300002126 Bacteria 1733
6 JGI24034J26672_10000004 3300002239 Bacteria 426946
7 JGI24751J29686_10000059 3300002459 Bacteria 61971
8 JGI25406J46586_10015605 3300003203 Bacteria 3198
9 JGI25405J52794_10003551 3300003911 Bacteria 2743
10 Ga0065704_10005017 3300005289 Bacteria 3884
11 Ga0065704_10024393 3300005289 Bacteria 1638
12 Ga0065712_10009345 3300005290 Bacteria 2215
13 Ga0065712_10010060 3300005290 Bacteria 2296
14 Ga0065715_10150992 3300005293 Unclassified 1729
15 Ga0065707_10098902 3300005295 Bacteria 3047
16 Ga0065707_10134605 3300005295 Bacteria 1863
17 Ga0065707_10154755 3300005295 Unclassified 1620
18 Ga0070676_10001155 3300005328 Bacteria 13186
19 Ga0070683_100009534 3300005329 Bacteria 8311
20 Ga0070683_100061053 3300005329 Bacteria 3504
21 Ga0070690_100001912 3300005330 Bacteria 11054
22 Ga0070690_100114717 3300005330 Bacteria 1802
23 Ga0070680_100001278 3300005336 Bacteria 18191
24 Ga0068868_100024315 3300005338 Bacteria 4595
25 Ga0068868_100026314 3300005338 Bacteria 4432
26 Ga0068868_100409344 3300005338 Unclassified 1172
27 Ga0070660_100031134 3300005339 Bacteria 4004
28 Ga0070660_100034215 3300005339 Unclassified 3837
29 Ga0070689_100002926 3300005340 Bacteria 11222
30 Ga0070687_100000993 3300005343 Bacteria 9679
31 Ga0070687_100063013 3300005343 Unclassified 1965
32 Ga0070687_100102809 3300005343 Bacteria 1603
33 Ga0070661_100038296 3300005344 Bacteria 3490
34 Ga0070661_100110633 3300005344 Bacteria 2051
35 Ga0070668_100003008 3300005347 Bacteria 12461
36 Ga0070668_100063146 3300005347 Bacteria 2870
37 Ga0070668_100104730 3300005347 Bacteria 2246
38 Ga0070669_100004427 3300005353 Bacteria 10128
39 Ga0070669_100009968 3300005353 Bacteria 6757
40 Ga0070675_100002174 3300005354 Bacteria 14520
41 Ga0070675_100457914 3300005354 Bacteria 1145
42 Ga0070671_100015284 3300005355 Bacteria 6199
43 Ga0070671_100047400 3300005355 Bacteria 3574
44 Ga0070671_100063345 3300005355 Bacteria 3079
45 Ga0070674_100102061 3300005356 Bacteria 2092
46 Ga0070673_100042188 3300005364 Bacteria 3516
47 Ga0070673_100069395 3300005364 Unclassified 2824
48 Ga0070673_100360041 3300005364 Unclassified 1293
49 Ga0070673_100681302 3300005364 Bacteria 943
50 Ga0070688_100000773 3300005365 Bacteria 15832
51 Ga0070659_100001121 3300005366 Bacteria 19545
52 Ga0070659_100001243 3300005366 Bacteria 18491
53 Ga0070659_100429753 3300005366 Unclassified 1118
54 Ga0070667_100025741 3300005367 Bacteria 4893
55 Ga0070709_10004318 3300005434 Bacteria 7665
56 Ga0070714_100032045 3300005435 Bacteria 4388
57 Ga0070714_100270837 3300005435 Bacteria 1575
58 Ga0070714_100312923 3300005435 Bacteria 1466
59 Ga0070713_100109908 3300005436 Bacteria 2402
60 Ga0070710_10011738 3300005437 Bacteria 4335
61 Ga0070701_10019527 3300005438 Bacteria 3202
62 Ga0070711_100083691 3300005439 Bacteria 2280
63 Ga0070711_100092479 3300005439 Bacteria 2183
64 Ga0070711_100526143 3300005439 Bacteria 978
65 Ga0070694_100022628 3300005444 Bacteria 4030
66 Ga0070708_100014660 3300005445 Bacteria 6457
67 Ga0070708_100195727 3300005445 Bacteria 1891
68 Ga0070708_100310989 3300005445 Bacteria 1484
69 Ga0070708_100513240 3300005445 Bacteria 1130
70 Ga0070678_100037349 3300005456 Bacteria 3410
71 Ga0070662_100001218 3300005457 Bacteria 15802
72 Ga0070662_100030991 3300005457 Unclassified 3748
73 Ga0070662_100086399 3300005457 Unclassified 2346
74 Ga0070681_10001309 3300005458 Bacteria 21729
75 Ga0070681_10017692 3300005458 Bacteria 7124
76 Ga0070706_100006694 3300005467 Bacteria 10875
77 Ga0070706_100012488 3300005467 Bacteria 7868
78 Ga0070706_100053989 3300005467 Bacteria 3710
79 Ga0070706_100185122 3300005467 Bacteria 1946
80 Ga0070707_100000711 3300005468 Bacteria 33208
81 Ga0070707_100003846 3300005468 Bacteria 14148
82 Ga0070707_100005281 3300005468 Bacteria 12092
83 Ga0070707_100101673 3300005468 Bacteria 2785
