F435953

General Info

Members Datasets Scaffolds Average Seq Length
405 185 810 213

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10062769|Ga0207643_100627692
Length 216
Sequence MLNTNSIAAETPRTGERIRVLCVDDHRVMLDGLALLIGRQPDMEVIAAATNGERAVELFASLLPDVTLMDLQLPTMSGLEAIGAIRKSHSDARIVVLTMYQGDEDIYRALEAGAAAYLLKDTLAEDLVNVIRDVHTGHKPIPPDVAAALAARKAQPALTPREIEVVHLIAQGLRNKEIAVTLGISEQTAKVHVKNILAKRSAVIAVAVRRGIIHIR

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 29.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10062769 3300025908 Archaea 2123
2 JGI24746J21847_1001008 3300001977 Unclassified 4424
3 JGI25406J46586_10018991 3300003203 Bacteria 2812
4 Ga0065712_10067776 3300005290 Bacteria 42236
5 Ga0065707_10148981 3300005295 Unclassified 1680
6 Ga0070676_10003532 3300005328 Bacteria 8174
7 Ga0070676_10011813 3300005328 Bacteria 4753
8 Ga0070676_10715960 3300005328 Bacteria 732
9 Ga0070683_100135239 3300005329 Bacteria 2334
10 Ga0070690_100006772 3300005330 Bacteria 6513
11 Ga0070690_100034954 3300005330 Unclassified 3151
12 Ga0070670_100029841 3300005331 Bacteria 4697
13 Ga0070670_101201764 3300005331 Bacteria 693
14 Ga0070677_10005115 3300005333 Unclassified 4311
15 Ga0070677_10068747 3300005333 Bacteria 1484
16 Ga0070677_10219195 3300005333 Bacteria 928
17 Ga0068869_100000245 3300005334 Bacteria 28658
18 Ga0068869_100014261 3300005334 Bacteria 5305
19 Ga0070666_10002448 3300005335 Bacteria 11224
20 Ga0070666_10209803 3300005335 Bacteria 1371
21 Ga0070680_100095713 3300005336 Archaea 2462
22 Ga0070682_100123578 3300005337 Unclassified 1741
23 Ga0068868_100029524 3300005338 Unclassified 4199
24 Ga0068868_100065261 3300005338 Bacteria 2892
25 Ga0070660_100095531 3300005339 Bacteria 2349
26 Ga0070689_100013000 3300005340 Bacteria 6014
27 Ga0070689_100581677 3300005340 Bacteria 968
28 Ga0070687_100011749 3300005343 Unclassified 3841
29 Ga0070687_100584234 3300005343 Unclassified 765
30 Ga0070661_100149159 3300005344 Unclassified 1767
31 Ga0070661_100300595 3300005344 Unclassified 1249
32 Ga0070661_100733045 3300005344 Unclassified 807
33 Ga0070668_100047359 3300005347 Unclassified 3306
34 Ga0070669_100002774 3300005353 Bacteria 12639
35 Ga0070669_100090106 3300005353 Unclassified 2298
36 Ga0070669_100101150 3300005353 Bacteria 2174
37 Ga0070669_100149223 3300005353 Bacteria 1809
38 Ga0070669_100642572 3300005353 Bacteria 892
39 Ga0070675_100002822 3300005354 Bacteria 13100
40 Ga0070675_100014556 3300005354 Bacteria 6204
41 Ga0070675_100016008 3300005354 Bacteria 5943
42 Ga0070675_100022740 3300005354 Bacteria 5009
43 Ga0070675_100042187 3300005354 Archaea 3727
44 Ga0070675_100043483 3300005354 Unclassified 3671
45 Ga0070675_100132672 3300005354 Bacteria 2123
46 Ga0070675_100219818 3300005354 Bacteria 1654
47 Ga0070675_100252484 3300005354 Archaea 1544
48 Ga0070671_100052907 3300005355 Bacteria 3376
49 Ga0070671_100071526 3300005355 Unclassified 2895
50 Ga0070671_100250617 3300005355 Bacteria 1504
51 Ga0070671_100605725 3300005355 Bacteria 947
52 Ga0070671_100700098 3300005355 Bacteria 879
53 Ga0070674_100079747 3300005356 Unclassified 2336
54 Ga0070673_100008475 3300005364 Bacteria 6835
55 Ga0070673_100074516 3300005364 Bacteria 2735
56 Ga0070673_100197908 3300005364 Unclassified 1729
57 Ga0070673_101006528 3300005364 Bacteria 776
58 Ga0070688_100110146 3300005365 Archaea 1830
59 Ga0070688_100608216 3300005365 Bacteria 837
60 Ga0070659_100081373 3300005366 Unclassified 2586
61 Ga0070667_100006844 3300005367 Bacteria 9467
62 Ga0070667_100565356 3300005367 Bacteria 1046
63 Ga0070701_10030772 3300005438 Unclassified 2658
64 Ga0070711_100224885 3300005439 Bacteria 1461
65 Ga0070700_100001793 3300005441 Bacteria 10831
66 Ga0070700_100028517 3300005441 Unclassified 3322
67 Ga0070694_100366545 3300005444 Bacteria 1120
68 Ga0070663_100131316 3300005455 Unclassified 1902
69 Ga0070678_100025124 3300005456 Unclassified 4002
70 Ga0070678_100034030 3300005456 Archaea 3545
