F435930

General Info

Members Datasets Scaffolds Average Seq Length
405 263 810 219

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10011774|Ga0105243_100117747
Length 234
Sequence LREEAMLMSDRVLGADRMRILVVDNYDSFVYNLVQYLAQLGAEVIVRRNDAVSPADLAELNVDGVLISPGPGIPQEAGQSMPLVTACATTGLPLFGVCLGHQAIGAVFGAPIIRAPELLHGKTSEIVHDGSGVLAGLPSPFTATRYHSLAVDEAALPEEIIVTGRSRSGVVMALRHRTLPIDGVQFHPESVLTHGGHRMVANWLVRCGGTVDDGRVDQLSDGVDALRSTAFADV

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
258 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
259 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
260 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
261 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
262 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
263 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0.74
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.86
Rhizosphere 85.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10011774 3300009148 Bacteria 6614
2 JGI24735J21928_10061637 3300002067 Bacteria 1077
3 Ga0070658_10008321 3300005327 Bacteria 8343
4 Ga0070683_100042339 3300005329 Bacteria 4193
5 Ga0070683_100250731 3300005329 Bacteria 1684
6 Ga0070666_10039929 3300005335 Bacteria 3130
7 Ga0070680_100337748 3300005336 Bacteria 1280
8 Ga0070660_100331259 3300005339 Bacteria 1252
9 Ga0070660_100370320 3300005339 Bacteria 1182
10 Ga0070691_10017217 3300005341 Bacteria 3326
11 Ga0070687_100083641 3300005343 Bacteria 1748
12 Ga0070661_100077177 3300005344 Bacteria 2455
13 Ga0070692_10165318 3300005345 Bacteria 1271
14 Ga0070668_100008403 3300005347 Bacteria 7667
15 Ga0070668_100091149 3300005347 Bacteria 2402
16 Ga0070668_100292474 3300005347 Bacteria 1364
17 Ga0070669_100094115 3300005353 Bacteria 2251
18 Ga0070671_100003629 3300005355 Bacteria 12080
19 Ga0070671_100023232 3300005355 Bacteria 5072
20 Ga0070674_100020747 3300005356 Bacteria 4206
21 Ga0070674_100078494 3300005356 Bacteria 2353
22 Ga0070674_100523668 3300005356 Bacteria 991
23 Ga0070673_100011592 3300005364 Bacteria 6022
24 Ga0070659_100051580 3300005366 Bacteria 3235
25 Ga0070667_100030646 3300005367 Bacteria 4486
26 Ga0070703_10020144 3300005406 Bacteria 1939
27 Ga0070709_10158299 3300005434 Bacteria 1572
28 Ga0070714_100035809 3300005435 Bacteria 4160
29 Ga0070713_100036855 3300005436 Bacteria 3950
30 Ga0070711_100024827 3300005439 Bacteria 3915
31 Ga0070700_100000015 3300005441 Bacteria 149873
32 Ga0070700_100796686 3300005441 Bacteria 760
33 Ga0070694_100037738 3300005444 Bacteria 3205
34 Ga0070663_100008145 3300005455 Bacteria 6429
35 Ga0070678_100208413 3300005456 Bacteria 1618
36 Ga0070662_100011104 3300005457 Bacteria 5930
37 Ga0070681_10195468 3300005458 Bacteria 1942
38 Ga0070679_100092386 3300005530 Bacteria 3014
39 Ga0070679_100159786 3300005530 Bacteria 2228
40 Ga0070672_100054188 3300005543 Bacteria 3139
41 Ga0070695_100005806 3300005545 Bacteria 7274
42 Ga0070696_100010816 3300005546 Bacteria 6115
43 Ga0070693_100003357 3300005547 Bacteria 7444
44 Ga0070665_100002075 3300005548 Bacteria 22481
45 Ga0070665_100062705 3300005548 Bacteria 3727
46 Ga0070704_100031657 3300005549 Bacteria 3560
47 Ga0068855_100005745 3300005563 Bacteria 15151
48 Ga0070664_100184742 3300005564 Bacteria 1855
49 Ga0068854_100024394 3300005578 Bacteria 4141
50 Ga0068856_100006479 3300005614 Bacteria 11478
51 Ga0068856_100041921 3300005614 Bacteria 4500
52 Ga0070702_100025554 3300005615 Bacteria 3166
53 Ga0068852_100181012 3300005616 Bacteria 1982
54 Ga0068859_100115794 3300005617 Bacteria 2745