84 Ga0070707_100546316 3300005468 Bacteria 1121
85 Ga0070698_100006581 3300005471 Bacteria 12600
86 Ga0070698_100641200 3300005471 Unclassified 1003
87 Ga0070699_100031848 3300005518 Unclassified 4554
88 Ga0070699_100038065 3300005518 Bacteria 4165
89 Ga0070699_100057249 3300005518 Unclassified 3376
90 Ga0070699_100112575 3300005518 Bacteria 2391
91 Ga0070699_100387363 3300005518 Bacteria 1263
92 Ga0070679_100013718 3300005530 Bacteria 7762
93 Ga0070679_100133419 3300005530 Bacteria 2464
94 Ga0070684_100000223 3300005535 Bacteria 39444
95 Ga0070684_100007630 3300005535 Bacteria 8435
96 Ga0070684_100041841 3300005535 Bacteria 3952
97 Ga0070697_100000229 3300005536 Bacteria 45809
98 Ga0070697_100010369 3300005536 Bacteria 7269
99 Ga0070697_100026167 3300005536 Bacteria 4657
100 Ga0070697_100060852 3300005536 Unclassified 3079
101 Ga0070697_100073896 3300005536 Unclassified 2800
102 Ga0070697_100075110 3300005536 Bacteria 2778
103 Ga0070697_100403410 3300005536 Bacteria 1186
104 Ga0068853_100104423 3300005539 Bacteria 2509
105 Ga0070672_100127388 3300005543 Bacteria 2089
106 Ga0070686_100071690 3300005544 Bacteria 2269
107 Ga0070686_100257827 3300005544 Bacteria 1277
108 Ga0070696_100157947 3300005546 Bacteria 1669
109 Ga0070665_100066006 3300005548 Bacteria 3630
110 Ga0070704_100038886 3300005549 Bacteria 3262
111 Ga0070704_100228040 3300005549 Bacteria 1518
112 Ga0070664_100001461 3300005564 Bacteria 18822
113 Ga0068857_100007545 3300005577 Bacteria 9362
114 Ga0070702_100037970 3300005615 Bacteria 2678
115 Ga0068859_100023425 3300005617 Bacteria 6196
116 Ga0068864_100024403 3300005618 Bacteria 5087
117 Ga0068864_100029429 3300005618 Bacteria 4652
118 Ga0068870_10103517 3300005840 Bacteria 1613
119 Ga0068863_100059304 3300005841 Bacteria 3621
120 Ga0068863_100096352 3300005841 Unclassified 2809
121 Ga0068858_100000067 3300005842 Bacteria 106455
122 Ga0068858_100008668 3300005842 Bacteria 9764
123 Ga0068858_100020231 3300005842 Bacteria 6224
124 Ga0068860_100004153 3300005843 Bacteria 14839
125 Ga0068860_100060014 3300005843 Bacteria 3615
126 Ga0068860_100156976 3300005843 Bacteria 2193
127 Ga0068862_100006211 3300005844 Bacteria 9951
128 Ga0068862_100032813 3300005844 Bacteria 4385
129 Ga0068862_100231902 3300005844 Bacteria 1675
130 Ga0081455_10003905 3300005937 Bacteria 16973
131 Ga0081455_10016047 3300005937 Bacteria 7246
132 Ga0081455_10027359 3300005937 Bacteria 5226
133 Ga0081455_10032157 3300005937 Bacteria 4732
134 Ga0081455_10078216 3300005937 Bacteria 2718
135 Ga0081540_1000031 3300005983 Bacteria 147094
136 Ga0081540_1046155 3300005983 Bacteria 2203
137 Ga0081539_10000502 3300005985 Bacteria 82098
138 Ga0081539_10000681 3300005985 Bacteria 68157
139 Ga0081539_10001382 3300005985 Bacteria 41998
140 Ga0081539_10030574 3300005985 Bacteria 3339
141 Ga0081539_10039213 3300005985 Bacteria 2799
142 Ga0081539_10046191 3300005985 Bacteria 2498
143 Ga0081539_10104874 3300005985 Bacteria 1434
144 Ga0070717_10010294 3300006028 Bacteria 7051
145 Ga0070717_10048103 3300006028 Bacteria 3497
146 Ga0070717_10049479 3300006028 Unclassified 3450
147 Ga0070715_10130680 3300006163 Bacteria 1208
148 Ga0070716_100097607 3300006173 Bacteria 1794
149 Ga0070716_100101535 3300006173 Bacteria 1764
150 Ga0070716_100150557 3300006173 Bacteria 1496
151 Ga0070712_100009510 3300006175 Bacteria 6128
152 Ga0070712_100076558 3300006175 Unclassified 2409
153 Ga0070712_100086124 3300006175 Bacteria 2289
154 Ga0070712_100182500 3300006175 Bacteria 1636
155 Ga0070712_100280275 3300006175 Unclassified 1342
156 Ga0070712_100489087 3300006175 Bacteria 1030
157 Ga0068871_100089680 3300006358 Bacteria 2560
158 Ga0075433_10005128 3300006852 Bacteria 10278
159 Ga0075434_100358285 3300006871 Unclassified 1480
160 Ga0075434_100433188 3300006871 Unclassified 1336
161 Ga0068865_100178018 3300006881 Unclassified 1636