71 Ga0070678_100052280 3300005456 Unclassified 2966
72 Ga0070678_100234570 3300005456 Bacteria 1531
73 Ga0070678_100618679 3300005456 Bacteria 968
74 Ga0070662_100006395 3300005457 Bacteria 7591
75 Ga0070662_100358142 3300005457 Bacteria 1197
76 Ga0070681_10005738 3300005458 Bacteria 11999
77 Ga0070681_10007128 3300005458 Bacteria 10891
78 Ga0070681_10159391 3300005458 Bacteria 2180
79 Ga0068867_100020472 3300005459 Bacteria 4715
80 Ga0068867_100214284 3300005459 Bacteria 1549
81 Ga0070685_10005658 3300005466 Bacteria 6343
82 Ga0070685_10059991 3300005466 Bacteria 2223
83 Ga0070685_10188223 3300005466 Bacteria 1333
84 Ga0070706_100279735 3300005467 Bacteria 1557
85 Ga0070707_100808418 3300005468 Bacteria 901
86 Ga0070698_100567698 3300005471 Bacteria 1074
87 Ga0070699_100432402 3300005518 Unclassified 1192
88 Ga0070679_100058376 3300005530 Unclassified 3845
89 Ga0070684_100346936 3300005535 Unclassified 1365
90 Ga0070684_100467697 3300005535 Unclassified 1166
91 Ga0070672_100005205 3300005543 Bacteria 8606
92 Ga0070672_100020197 3300005543 Bacteria 4853
93 Ga0070672_100043787 3300005543 Bacteria 3454
94 Ga0070672_100109722 3300005543 Unclassified 2248
95 Ga0070672_100305971 3300005543 Bacteria 1348
96 Ga0070672_100817100 3300005543 Bacteria 821
97 Ga0070686_100010348 3300005544 Bacteria 5259
98 Ga0070686_100024362 3300005544 Bacteria 3626
99 Ga0070665_100041075 3300005548 Unclassified 4648
100 Ga0070665_100158111 3300005548 Unclassified 2268
101 Ga0070665_100936573 3300005548 Bacteria 879
102 Ga0070704_100274975 3300005549 Unclassified 1393
103 Ga0070704_100297679 3300005549 Bacteria 1343
104 Ga0068855_100847215 3300005563 Bacteria 969
105 Ga0070664_100010463 3300005564 Bacteria 7519
106 Ga0070664_100071510 3300005564 Bacteria 2973
107 Ga0070664_100128190 3300005564 Archaea 2227
108 Ga0070664_100194520 3300005564 Unclassified 1808
109 Ga0068857_100025182 3300005577 Bacteria 5239
110 Ga0068857_100083432 3300005577 Bacteria 2855
111 Ga0068857_100505034 3300005577 Bacteria 1135
112 Ga0068854_100114663 3300005578 Bacteria 2037
113 Ga0068854_100506568 3300005578 Bacteria 1017
114 Ga0070702_100175998 3300005615 Bacteria 1396
115 Ga0068852_100097928 3300005616 Unclassified 2640
116 Ga0068859_100041197 3300005617 Unclassified 4639
117 Ga0068859_100283603 3300005617 Archaea 1749
118 Ga0068859_100760249 3300005617 Archaea 1058
119 Ga0068859_100784169 3300005617 Bacteria 1041
120 Ga0068864_100040298 3300005618 Bacteria 3996
121 Ga0068864_100213705 3300005618 Unclassified 1777
122 Ga0068861_100016520 3300005719 Bacteria 5224
123 Ga0068861_100040448 3300005719 Bacteria 3487
124 Ga0068851_10121815 3300005834 Bacteria 1402
125 Ga0068870_10001328 3300005840 Bacteria 9957
126 Ga0068870_10012729 3300005840 Bacteria 3938
127 Ga0068870_10147004 3300005840 Bacteria 1385
128 Ga0068870_10340853 3300005840 Unclassified 959
129 Ga0068863_100087315 3300005841 Unclassified 2955
130 Ga0068863_100888142 3300005841 Bacteria 891
131 Ga0068858_100015362 3300005842 Bacteria 7200
132 Ga0068858_100041153 3300005842 Bacteria 4286
133 Ga0068858_100154874 3300005842 Bacteria 2156
134 Ga0068858_100554465 3300005842 Bacteria 1113
135 Ga0068858_100627849 3300005842 Bacteria 1043
136 Ga0068858_100957331 3300005842 Bacteria 838
137 Ga0068860_100027966 3300005843 Bacteria 5429
138 Ga0068860_100097997 3300005843 Bacteria 2796
139 Ga0068860_100217374 3300005843 Bacteria 1855
140 Ga0068862_100022920 3300005844 Bacteria 5228
141 Ga0068862_100109254 3300005844 Unclassified 2426
142 Ga0081455_10034494 3300005937 Bacteria 4532
143 Ga0081539_10000285 3300005985 Bacteria 114370
144 Ga0070715_10030597 3300006163 Unclassified 2178
145 Ga0097621_100033386 3300006237 Unclassified 4098
146 Ga0097621_100092688 3300006237 Bacteria 2531
147 Ga0097621_100364144 3300006237 Bacteria 1289
148 Ga0068871_100038593 3300006358 Bacteria 3815
149 Ga0068871_100100139 3300006358 Unclassified 2427
150 Ga0068871_100146476 3300006358 Bacteria 2011