55 Ga0068864_100167833 3300005618 Bacteria 1999
56 Ga0068866_10030764 3300005718 Bacteria 2580
57 Ga0068861_100006598 3300005719 Bacteria 7918
58 Ga0068851_10068324 3300005834 Bacteria 1834
59 Ga0068863_100032501 3300005841 Bacteria 4974
60 Ga0068863_100080880 3300005841 Bacteria 3078
61 Ga0068858_100111211 3300005842 Bacteria 2558
62 Ga0068860_100000465 3300005843 Bacteria 50703
63 Ga0068860_100608542 3300005843 Bacteria 1098
64 Ga0068862_100071761 3300005844 Bacteria 2990
65 Ga0081455_10121978 3300005937 Bacteria 2052
66 Ga0081540_1070359 3300005983 Bacteria 1621
67 Ga0070717_10152637 3300006028 Bacteria 1999
68 Ga0075432_10060260 3300006058 Bacteria 1350
69 Ga0070715_10037571 3300006163 Bacteria 2005
70 Ga0097621_100205661 3300006237 Bacteria 1710
71 Ga0068871_100340818 3300006358 Bacteria 1324
72 Ga0075433_10110810 3300006852 Bacteria 2435
73 Ga0075434_100012019 3300006871 Bacteria 8191
74 Ga0068865_100004755 3300006881 Bacteria 8208
75 Ga0075436_100293816 3300006914 Bacteria 1163
76 Ga0097620_100115792 3300006931 Bacteria 2745
77 Ga0075435_100019907 3300007076 Bacteria 5131
78 Ga0105250_10167539 3300009092 Bacteria 919
79 Ga0105240_10023497 3300009093 Bacteria 8149
80 Ga0105240_10056745 3300009093 Bacteria 4898
81 Ga0105240_10198666 3300009093 Bacteria 2352
82 Ga0105240_10707541 3300009093 Bacteria 1099
83 Ga0111539_10262756 3300009094 Bacteria 2009
84 Ga0105245_10009193 3300009098 Bacteria 8617
85 Ga0105245_10278283 3300009098 Bacteria 1635
86 Ga0105245_10287515 3300009098 Bacteria 1609
87 Ga0105245_10301241 3300009098 Bacteria 1573
88 Ga0105245_10384824 3300009098 Bacteria 1398
89 Ga0105247_10015978 3300009101 Bacteria 4497
90 Ga0105243_10152480 3300009148 Bacteria 1984
91 Ga0105243_10264599 3300009148 Bacteria 1541
92 Ga0105243_10597317 3300009148 Bacteria 1062
93 Ga0105241_10539450 3300009174 Bacteria 1046
94 Ga0105241_10923281 3300009174 Bacteria 812
95 Ga0105242_10064711 3300009176 Bacteria 3015
96 Ga0105242_10174299 3300009176 Bacteria 1892
97 Ga0105248_10033243 3300009177 Bacteria 5760
98 Ga0105237_10025003 3300009545 Bacteria 6109
99 Ga0105237_10037555 3300009545 Bacteria 4894
100 Ga0105238_10142896 3300009551 Bacteria 2370
101 Ga0105238_10874654 3300009551 Bacteria 916
102 Ga0105249_10003157 3300009553 Bacteria 14255
103 Ga0105249_10195830 3300009553 Bacteria 1975
104 Ga0105239_10017809 3300010375 Bacteria 7860
105 Ga0105239_10040208 3300010375 Bacteria 5124
106 Ga0105239_10584687 3300010375 Bacteria 1273
107 Ga0105246_10389186 3300011119 Bacteria 1154
108 Ga0157371_10023891 3300013102 Bacteria 4467
109 Ga0157370_10034574 3300013104 Bacteria 4918
110 Ga0157370_10210206 3300013104 Bacteria 1803
111 Ga0157370_10814762 3300013104 Bacteria 849
112 Ga0157370_10946245 3300013104 Bacteria 781
113 Ga0157369_10004700 3300013105 Bacteria 16052
114 Ga0157369_10017125 3300013105 Bacteria 8143
115 Ga0157369_10171586 3300013105 Bacteria 2285
116 Ga0157374_10016799 3300013296 Bacteria 6440
117 Ga0157374_10214998 3300013296 Bacteria 1885
118 Ga0157374_10906463 3300013296 Bacteria 899
119 Ga0163162_10015180 3300013306 Bacteria 7523
120 Ga0163162_10302292 3300013306 Bacteria 1732
121 Ga0157372_10000004 3300013307 Bacteria 435659
122 Ga0157375_10006011 3300013308 Bacteria 10583
123 Ga0157375_10136393 3300013308 Bacteria 2578
124 Ga0157375_10336754 3300013308 Bacteria 1674
125 Ga0157375_11233977 3300013308 Bacteria 878
126 Ga0163163_10010070 3300014325 Bacteria 8481
127 Ga0163163_10169087 3300014325 Bacteria 2232
128 Ga0163163_10269279 3300014325 Bacteria 1754