162 Ga0075436_100367228 3300006914 Bacteria 1039
163 Ga0097620_100023424 3300006931 Bacteria 6196
164 Ga0105245_10150501 3300009098 Bacteria 2200
165 Ga0105247_10000005 3300009101 Bacteria 426989
166 Ga0105247_10038189 3300009101 Bacteria 2930
167 Ga0105247_10277376 3300009101 Unclassified 1155
168 Ga0114129_10048661 3300009147 Bacteria 5957
169 Ga0105243_10076699 3300009148 Unclassified 2717
170 Ga0105241_10382940 3300009174 Bacteria 1229
171 Ga0105242_10133198 3300009176 Unclassified 2148
172 Ga0105242_10282726 3300009176 Bacteria 1508
173 Ga0105248_10173048 3300009177 Unclassified 2434
174 Ga0105237_10116392 3300009545 Bacteria 2666
175 Ga0105249_10002442 3300009553 Bacteria 16138
176 Ga0105249_10004441 3300009553 Bacteria 12141
177 Ga0105249_10338514 3300009553 Archaea 1520
178 Ga0105239_10005974 3300010375 Bacteria 14168
179 Ga0157373_10141327 3300013100 Bacteria 1693
180 Ga0157374_10072474 3300013296 Bacteria 3250
181 Ga0157374_10075277 3300013296 Unclassified 3190
182 Ga0157374_10096830 3300013296 Unclassified 2822
183 Ga0157374_10104381 3300013296 Bacteria 2721
184 Ga0157374_10289546 3300013296 Bacteria 1618
185 Ga0157374_10414620 3300013296 Bacteria 1345
186 Ga0157378_10002650 3300013297 Bacteria 15941
187 Ga0157378_10036802 3300013297 Bacteria 4331
188 Ga0157378_10149831 3300013297 Unclassified 2173
189 Ga0163162_10004921 3300013306 Bacteria 12879
190 Ga0163162_10020120 3300013306 Bacteria 6553
191 Ga0163162_10223928 3300013306 Unclassified 2010
192 Ga0163162_10231581 3300013306 Bacteria 1978
193 Ga0157372_10013192 3300013307 Bacteria 8817
194 Ga0157372_10066786 3300013307 Bacteria 4041
195 Ga0157375_10003948 3300013308 Bacteria 12859
196 Ga0157375_10315999 3300013308 Bacteria 1726
197 Ga0163163_10007737 3300014325 Bacteria 9496
198 Ga0163163_10031898 3300014325 Bacteria 5088
199 Ga0163163_10049383 3300014325 Bacteria 4141
200 Ga0163163_10372572 3300014325 Unclassified 1485
201 Ga0157380_10008210 3300014326 Bacteria 7440
202 Ga0157377_10347889 3300014745 Bacteria 994
203 Ga0157379_10053558 3300014968 Unclassified 3604
204 Ga0157376_10169426 3300014969 Bacteria 1987
205 Ga0207672_1000026 3300025223 Bacteria 18650
206 Ga0207666_1000285 3300025271 Bacteria 7206
207 Ga0207673_1000469 3300025290 Bacteria 4193
208 Ga0207673_1000639 3300025290 Bacteria 3736
209 Ga0207697_10000692 3300025315 Bacteria 19173
210 Ga0207697_10000728 3300025315 Bacteria 18701
211 Ga0207697_10000818 3300025315 Bacteria 17610
212 Ga0207697_10001291 3300025315 Bacteria 13748
213 Ga0207697_10006408 3300025315 Bacteria 5329
214 Ga0207697_10021413 3300025315 Unclassified 2646
215 Ga0207697_10022752 3300025315 Bacteria 2567
216 Ga0207697_10036252 3300025315 Unclassified 2019
217 Ga0207697_10103383 3300025315 Bacteria 1216
218 Ga0207692_10034114 3300025898 Bacteria 2462
219 Ga0207710_10000004 3300025900 Bacteria 846540
220 Ga0207688_10016562 3300025901 Bacteria 3999
221 Ga0207680_10087347 3300025903 Bacteria 1974
222 Ga0207647_10017779 3300025904 Bacteria 4825
223 Ga0207685_10108392 3300025905 Unclassified 1200
224 Ga0207699_10013801 3300025906 Bacteria 4146
225 Ga0207645_10001255 3300025907 Bacteria 20871
226 Ga0207645_10007062 3300025907 Bacteria 7991
227 Ga0207684_10006654 3300025910 Bacteria 10504
228 Ga0207684_10068447 3300025910 Bacteria 3017
229 Ga0207684_10151934 3300025910 Unclassified 1992
230 Ga0207684_10204997 3300025910 Bacteria 1701
231 Ga0207684_10317211 3300025910 Bacteria 1343
232 Ga0207654_10184800 3300025911 Bacteria 1362
233 Ga0207707_10015193 3300025912 Bacteria 6704
234 Ga0207693_10007807 3300025915 Bacteria 8783
235 Ga0207693_10009130 3300025915 Bacteria 8095
236 Ga0207693_10019668 3300025915 Bacteria 5370
237 Ga0207693_10052818 3300025915 Bacteria 3187
238 Ga0207693_10057604 3300025915 Bacteria 3045
239 Ga0207693_10237843 3300025915 Bacteria 1430
240 Ga0207693_10350503 3300025915 Bacteria 1155