151 Ga0068871_100155920 3300006358 Unclassified 1950
152 Ga0068871_100475718 3300006358 Bacteria 1123
153 Ga0075428_100049143 3300006844 Bacteria 4628
154 Ga0075428_100181590 3300006844 Bacteria 2277
155 Ga0075428_100589671 3300006844 Unclassified 1187
156 Ga0075430_100005930 3300006846 Bacteria 10321
157 Ga0075431_100002095 3300006847 Bacteria 19057
158 Ga0075431_100018301 3300006847 Bacteria 7129
159 Ga0075431_100191348 3300006847 Bacteria 2096
160 Ga0075433_10096835 3300006852 Unclassified 2611
161 Ga0075433_10673844 3300006852 Unclassified 906
162 Ga0075434_100086264 3300006871 Unclassified 3139
163 Ga0075434_100324056 3300006871 Archaea 1561
164 Ga0075434_101250796 3300006871 Unclassified 754
165 Ga0075429_100000706 3300006880 Bacteria 26099
166 Ga0075429_100132653 3300006880 Unclassified 2179
167 Ga0075429_100218395 3300006880 Bacteria 1670
168 Ga0068865_100003860 3300006881 Bacteria 8988
169 Ga0068865_100010940 3300006881 Bacteria 5663
170 Ga0097620_100041198 3300006931 Unclassified 4639
171 Ga0097620_100283614 3300006931 Archaea 1749
172 Ga0097620_100760327 3300006931 Archaea 1058
173 Ga0097620_100784079 3300006931 Bacteria 1041
174 Ga0075435_100096529 3300007076 Bacteria 2445
175 Ga0111539_10010625 3300009094 Bacteria 11592
176 Ga0111539_10015316 3300009094 Bacteria 9549
177 Ga0111539_10017354 3300009094 Bacteria 8908
178 Ga0111539_10312696 3300009094 Bacteria 1828
179 Ga0111539_10729888 3300009094 Bacteria 1153
180 Ga0105245_10264226 3300009098 Unclassified 1676
181 Ga0105247_10099002 3300009101 Bacteria 1862
182 Ga0114129_10105343 3300009147 Bacteria 3898
183 Ga0114129_10187250 3300009147 Bacteria 2812
184 Ga0105243_10392439 3300009148 Bacteria 1287
185 Ga0105243_10462637 3300009148 Bacteria 1193
186 Ga0105243_11083477 3300009148 Bacteria 808
187 Ga0105242_10155432 3300009176 Bacteria 1998
188 Ga0105242_10163996 3300009176 Unclassified 1947
189 Ga0105242_10906132 3300009176 Bacteria 882
190 Ga0105248_10004069 3300009177 Bacteria 16160
191 Ga0105248_10050908 3300009177 Unclassified 4647
192 Ga0105248_10062829 3300009177 Bacteria 4168
193 Ga0105248_10326405 3300009177 Bacteria 1729
194 Ga0105238_10376195 3300009551 Bacteria 1411
195 Ga0105238_10636378 3300009551 Bacteria 1076
196 Ga0105249_10007086 3300009553 Bacteria 9786
197 Ga0105249_11018556 3300009553 Unclassified 897
198 Ga0105246_10020336 3300011119 Unclassified 4256
199 Ga0105246_10052209 3300011119 Unclassified 2809
200 Ga0105246_10170622 3300011119 Bacteria 1666
201 Ga0157369_10794780 3300013105 Bacteria 972
202 Ga0157374_10359628 3300013296 Unclassified 1447
203 Ga0157378_10009572 3300013297 Bacteria 8439
204 Ga0157378_10046206 3300013297 Unclassified 3871
205 Ga0157378_10667474 3300013297 Unclassified 1057
206 Ga0157378_11455554 3300013297 Bacteria 729
207 Ga0163162_10847886 3300013306 Bacteria 1029
208 Ga0157372_10791528 3300013307 Bacteria 1102
209 Ga0157375_10035491 3300013308 Bacteria 4760
210 Ga0157375_10058014 3300013308 Unclassified 3829
211 Ga0157375_10104120 3300013308 Bacteria 2926
212 Ga0157375_10159187 3300013308 Bacteria 2399
213 Ga0157375_10164643 3300013308 Bacteria 2362
214 Ga0157375_10732547 3300013308 Bacteria 1141
215 Ga0163163_10009132 3300014325 Bacteria 8836
216 Ga0163163_10504560 3300014325 Bacteria 1272
217 Ga0163163_10585077 3300014325 Unclassified 1179
218 Ga0157380_10005268 3300014326 Bacteria 9036
219 Ga0157380_10025726 3300014326 Unclassified 4465
220 Ga0157380_10030562 3300014326 Bacteria 4127
221 Ga0157380_10086533 3300014326 Bacteria 2575
222 Ga0157380_10123896 3300014326 Bacteria 2194
223 Ga0157380_10131205 3300014326 Unclassified 2138
224 Ga0157380_10388025 3300014326 Bacteria 1320
225 Ga0157377_10009710 3300014745 Unclassified 4735
226 Ga0157377_10060790 3300014745 Unclassified 2158
227 Ga0157377_10137614 3300014745 Bacteria 1498
228 Ga0157379_10110603 3300014968 Bacteria 2467
229 Ga0157376_10069941 3300014969 Bacteria 2978