241 Ga0207663_10071709 3300025916 Bacteria 2236
242 Ga0207663_10094112 3300025916 Bacteria 1996
243 Ga0207663_10150306 3300025916 Unclassified 1633
244 Ga0207663_10181068 3300025916 Unclassified 1505
245 Ga0207663_10240570 3300025916 Unclassified 1327
246 Ga0207662_10000808 3300025918 Bacteria 14411
247 Ga0207657_10070801 3300025919 Bacteria 2954
248 Ga0207657_10071764 3300025919 Bacteria 2931
249 Ga0207649_10144005 3300025920 Bacteria 1634
250 Ga0207646_10000413 3300025922 Bacteria 57255
251 Ga0207646_10020892 3300025922 Bacteria 6058
252 Ga0207646_10135900 3300025922 Bacteria 2214
253 Ga0207646_10540713 3300025922 Bacteria 1048
254 Ga0207681_10005833 3300025923 Bacteria 7552
255 Ga0207659_10006022 3300025926 Bacteria 7398
256 Ga0207659_10227907 3300025926 Unclassified 1501
257 Ga0207659_10349240 3300025926 Bacteria 1227
258 Ga0207659_10506628 3300025926 Unclassified 1022
259 Ga0207700_10010107 3300025928 Bacteria 5933
260 Ga0207664_10026288 3300025929 Bacteria 4398
261 Ga0207664_10091933 3300025929 Bacteria 2489
262 Ga0207664_10314040 3300025929 Unclassified 1381
263 Ga0207644_10011795 3300025931 Bacteria 5787
264 Ga0207644_10027029 3300025931 Bacteria 3962
265 Ga0207644_10048385 3300025931 Bacteria 3040
266 Ga0207644_10520930 3300025931 Bacteria 982
267 Ga0207690_10033217 3300025932 Bacteria 3316
268 Ga0207690_10208806 3300025932 Bacteria 1487
269 Ga0207690_10320888 3300025932 Unclassified 1218
270 Ga0207690_10400492 3300025932 Unclassified 1094
271 Ga0207706_10002955 3300025933 Bacteria 16413
272 Ga0207706_10031926 3300025933 Bacteria 4692
273 Ga0207706_10111932 3300025933 Unclassified 2402
274 Ga0207706_10142695 3300025933 Bacteria 2107
275 Ga0207709_10087054 3300025935 Unclassified 2030
276 Ga0207670_10077625 3300025936 Bacteria 2314
277 Ga0207670_10091542 3300025936 Unclassified 2151
278 Ga0207704_10099787 3300025938 Bacteria 1932
279 Ga0207665_10024818 3300025939 Bacteria 3955
280 Ga0207665_10055973 3300025939 Bacteria 2662
281 Ga0207691_10000134 3300025940 Bacteria 67672
282 Ga0207691_10028600 3300025940 Bacteria 5218
283 Ga0207711_10123701 3300025941 Unclassified 2312
284 Ga0207661_10112694 3300025944 Unclassified 2303
285 Ga0207679_10131502 3300025945 Bacteria 2008
286 Ga0207679_10143469 3300025945 Bacteria 1933
287 Ga0207651_10136149 3300025960 Unclassified 1889
288 Ga0207712_10005817 3300025961 Bacteria 7773
289 Ga0207712_10028581 3300025961 Unclassified 3731
290 Ga0207668_10002747 3300025972 Bacteria 10283
291 Ga0207668_10008785 3300025972 Bacteria 6036
292 Ga0207668_10045006 3300025972 Bacteria 3007
293 Ga0207668_10343477 3300025972 Unclassified 1246
294 Ga0207640_10271259 3300025981 Bacteria 1327
295 Ga0207658_10017615 3300025986 Bacteria 4925
296 Ga0207677_10078358 3300026023 Bacteria 2359
297 Ga0207677_10192392 3300026023 Unclassified 1615
298 Ga0207703_10000360 3300026035 Bacteria 48744
299 Ga0207703_10042264 3300026035 Bacteria 3656
300 Ga0207639_10004529 3300026041 Bacteria 9365
301 Ga0207641_10045626 3300026088 Bacteria 3691
302 Ga0207676_10009784 3300026095 Bacteria 6817
303 Ga0207676_10023499 3300026095 Bacteria 4549
304 Ga0207674_10000169 3300026116 Bacteria 78781
305 Ga0207683_10004148 3300026121 Bacteria 12541
306 Ga0207683_10015254 3300026121 Bacteria 6539
307 Ga0207683_10084645 3300026121 Bacteria 2819
308 Ga0209974_10014698 3300027876 Bacteria 2602
309 Ga0268265_10007091 3300028380 Bacteria 7574
310 Ga0268265_10048402 3300028380 Bacteria 3191
311 Ga0268264_10050590 3300028381 Bacteria 3461
312 Ga0268264_10066400 3300028381 Bacteria 3042
313 Ga0307513_10001605 3300031456 Bacteria 32470
314 Ga0373926_0020322 3300035083 Bacteria 2294
315 Ga0373926_0050957 3300035083 Bacteria 1493
316 Ga0373936_0082631 3300035113 Bacteria 1339
317 Ga0373945_0095345 3300035116 Bacteria 1158
318 Ga0373943_0020103 3300035170 Bacteria 3076