230 Ga0157376_10203900 3300014969 Bacteria 1822
231 Ga0157376_10789325 3300014969 Bacteria 961
232 Ga0163161_10044522 3300017792 Unclassified 3197
233 Ga0207697_10006315 3300025315 Bacteria 5383
234 Ga0207682_10006476 3300025893 Bacteria 4712
235 Ga0207682_10031582 3300025893 Unclassified 2126
236 Ga0207688_10000527 3300025901 Bacteria 18549
237 Ga0207680_10100746 3300025903 Bacteria 1855
238 Ga0207680_10122230 3300025903 Unclassified 1704
239 Ga0207645_10000992 3300025907 Bacteria 23401
240 Ga0207645_10010425 3300025907 Bacteria 6378
241 Ga0207645_10172765 3300025907 Bacteria 1417
242 Ga0207643_10004648 3300025908 Bacteria 7375
243 Ga0207643_10028722 3300025908 Bacteria 3091
244 Ga0207643_10445966 3300025908 Unclassified 823
245 Ga0207684_10236240 3300025910 Bacteria 1577
246 Ga0207707_10028359 3300025912 Unclassified 4894
247 Ga0207663_10248885 3300025916 Bacteria 1307
248 Ga0207660_10302297 3300025917 Bacteria 1274
249 Ga0207662_10007216 3300025918 Bacteria 6044
250 Ga0207662_10019516 3300025918 Bacteria 3860
251 Ga0207657_10273807 3300025919 Bacteria 1341
252 Ga0207649_10020215 3300025920 Bacteria 3816
253 Ga0207652_10046193 3300025921 Unclassified 3715
254 Ga0207681_10007752 3300025923 Bacteria 6577
255 Ga0207681_10011238 3300025923 Bacteria 5499
256 Ga0207681_10026565 3300025923 Bacteria 3735
257 Ga0207681_10140346 3300025923 Bacteria 1799
258 Ga0207650_10001167 3300025925 Bacteria 19308
259 Ga0207650_10113398 3300025925 Unclassified 2101
260 Ga0207650_10129073 3300025925 Unclassified 1976
261 Ga0207659_10027142 3300025926 Bacteria 3873
262 Ga0207659_10036665 3300025926 Bacteria 3399
263 Ga0207659_10045933 3300025926 Unclassified 3082
264 Ga0207659_10052598 3300025926 Unclassified 2902
265 Ga0207659_10059229 3300025926 Bacteria 2752
266 Ga0207659_10135746 3300025926 Bacteria 1904
267 Ga0207659_10189281 3300025926 Bacteria 1637
268 Ga0207659_10233756 3300025926 Archaea 1484
269 Ga0207644_10038059 3300025931 Bacteria 3386
270 Ga0207644_10276686 3300025931 Bacteria 1347
271 Ga0207644_10299550 3300025931 Unclassified 1295
272 Ga0207644_10555112 3300025931 Bacteria 951
273 Ga0207706_10122611 3300025933 Bacteria 2286
274 Ga0207686_10040133 3300025934 Bacteria 2844
275 Ga0207709_10017223 3300025935 Bacteria 4029
276 Ga0207670_10532155 3300025936 Bacteria 958
277 Ga0207691_10037613 3300025940 Bacteria 4481
278 Ga0207691_10038197 3300025940 Unclassified 4442
279 Ga0207691_10068200 3300025940 Bacteria 3214
280 Ga0207691_10190666 3300025940 Bacteria 1788
281 Ga0207691_10204403 3300025940 Bacteria 1718
282 Ga0207711_10082131 3300025941 Bacteria 2816
283 Ga0207711_10127439 3300025941 Unclassified 2279
284 Ga0207711_10145278 3300025941 Unclassified 2137
285 Ga0207711_10201421 3300025941 Bacteria 1816
286 Ga0207711_10283962 3300025941 Bacteria 1524
287 Ga0207689_10002830 3300025942 Bacteria 16006
288 Ga0207689_10029510 3300025942 Unclassified 4579
289 Ga0207689_10082287 3300025942 Unclassified 2647
290 Ga0207661_10052302 3300025944 Bacteria 3263
291 Ga0207679_10016945 3300025945 Unclassified 4846
292 Ga0207679_10041498 3300025945 Bacteria 3299
293 Ga0207679_10151333 3300025945 Archaea 1889
294 Ga0207679_10192134 3300025945 Unclassified 1698
295 Ga0207667_10635846 3300025949 Bacteria 1074
296 Ga0207651_10025229 3300025960 Unclassified 3693
297 Ga0207651_10065577 3300025960 Bacteria 2547
298 Ga0207651_10088084 3300025960 Bacteria 2262
299 Ga0207651_10099897 3300025960 Bacteria 2150
300 Ga0207651_10663652 3300025960 Bacteria 916
301 Ga0207712_10027178 3300025961 Bacteria 3820
302 Ga0207668_10018821 3300025972 Unclassified 4354
303 Ga0207640_10047421 3300025981 Bacteria 2771
304 Ga0207658_10617799 3300025986 Unclassified 975
305 Ga0207677_10026837 3300026023 Bacteria 3618
306 Ga0207677_10278769 3300026023 Bacteria 1371
307 Ga0207703_10127123 3300026035 Bacteria 2196
308 Ga0207703_10134938 3300026035 Bacteria 2136
309 Ga0207703_10591631 3300026035 Bacteria 1049
310 Ga0207703_10746475 3300026035 Unclassified 932