319 Ga0373946_0214172 3300035171 Bacteria 928
320 Ga0373924_0150309 3300035410 Unclassified 1019
321 Ga0373931_0271098 3300035691 Bacteria 1039
322 Ga0373935_0078788 3300035692 Bacteria 2138
323 Ga0373927_0029151 3300035695 Bacteria 3597
324 Ga0373927_0194944 3300035695 Bacteria 1329
325 Ga0373947_0063067 3300035725 Bacteria 2257
326 Ga0373937_0159827 3300036401 Bacteria 2112
327 Ga0373937_0491441 3300036401 Bacteria 1166
328 Ga0373925_0130861 3300037068 Unclassified 1956
329 Ga0373925_0209464 3300037068 Bacteria 1553
330 Ga0373925_0242660 3300037068 Bacteria 1443
331 Ga0373925_0630100 3300037068 Unclassified 883
332 Ga0395899_0118018 3300037312 Bacteria 1903
333 Ga0395900_0058254 3300037418 Bacteria 3977
334 Ga0395900_0106083 3300037418 Bacteria 2886
335 Ga0395900_0321089 3300037418 Bacteria 1529
336 Ga0395905_0175567 3300037471 Bacteria 2012
337 Ga0436364_0882654 3300037853 Unclassified 1943
338 Ga0451853_2469434 3300041512 Bacteria 1533
339 Ga0439450_052851 3300042008 Unclassified 969
340 Ga0439458_0008959 3300042157 Bacteria 2234
341 Ga0451577_0095769 3300042876 Bacteria 2650
342 Ga0453683_0013185 3300044673 Bacteria 5402
343 Ga0451576_0074438 3300045051 Bacteria 3534
344 Ga0495629_0244949 3300046459 Unclassified 1234
345 Ga0495641_0192284 3300046461 Bacteria 915
346 Ga0495580_0054750 3300046472 Bacteria 2813
347 Ga0495580_0270377 3300046472 Bacteria 1161
348 Ga0495582_0133986 3300046473 Bacteria 1401
349 Ga0495585_0131179 3300046492 Bacteria 1319
350 Ga0495628_0014712 3300046516 Bacteria 6551
351 Ga0495630_0018486 3300046517 Bacteria 5120
352 Ga0495630_0347169 3300046517 Unclassified 1136
353 Ga0495643_0148617 3300046522 Unclassified 1162
354 Ga0495666_0108244 3300046526 Bacteria 1307
355 Ga0495652_0021792 3300046529 Bacteria 5696
356 Ga0495652_0252767 3300046529 Bacteria 1305
357 Ga0495587_0022241 3300046536 Unclassified 3905
358 Ga0495598_0120950 3300046537 Unclassified 887
359 Ga0495645_0013403 3300046543 Bacteria 5794
360 Ga0495667_0162968 3300046559 Bacteria 1434
361 Ga0495667_0223897 3300046559 Bacteria 1200
362 Ga0495667_0238456 3300046559 Unclassified 1159
363 Ga0495635_0396734 3300046663 Unclassified 917
364 Ga0495657_0096331 3300046675 Bacteria 1891
365 Ga0495657_0232160 3300046675 Bacteria 1116
366 Ga0495623_0021804 3300046679 Bacteria 4137
367 Ga0495646_0012149 3300046680 Bacteria 5475
368 Ga0495624_0032674 3300046690 Bacteria 3373
369 Ga0495581_0122102 3300047315 Unclassified 1516
370 Ga0495674_0018121 3300047319 Bacteria 6553
371 Ga0495676_0156427 3300047321 Bacteria 1617
372 Ga0495675_0219136 3300047444 Bacteria 1152
373 Ga0496101_0324395 3300048904 Bacteria 1208
374 Ga0496101_0406817 3300048904 Bacteria 1072
375 Ga0496102_0594822 3300048905 Bacteria 1029
376 Ga0496103_0150321 3300048906 Unclassified 1492
377 Ga0496103_0204758 3300048906 Unclassified 1269
378 Ga0496104_0196317 3300048907 Bacteria 1930
379 Ga0496104_0373090 3300048907 Unclassified 1339
380 Ga0496106_0008862 3300048909 Bacteria 7438
381 Ga0496106_0011271 3300048909 Bacteria 6617
382 Ga0496107_0208519 3300048910 Bacteria 1453
383 Ga0496108_0019361 3300048911 Bacteria 5589
384 Ga0496108_0141380 3300048911 Bacteria 2074
385 Ga0496108_0375820 3300048911 Unclassified 1241
386 Ga0496109_0021148 3300048912 Bacteria 5752
387 Ga0496110_0056243 3300048913 Bacteria 3462
388 Ga0496110_0074818 3300048913 Bacteria 3009
389 Ga0496110_0418473 3300048913 Unclassified 1222
390 Ga0496111_0093538 3300048914 Unclassified 2204
391 Ga0496112_0027261 3300048915 Bacteria 5508
392 Ga0496112_0208614 3300048915 Bacteria 1911
393 Ga0496112_0268910 3300048915 Unclassified 1653
394 Ga0496112_0455513 3300048915 Bacteria 1217
395 Ga0496112_0577065 3300048915 Unclassified 1057
396 Ga0496113_0000857 3300048916 Bacteria 15922
397 Ga0496114_0204578 3300048917 Bacteria 1730
398 Ga0496115_0304214 3300048918 Bacteria 1306