311 Ga0207708_10000600 3300026075 Bacteria 27777
312 Ga0207708_10044017 3300026075 Unclassified 3402
313 Ga0207641_10020101 3300026088 Bacteria 5481
314 Ga0207641_11241740 3300026088 Bacteria 745
315 Ga0207648_10000122 3300026089 Bacteria 76231
316 Ga0207648_10524921 3300026089 Bacteria 1085
317 Ga0207676_10026678 3300026095 Bacteria 4297
318 Ga0207676_10054118 3300026095 Unclassified 3144
319 Ga0207676_10203030 3300026095 Unclassified 1753
320 Ga0207676_10219664 3300026095 Bacteria 1691
321 Ga0207676_10248181 3300026095 Unclassified 1601
322 Ga0207676_10411611 3300026095 Bacteria 1266
323 Ga0207674_10015987 3300026116 Bacteria 8222
324 Ga0207674_10063973 3300026116 Bacteria 3711
325 Ga0207674_10266742 3300026116 Bacteria 1659
326 Ga0207675_100007767 3300026118 Bacteria 10119
327 Ga0207675_100039396 3300026118 Bacteria 4410
328 Ga0207683_10009359 3300026121 Bacteria 8344
329 Ga0207683_10016896 3300026121 Bacteria 6209
330 Ga0207683_10023374 3300026121 Bacteria 5317
331 Ga0207683_10090661 3300026121 Bacteria 2722
332 Ga0207698_10095608 3300026142 Unclassified 2446
333 Ga0207698_10375512 3300026142 Bacteria 1351
334 Ga0207428_10012288 3300027907 Bacteria 7526
335 Ga0207428_10588961 3300027907 Unclassified 802
336 Ga0268266_10050267 3300028379 Unclassified 3577
337 Ga0268266_10110611 3300028379 Unclassified 2434
338 Ga0268266_10184424 3300028379 Bacteria 1902
339 Ga0268266_10644151 3300028379 Unclassified 1020
340 Ga0268266_11303885 3300028379 Bacteria 701
341 Ga0268265_10228570 3300028380 Bacteria 1633
342 Ga0268264_10024479 3300028381 Unclassified 4929
343 Ga0268264_10113056 3300028381 Bacteria 2381
344 Ga0268264_10744967 3300028381 Archaea 976
345 Ga0265318_10162193 3300028577 Unclassified 820
346 Ga0307408_100333457 3300031548 Bacteria 1282
347 Ga0307414_10545279 3300032004 Unclassified 1033
348 Ga0373932_0016271 3300035112 Unclassified 1896
349 Ga0373939_0246745 3300035114 Bacteria 693
350 Ga0373953_0064848 3300035117 Bacteria 1499
351 Ga0373931_0246792 3300035691 Bacteria 1084
352 Ga0373937_0198494 3300036401 Bacteria 1886
353 Ga0373937_0242889 3300036401 Bacteria 1697
354 Ga0373937_0565267 3300036401 Unclassified 1080
355 Ga0373937_0700133 3300036401 Bacteria 960
356 Ga0436365_0494837 3300039437 Unclassified 3067
357 Ga0439450_004617 3300042008 Unclassified 2366
358 Ga0439435_0128161 3300042436 Unclassified 800
359 Ga0466957_0592329 3300044842 Bacteria 776
360 Ga0466967_0249613 3300045976 Unclassified 1695
361 Ga0466967_0595364 3300045976 Unclassified 1091
362 Ga0495582_0425801 3300046473 Bacteria 766
363 Ga0495639_0171568 3300046475 Bacteria 1053
364 Ga0495630_0175819 3300046517 Bacteria 1632
365 Ga0495674_0444084 3300047319 Unclassified 1043
366 Ga0496100_0186993 3300048903 Unclassified 1501
367 Ga0496101_0000227 3300048904 Bacteria 42022
368 Ga0496104_0315107 3300048907 Unclassified 1477
369 Ga0496104_0760900 3300048907 Unclassified 875
370 Ga0496105_0234668 3300048908 Unclassified 1490
371 Ga0496106_0257149 3300048909 Unclassified 1397
372 Ga0496106_0304545 3300048909 Bacteria 1278
373 Ga0496106_0593322 3300048909 Unclassified 887
374 Ga0496109_0329791 3300048912 Bacteria 1441
375 Ga0496109_0474213 3300048912 Bacteria 1182
376 Ga0496113_0072263 3300048916 Unclassified 2625
377 Ga0496114_0000536 3300048917 Bacteria 28013
378 Ga0496114_0062082 3300048917 Bacteria 3127
379 Ga0501034_0100757 3300049571 Unclassified 2883
380 Ga0501040_0366985 3300049576 Bacteria 1032
381 Ga0501047_0259741 3300049581 Unclassified 1585
382 Ga0501070_0136916 3300049586 Bacteria 2022
383 Ga0501072_0186053 3300049588 Bacteria 1657
384 Ga0501044_0001012 3300049823 Bacteria 33764
385 nmdc:mga05p37_25117_c2 3300050507 Bacteria 3230
386 nmdc:mga09592_103977_c1 3300050508 Bacteria 2434
387 nmdc:mga09592_212782_c1 3300050508 Bacteria 1675
388 nmdc:mga09592_47523_c1 3300050508 Bacteria 3617
389 nmdc:mga09592_53447_c1 3300050508 Bacteria 3410