399 Ga0501299_011882 3300049522 Bacteria 1477
400 Ga0501242_018081 3300049674 Unclassified 894
401 Ga0501261_007564 3300049690 Bacteria 1396
402 nmdc:mga05p37_12913_c1 3300050507 Bacteria 9989
403 nmdc:mga0a205_25664_c1 3300050515 Bacteria 5616
404 Ga0495655_0001907 3300053083 Unclassified 3253
405 Ga0495619_0222568 3300053085 Bacteria 1307
406 Ga0207661_10468865
407 JGI24737J22298_10013536
408 JGI24748J21848_1000002
409 JGI24035J26624_1001230
410 JGI24035J26624_1002461
411 JGI24034J26672_10000004
412 JGI24751J29686_10000059
413 JGI25406J46586_10015605
414 JGI25405J52794_10003551
415 Ga0065704_10005017
416 Ga0065704_10024393
417 Ga0065712_10009345
418 Ga0065712_10010060
419 Ga0065715_10150992
420 Ga0065707_10098902
421 Ga0065707_10134605
422 Ga0065707_10154755
423 Ga0070676_10001155
424 Ga0070683_100009534
425 Ga0070683_100061053
426 Ga0070690_100001912
427 Ga0070690_100114717
428 Ga0070680_100001278
429 Ga0068868_100024315
430 Ga0068868_100026314
431 Ga0068868_100409344
432 Ga0070660_100031134
433 Ga0070660_100034215
434 Ga0070689_100002926
435 Ga0070687_100000993
436 Ga0070687_100063013
437 Ga0070687_100102809
438 Ga0070661_100038296
439 Ga0070661_100110633
440 Ga0070668_100003008
441 Ga0070668_100063146
442 Ga0070668_100104730
443 Ga0070669_100004427
444 Ga0070669_100009968
445 Ga0070675_100002174
446 Ga0070675_100457914
447 Ga0070671_100015284
448 Ga0070671_100047400
449 Ga0070671_100063345
450 Ga0070674_100102061
451 Ga0070673_100042188
452 Ga0070673_100069395
453 Ga0070673_100360041
454 Ga0070673_100681302
455 Ga0070688_100000773
456 Ga0070659_100001121
457 Ga0070659_100001243
458 Ga0070659_100429753
459 Ga0070667_100025741
460 Ga0070709_10004318
461 Ga0070714_100032045
462 Ga0070714_100270837
463 Ga0070714_100312923
464 Ga0070713_100109908
465 Ga0070710_10011738
466 Ga0070701_10019527
467 Ga0070711_100083691
468 Ga0070711_100092479
469 Ga0070711_100526143
470 Ga0070694_100022628
471 Ga0070708_100014660
472 Ga0070708_100195727
473 Ga0070708_100310989
474 Ga0070708_100513240
475 Ga0070678_100037349
476 Ga0070662_100001218
477 Ga0070662_100030991
478 Ga0070662_100086399
479 Ga0070681_10001309
480 Ga0070681_10017692
481 Ga0070706_100006694
482 Ga0070706_100012488
483 Ga0070706_100053989
484 Ga0070706_100185122
485 Ga0070707_100000711
486 Ga0070707_100003846
487 Ga0070707_100005281
488 Ga0070707_100101673
489 Ga0070707_100546316
490 Ga0070698_100006581
491 Ga0070698_100641200
492 Ga0070699_100031848
493 Ga0070699_100038065
494 Ga0070699_100057249
495 Ga0070699_100112575
496 Ga0070699_100387363
497 Ga0070679_100013718
498 Ga0070679_100133419
499 Ga0070684_100000223
500 Ga0070684_100007630
501 Ga0070684_100041841
502 Ga0070697_100000229
503 Ga0070697_100010369
504 Ga0070697_100026167
505 Ga0070697_100060852
506 Ga0070697_100073896
507 Ga0070697_100075110
508 Ga0070697_100403410
509 Ga0068853_100104423
510 Ga0070672_100127388
511 Ga0070686_100071690
512 Ga0070686_100257827
513 Ga0070696_100157947
514 Ga0070665_100066006
515 Ga0070704_100038886
516 Ga0070704_100228040
517 Ga0070664_100001461
518 Ga0068857_100007545
519 Ga0070702_100037970
520 Ga0068859_100023425
521 Ga0068864_100024403
522 Ga0068864_100029429
523 Ga0068870_10103517
524 Ga0068863_100059304
525 Ga0068863_100096352
526 Ga0068858_100000067
527 Ga0068858_100008668
528 Ga0068858_100020231
529 Ga0068860_100004153
530 Ga0068860_100060014
531 Ga0068860_100156976
532 Ga0068862_100006211
533 Ga0068862_100032813
534 Ga0068862_100231902
535 Ga0081455_10003905
536 Ga0081455_10016047
537 Ga0081455_10027359
538 Ga0081455_10032157
539 Ga0081455_10078216
540 Ga0081540_1000031
541 Ga0081540_1046155
542 Ga0081539_10000502
543 Ga0081539_10000681
544 Ga0081539_10001382
545 Ga0081539_10030574
546 Ga0081539_10039213
547 Ga0081539_10046191
548 Ga0081539_10104874
549 Ga0070717_10010294
550 Ga0070717_10048103
551 Ga0070717_10049479
552 Ga0070715_10130680
553 Ga0070716_100097607
554 Ga0070716_100101535
555 Ga0070716_100150557
556 Ga0070712_100009510
557 Ga0070712_100076558
558 Ga0070712_100086124
559 Ga0070712_100182500
560 Ga0070712_100280275
561 Ga0070712_100489087
562 Ga0068871_100089680
563 Ga0075433_10005128
564 Ga0075434_100358285
565 Ga0075434_100433188
566 Ga0068865_100178018
567 Ga0075436_100367228
568 Ga0097620_100023424
569 Ga0105245_10150501
570 Ga0105247_10000005
571 Ga0105247_10038189
572 Ga0105247_10277376
573 Ga0114129_10048661
574 Ga0105243_10076699
575 Ga0105241_10382940
576 Ga0105242_10133198
577 Ga0105242_10282726
578 Ga0105248_10173048
579 Ga0105237_10116392
580 Ga0105249_10002442
581 Ga0105249_10004441
582 Ga0105249_10338514
583 Ga0105239_10005974
584 Ga0157373_10141327
585 Ga0157374_10072474
586 Ga0157374_10075277
587 Ga0157374_10096830
588 Ga0157374_10104381
589 Ga0157374_10289546
590 Ga0157374_10414620
591 Ga0157378_10002650
592 Ga0157378_10036802
593 Ga0157378_10149831
594 Ga0163162_10004921
595 Ga0163162_10020120
596 Ga0163162_10223928
597 Ga0163162_10231581
598 Ga0157372_10013192
599 Ga0157372_10066786
600 Ga0157375_10003948
601 Ga0157375_10315999
602 Ga0163163_10007737
603 Ga0163163_10031898
604 Ga0163163_10049383
605 Ga0163163_10372572
606 Ga0157380_10008210
607 Ga0157377_10347889
608 Ga0157379_10053558
609 Ga0157376_10169426
610 Ga0207672_1000026
611 Ga0207666_1000285
612 Ga0207673_1000469
613 Ga0207673_1000639
614 Ga0207697_10000692
615 Ga0207697_10000728
616 Ga0207697_10000818
617 Ga0207697_10001291
618 Ga0207697_10006408
619 Ga0207697_10021413
620 Ga0207697_10022752
621 Ga0207697_10036252
622 Ga0207697_10103383
623 Ga0207692_10034114
624 Ga0207710_10000004
625 Ga0207688_10016562
626 Ga0207680_10087347
627 Ga0207647_10017779
628 Ga0207685_10108392
629 Ga0207699_10013801
630 Ga0207645_10001255
631 Ga0207645_10007062
632 Ga0207684_10006654
633 Ga0207684_10068447
634 Ga0207684_10151934
635 Ga0207684_10204997
636 Ga0207684_10317211
637 Ga0207654_10184800
638 Ga0207707_10015193
639 Ga0207693_10007807
640 Ga0207693_10009130
641 Ga0207693_10019668
642 Ga0207693_10052818
643 Ga0207693_10057604
644 Ga0207693_10237843
645 Ga0207693_10350503
646 Ga0207663_10071709
647 Ga0207663_10094112
648 Ga0207663_10150306
649 Ga0207663_10181068
650 Ga0207663_10240570
651 Ga0207662_10000808
652 Ga0207657_10070801
653 Ga0207657_10071764
654 Ga0207649_10144005
655 Ga0207646_10000413
656 Ga0207646_10020892
657 Ga0207646_10135900
658 Ga0207646_10540713
659 Ga0207681_10005833
660 Ga0207659_10006022
661 Ga0207659_10227907
662 Ga0207659_10349240
663 Ga0207659_10506628
664 Ga0207700_10010107
665 Ga0207664_10026288
666 Ga0207664_10091933
667 Ga0207664_10314040
668 Ga0207644_10011795
669 Ga0207644_10027029
670 Ga0207644_10048385
671 Ga0207644_10520930
672 Ga0207690_10033217
673 Ga0207690_10208806
674 Ga0207690_10320888
675 Ga0207690_10400492
676 Ga0207706_10002955
677 Ga0207706_10031926
678 Ga0207706_10111932
679 Ga0207706_10142695
680 Ga0207709_10087054
681 Ga0207670_10077625
682 Ga0207670_10091542
683 Ga0207704_10099787
684 Ga0207665_10024818
685 Ga0207665_10055973
686 Ga0207691_10000134
687 Ga0207691_10028600
688 Ga0207711_10123701
689 Ga0207661_10112694
690 Ga0207679_10131502
691 Ga0207679_10143469
692 Ga0207651_10136149
693 Ga0207712_10005817
694 Ga0207712_10028581
695 Ga0207668_10002747
696 Ga0207668_10008785
697 Ga0207668_10045006
698 Ga0207668_10343477
699 Ga0207640_10271259
700 Ga0207658_10017615
701 Ga0207677_10078358
702 Ga0207677_10192392
703 Ga0207703_10000360
704 Ga0207703_10042264
705 Ga0207639_10004529
706 Ga0207641_10045626
707 Ga0207676_10009784
708 Ga0207676_10023499
709 Ga0207674_10000169
710 Ga0207683_10004148
711 Ga0207683_10015254
712 Ga0207683_10084645
713 Ga0209974_10014698
714 Ga0268265_10007091
715 Ga0268265_10048402
716 Ga0268264_10050590
717 Ga0268264_10066400
718 Ga0307513_10001605