390 nmdc:mga0qj67_23776_c1 3300050509 Bacteria 4718
391 nmdc:mga08y16_10320_c1 3300050511 Bacteria 9804
392 nmdc:mga08y16_13075_c2 3300050511 Bacteria 7621
393 nmdc:mga08y16_248761_c1 3300050511 Bacteria 1837
394 nmdc:mga08y16_25768_c1 3300050511 Bacteria 6205
395 nmdc:mga08y16_492022_c1 3300050511 Unclassified 1247
396 nmdc:mga08y16_54836_c1 3300050511 Unclassified 4166
397 nmdc:mga08y16_817235_c1 3300050511 Bacteria 924
398 nmdc:mga0n895_312395_c1 3300050512 Archaea 1593
399 nmdc:mga0n895_44230_c1 3300050512 Unclassified 4342
400 nmdc:mga0rr50_181620_c1 3300050513 Bacteria 1720
401 nmdc:mga0a205_19469_c1 3300050515 Bacteria 6399
402 Ga0495619_0057124 3300053085 Bacteria 2589
403 Ga0495619_0207449 3300053085 Unclassified 1357
404 Ga0495619_0225255 3300053085 Bacteria 1299
405 Ga0501082_0243205 3300060353 Bacteria 1566
406 Ga0207643_10062769
407 JGI24746J21847_1001008
408 JGI25406J46586_10018991
409 Ga0065712_10067776
410 Ga0065707_10148981
411 Ga0070676_10003532
412 Ga0070676_10011813
413 Ga0070676_10715960
414 Ga0070683_100135239
415 Ga0070690_100006772
416 Ga0070690_100034954
417 Ga0070670_100029841
418 Ga0070670_101201764
419 Ga0070677_10005115
420 Ga0070677_10068747
421 Ga0070677_10219195
422 Ga0068869_100000245
423 Ga0068869_100014261
424 Ga0070666_10002448
425 Ga0070666_10209803
426 Ga0070680_100095713
427 Ga0070682_100123578
428 Ga0068868_100029524
429 Ga0068868_100065261
430 Ga0070660_100095531
431 Ga0070689_100013000
432 Ga0070689_100581677
433 Ga0070687_100011749
434 Ga0070687_100584234
435 Ga0070661_100149159
436 Ga0070661_100300595
437 Ga0070661_100733045
438 Ga0070668_100047359
439 Ga0070669_100002774
440 Ga0070669_100090106
441 Ga0070669_100101150
442 Ga0070669_100149223
443 Ga0070669_100642572
444 Ga0070675_100002822
445 Ga0070675_100014556
446 Ga0070675_100016008
447 Ga0070675_100022740
448 Ga0070675_100042187
449 Ga0070675_100043483
450 Ga0070675_100132672
451 Ga0070675_100219818
452 Ga0070675_100252484
453 Ga0070671_100052907
454 Ga0070671_100071526
455 Ga0070671_100250617
456 Ga0070671_100605725
457 Ga0070671_100700098
458 Ga0070674_100079747
459 Ga0070673_100008475
460 Ga0070673_100074516
461 Ga0070673_100197908
462 Ga0070673_101006528
463 Ga0070688_100110146
464 Ga0070688_100608216
465 Ga0070659_100081373
466 Ga0070667_100006844
467 Ga0070667_100565356
468 Ga0070701_10030772
469 Ga0070711_100224885
470 Ga0070700_100001793
471 Ga0070700_100028517
472 Ga0070694_100366545
473 Ga0070663_100131316
474 Ga0070678_100025124
475 Ga0070678_100034030
476 Ga0070678_100052280
477 Ga0070678_100234570
478 Ga0070678_100618679
479 Ga0070662_100006395
480 Ga0070662_100358142
481 Ga0070681_10005738
482 Ga0070681_10007128
483 Ga0070681_10159391
484 Ga0068867_100020472
485 Ga0068867_100214284
486 Ga0070685_10005658
487 Ga0070685_10059991
488 Ga0070685_10188223
489 Ga0070706_100279735
490 Ga0070707_100808418
491 Ga0070698_100567698
492 Ga0070699_100432402
493 Ga0070679_100058376
494 Ga0070684_100346936
495 Ga0070684_100467697
496 Ga0070672_100005205
497 Ga0070672_100020197
498 Ga0070672_100043787
499 Ga0070672_100109722
500 Ga0070672_100305971
501 Ga0070672_100817100
502 Ga0070686_100010348
503 Ga0070686_100024362
504 Ga0070665_100041075
505 Ga0070665_100158111
506 Ga0070665_100936573
507 Ga0070704_100274975
508 Ga0070704_100297679
509 Ga0068855_100847215
510 Ga0070664_100010463
511 Ga0070664_100071510
512 Ga0070664_100128190
513 Ga0070664_100194520
514 Ga0068857_100025182
515 Ga0068857_100083432
516 Ga0068857_100505034
517 Ga0068854_100114663
518 Ga0068854_100506568
519 Ga0070702_100175998
520 Ga0068852_100097928
521 Ga0068859_100041197
522 Ga0068859_100283603
523 Ga0068859_100760249
524 Ga0068859_100784169
525 Ga0068864_100040298
526 Ga0068864_100213705
527 Ga0068861_100016520
528 Ga0068861_100040448
529 Ga0068851_10121815
530 Ga0068870_10001328
531 Ga0068870_10012729
532 Ga0068870_10147004
533 Ga0068870_10340853
534 Ga0068863_100087315
535 Ga0068863_100888142
536 Ga0068858_100015362
537 Ga0068858_100041153
538 Ga0068858_100154874
539 Ga0068858_100554465
540 Ga0068858_100627849
541 Ga0068858_100957331
542 Ga0068860_100027966
543 Ga0068860_100097997
544 Ga0068860_100217374
545 Ga0068862_100022920
546 Ga0068862_100109254
547 Ga0081455_10034494
548 Ga0081539_10000285
549 Ga0070715_10030597
550 Ga0097621_100033386
551 Ga0097621_100092688
552 Ga0097621_100364144
553 Ga0068871_100038593
554 Ga0068871_100100139
555 Ga0068871_100146476
556 Ga0068871_100155920
557 Ga0068871_100475718
558 Ga0075428_100049143
559 Ga0075428_100181590
560 Ga0075428_100589671
561 Ga0075430_100005930
562 Ga0075431_100002095
563 Ga0075431_100018301
564 Ga0075431_100191348
565 Ga0075433_10096835
566 Ga0075433_10673844
567 Ga0075434_100086264
568 Ga0075434_100324056
569 Ga0075434_101250796
570 Ga0075429_100000706
571 Ga0075429_100132653
572 Ga0075429_100218395
573 Ga0068865_100003860
574 Ga0068865_100010940
575 Ga0097620_100041198
576 Ga0097620_100283614
577 Ga0097620_100760327
578 Ga0097620_100784079
579 Ga0075435_100096529
580 Ga0111539_10010625
581 Ga0111539_10015316
582 Ga0111539_10017354
583 Ga0111539_10312696
584 Ga0111539_10729888
585 Ga0105245_10264226
586 Ga0105247_10099002
587 Ga0114129_10105343
588 Ga0114129_10187250
589 Ga0105243_10392439
590 Ga0105243_10462637
591 Ga0105243_11083477
592 Ga0105242_10155432
593 Ga0105242_10163996
594 Ga0105242_10906132
595 Ga0105248_10004069
596 Ga0105248_10050908
597 Ga0105248_10062829
598 Ga0105248_10326405
599 Ga0105238_10376195
600 Ga0105238_10636378
601 Ga0105249_10007086
602 Ga0105249_11018556
603 Ga0105246_10020336
604 Ga0105246_10052209
605 Ga0105246_10170622
606 Ga0157369_10794780
607 Ga0157374_10359628
608 Ga0157378_10009572
609 Ga0157378_10046206
610 Ga0157378_10667474
611 Ga0157378_11455554
612 Ga0163162_10847886
613 Ga0157372_10791528
614 Ga0157375_10035491
615 Ga0157375_10058014
616 Ga0157375_10104120
617 Ga0157375_10159187
618 Ga0157375_10164643
619 Ga0157375_10732547
620 Ga0163163_10009132
621 Ga0163163_10504560
622 Ga0163163_10585077
623 Ga0157380_10005268
624 Ga0157380_10025726
625 Ga0157380_10030562
626 Ga0157380_10086533
627 Ga0157380_10123896
628 Ga0157380_10131205
629 Ga0157380_10388025
630 Ga0157377_10009710
631 Ga0157377_10060790
632 Ga0157377_10137614
633 Ga0157379_10110603
634 Ga0157376_10069941
635 Ga0157376_10203900
636 Ga0157376_10789325
637 Ga0163161_10044522
638 Ga0207697_10006315
639 Ga0207682_10006476
640 Ga0207682_10031582
641 Ga0207688_10000527
642 Ga0207680_10100746
643 Ga0207680_10122230
644 Ga0207645_10000992
645 Ga0207645_10010425
646 Ga0207645_10172765
647 Ga0207643_10004648
648 Ga0207643_10028722
649 Ga0207643_10445966
650 Ga0207684_10236240
651 Ga0207707_10028359
652 Ga0207663_10248885
653 Ga0207660_10302297
654 Ga0207662_10007216
655 Ga0207662_10019516
656 Ga0207657_10273807
657 Ga0207649_10020215
658 Ga0207652_10046193
659 Ga0207681_10007752
660 Ga0207681_10011238
661 Ga0207681_10026565
662 Ga0207681_10140346
663 Ga0207650_10001167
664 Ga0207650_10113398
665 Ga0207650_10129073
666 Ga0207659_10027142
667 Ga0207659_10036665
668 Ga0207659_10045933
669 Ga0207659_10052598
670 Ga0207659_10059229
671 Ga0207659_10135746
672 Ga0207659_10189281
673 Ga0207659_10233756
674 Ga0207644_10038059
675 Ga0207644_10276686
676 Ga0207644_10299550
677 Ga0207644_10555112
678 Ga0207706_10122611
679 Ga0207686_10040133
680 Ga0207709_10017223
681 Ga0207670_10532155
682 Ga0207691_10037613
683 Ga0207691_10038197
684 Ga0207691_10068200
685 Ga0207691_10190666
686 Ga0207691_10204403
687 Ga0207711_10082131
688 Ga0207711_10127439
689 Ga0207711_10145278
690 Ga0207711_10201421
691 Ga0207711_10283962
692 Ga0207689_10002830
693 Ga0207689_10029510
694 Ga0207689_10082287
695 Ga0207661_10052302
696 Ga0207679_10016945
697 Ga0207679_10041498
698 Ga0207679_10151333
699 Ga0207679_10192134
700 Ga0207667_10635846
701 Ga0207651_10025229
702 Ga0207651_10065577
703 Ga0207651_10088084
704 Ga0207651_10099897
705 Ga0207651_10663652