719 Ga0373926_0020322
720 Ga0373926_0050957
721 Ga0373936_0082631
722 Ga0373945_0095345
723 Ga0373943_0020103
724 Ga0373946_0214172
725 Ga0373924_0150309
726 Ga0373931_0271098
727 Ga0373935_0078788
728 Ga0373927_0029151
729 Ga0373927_0194944
730 Ga0373947_0063067
731 Ga0373937_0159827
732 Ga0373937_0491441
733 Ga0373925_0130861
734 Ga0373925_0209464
735 Ga0373925_0242660
736 Ga0373925_0630100
737 Ga0395899_0118018
738 Ga0395900_0058254
739 Ga0395900_0106083
740 Ga0395900_0321089
741 Ga0395905_0175567
742 Ga0436364_0882654
743 Ga0451853_2469434
744 Ga0439450_052851
745 Ga0439458_0008959
746 Ga0451577_0095769
747 Ga0453683_0013185
748 Ga0451576_0074438
749 Ga0495629_0244949
750 Ga0495641_0192284
751 Ga0495580_0054750
752 Ga0495580_0270377
753 Ga0495582_0133986
754 Ga0495585_0131179
755 Ga0495628_0014712
756 Ga0495630_0018486
757 Ga0495630_0347169
758 Ga0495643_0148617
759 Ga0495666_0108244
760 Ga0495652_0021792
761 Ga0495652_0252767
762 Ga0495587_0022241
763 Ga0495598_0120950
764 Ga0495645_0013403
765 Ga0495667_0162968
766 Ga0495667_0223897
767 Ga0495667_0238456
768 Ga0495635_0396734
769 Ga0495657_0096331
770 Ga0495657_0232160
771 Ga0495623_0021804
772 Ga0495646_0012149
773 Ga0495624_0032674
774 Ga0495581_0122102
775 Ga0495674_0018121
776 Ga0495676_0156427
777 Ga0495675_0219136
778 Ga0496101_0324395
779 Ga0496101_0406817
780 Ga0496102_0594822
781 Ga0496103_0150321
782 Ga0496103_0204758
783 Ga0496104_0196317
784 Ga0496104_0373090
785 Ga0496106_0008862
786 Ga0496106_0011271
787 Ga0496107_0208519
788 Ga0496108_0019361
789 Ga0496108_0141380
790 Ga0496108_0375820
791 Ga0496109_0021148
792 Ga0496110_0056243
793 Ga0496110_0074818
794 Ga0496110_0418473
795 Ga0496111_0093538
796 Ga0496112_0027261
797 Ga0496112_0208614
798 Ga0496112_0268910
799 Ga0496112_0455513
800 Ga0496112_0577065
801 Ga0496113_0000857
802 Ga0496114_0204578
803 Ga0496115_0304214
804 Ga0501299_011882
805 Ga0501242_018081
806 Ga0501261_007564
807 nmdc:mga05p37_12913_c1
808 nmdc:mga0a205_25664_c1
809 Ga0495655_0001907
810 Ga0495619_0222568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

63

323

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hno-assembly1.cif.gz_A high resolution crystal structure of dna apurinic/apyrimidinic (ap) endonuclease iv nfo from thermatoga maritima 0.9202 1 276
4hno-assembly1.cif.gz_A high resolution crystal structure of dna apurinic/apyrimidinic (ap) endonuclease iv nfo from thermatoga maritima 0.9045 1 276
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 0.8897 1 271
2nqj-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna 0.8897 1 271
3aam-assembly1.cif.gz_A crystal structure of endonuclease iv from thermus thermophilus hb8 0.8872 1 276
ID Description Score Start End Superfamily
2x7wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.92 1 276 3.20.20.150
af_Q966U0_262_539_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9114 1 273 3.20.20.150
af_Q8IE02_304_597_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9068 1 275 3.20.20.150
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9057 1 273 3.20.20.150
2x7wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9043 1 276 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V6GLA9-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9925 1 206 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A2V6N5R1-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9916 1 136 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A838IAC6-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9903 1 181 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
AF-A0A2V5Q5P3-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9778 1 199 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
AF-A0A2V6L203-F1-model_v4 Deoxyribonuclease IV (EC 3.1.21.2) 0.9726 1 147 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833

Map