706 Ga0207712_10027178
707 Ga0207668_10018821
708 Ga0207640_10047421
709 Ga0207658_10617799
710 Ga0207677_10026837
711 Ga0207677_10278769
712 Ga0207703_10127123
713 Ga0207703_10134938
714 Ga0207703_10591631
715 Ga0207703_10746475
716 Ga0207708_10000600
717 Ga0207708_10044017
718 Ga0207641_10020101
719 Ga0207641_11241740
720 Ga0207648_10000122
721 Ga0207648_10524921
722 Ga0207676_10026678
723 Ga0207676_10054118
724 Ga0207676_10203030
725 Ga0207676_10219664
726 Ga0207676_10248181
727 Ga0207676_10411611
728 Ga0207674_10015987
729 Ga0207674_10063973
730 Ga0207674_10266742
731 Ga0207675_100007767
732 Ga0207675_100039396
733 Ga0207683_10009359
734 Ga0207683_10016896
735 Ga0207683_10023374
736 Ga0207683_10090661
737 Ga0207698_10095608
738 Ga0207698_10375512
739 Ga0207428_10012288
740 Ga0207428_10588961
741 Ga0268266_10050267
742 Ga0268266_10110611
743 Ga0268266_10184424
744 Ga0268266_10644151
745 Ga0268266_11303885
746 Ga0268265_10228570
747 Ga0268264_10024479
748 Ga0268264_10113056
749 Ga0268264_10744967
750 Ga0265318_10162193
751 Ga0307408_100333457
752 Ga0307414_10545279
753 Ga0373932_0016271
754 Ga0373939_0246745
755 Ga0373953_0064848
756 Ga0373931_0246792
757 Ga0373937_0198494
758 Ga0373937_0242889
759 Ga0373937_0565267
760 Ga0373937_0700133
761 Ga0436365_0494837
762 Ga0439450_004617
763 Ga0439435_0128161
764 Ga0466957_0592329
765 Ga0466967_0249613
766 Ga0466967_0595364
767 Ga0495582_0425801
768 Ga0495639_0171568
769 Ga0495630_0175819
770 Ga0495674_0444084
771 Ga0496100_0186993
772 Ga0496101_0000227
773 Ga0496104_0315107
774 Ga0496104_0760900
775 Ga0496105_0234668
776 Ga0496106_0257149
777 Ga0496106_0304545
778 Ga0496106_0593322
779 Ga0496109_0329791
780 Ga0496109_0474213
781 Ga0496113_0072263
782 Ga0496114_0000536
783 Ga0496114_0062082
784 Ga0501034_0100757
785 Ga0501040_0366985
786 Ga0501047_0259741
787 Ga0501070_0136916
788 Ga0501072_0186053
789 Ga0501044_0001012
790 nmdc:mga05p37_25117_c2
791 nmdc:mga09592_103977_c1
792 nmdc:mga09592_212782_c1
793 nmdc:mga09592_47523_c1
794 nmdc:mga09592_53447_c1
795 nmdc:mga0qj67_23776_c1
796 nmdc:mga08y16_10320_c1
797 nmdc:mga08y16_13075_c2
798 nmdc:mga08y16_248761_c1
799 nmdc:mga08y16_25768_c1
800 nmdc:mga08y16_492022_c1
801 nmdc:mga08y16_54836_c1
802 nmdc:mga08y16_817235_c1
803 nmdc:mga0n895_312395_c1
804 nmdc:mga0n895_44230_c1
805 nmdc:mga0rr50_181620_c1
806 nmdc:mga0a205_19469_c1
807 Ga0495619_0057124
808 Ga0495619_0207449
809 Ga0495619_0225255
810 Ga0501082_0243205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

20

132

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

156

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9787 145 200
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9782 146 206
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.975 146 206
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9615 6 122
6jqs-assembly1.cif.gz_A structure of transcription factor, gere 0.9542 146 207
ID Description Score Start End Superfamily
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9867 146 200 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9856 146 200 1.10.10.10
4hyeA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.981 146 206 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9787 145 200 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9738 144 206 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2A2QVW9-F1-model_v4 DNA-binding response regulator 0.987 6 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A352FSP0-F1-model_v4 DNA-binding response regulator 0.9862 5 142 GO:0000160
GO:0003677
AF-A0A1F2U3G5-F1-model_v4 DNA-binding response regulator 0.9806 1 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A2N9LIR4-F1-model_v4 Nitrate/nitrite response regulator protein NarL 0.9795 3 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A4V2G4X2-F1-model_v4 LuxR family two component transcriptional regulator 0.9768 6 209 GO:0000160
GO:0003677
GO:0006355

Map