129 Ga0157380_10222554 3300014326 Bacteria 1689
130 Ga0157380_10251403 3300014326 Bacteria 1600
131 Ga0157377_10103588 3300014745 Bacteria 1700
132 Ga0157379_10009583 3300014968 Bacteria 8434
133 Ga0157379_10037848 3300014968 Bacteria 4303
134 Ga0157376_10019319 3300014969 Bacteria 5249
135 Ga0157376_10443998 3300014969 Bacteria 1264
136 Ga0157376_10814143 3300014969 Bacteria 947
137 Ga0163161_10008848 3300017792 Bacteria 6962
138 Ga0163161_10010580 3300017792 Bacteria 6387
139 Ga0163161_10339976 3300017792 Bacteria 1191
140 Ga0197907_10126009 3300020069 Bacteria 899
141 Ga0197907_11383671 3300020069 Bacteria 2005
142 Ga0206353_10701103 3300020082 Bacteria 1177
143 Ga0207653_10012721 3300025885 Bacteria 2629
144 Ga0207642_10032952 3300025899 Bacteria 2187
145 Ga0207688_10005592 3300025901 Bacteria 6836
146 Ga0207688_10057718 3300025901 Bacteria 2183
147 Ga0207680_10025825 3300025903 Bacteria 3245
148 Ga0207647_10082624 3300025904 Bacteria 1924
149 Ga0207705_10006990 3300025909 Bacteria 8330
150 Ga0207705_10039228 3300025909 Bacteria 3393
151 Ga0207695_10133511 3300025913 Bacteria 2437
152 Ga0207671_10024070 3300025914 Bacteria 4583
153 Ga0207693_10000501 3300025915 Bacteria 35426
154 Ga0207662_10133220 3300025918 Bacteria 1568
155 Ga0207657_10288923 3300025919 Bacteria 1301
156 Ga0207657_10329690 3300025919 Bacteria 1206
157 Ga0207652_10113160 3300025921 Bacteria 2409
158 Ga0207652_10248605 3300025921 Bacteria 1604
159 Ga0207681_10323575 3300025923 Bacteria 1227
160 Ga0207694_10031345 3300025924 Bacteria 4061
161 Ga0207664_10046279 3300025929 Bacteria 3414
162 Ga0207664_10302922 3300025929 Bacteria 1406
163 Ga0207644_10009971 3300025931 Bacteria 6253
164 Ga0207644_10022132 3300025931 Bacteria 4340
165 Ga0207690_10244567 3300025932 Bacteria 1383
166 Ga0207690_10400128 3300025932 Bacteria 1095
167 Ga0207706_10015702 3300025933 Bacteria 6846
168 Ga0207686_10013741 3300025934 Bacteria 4489
169 Ga0207686_10122841 3300025934 Bacteria 1770
170 Ga0207669_10024317 3300025937 Bacteria 3254
171 Ga0207669_10098243 3300025937 Bacteria 1928
172 Ga0207665_10002286 3300025939 Bacteria 12935
173 Ga0207691_10028692 3300025940 Bacteria 5208
174 Ga0207711_10086563 3300025941 Bacteria 2747
175 Ga0207661_10040154 3300025944 Bacteria 3677
176 Ga0207661_10706816 3300025944 Bacteria 927
177 Ga0207679_10766633 3300025945 Bacteria 878
178 Ga0207667_10288224 3300025949 Bacteria 1678
179 Ga0207667_10434174 3300025949 Bacteria 1336
180 Ga0207712_10016245 3300025961 Bacteria 4816
181 Ga0207712_10128243 3300025961 Bacteria 1929
182 Ga0207668_10004062 3300025972 Bacteria 8609
183 Ga0207668_10343420 3300025972 Bacteria 1246
184 Ga0207640_10031412 3300025981 Bacteria 3281
185 Ga0207640_10455470 3300025981 Bacteria 1055
186 Ga0207658_10367368 3300025986 Bacteria 1257
187 Ga0207677_10024317 3300026023 Bacteria 3761
188 Ga0207677_10108193 3300026023 Bacteria 2064
189 Ga0207677_10610797 3300026023 Bacteria 958
190 Ga0207703_10010307 3300026035 Bacteria 7318
191 Ga0207703_10332148 3300026035 Bacteria 1395
192 Ga0207639_10167514 3300026041 Bacteria 1857
193 Ga0207678_10004095 3300026067 Bacteria 13113
194 Ga0207678_10071587 3300026067 Bacteria 2973
195 Ga0207678_10119119 3300026067 Bacteria 2253
196 Ga0207678_10312908 3300026067 Bacteria 1350
197 Ga0207678_10592839 3300026067 Bacteria 971
198 Ga0207708_10000004 3300026075 Bacteria 293087
199 Ga0207702_10186447 3300026078 Bacteria 1914
200 Ga0207641_10035914 3300026088 Bacteria 4133
201 Ga0207676_10075045 3300026095 Bacteria 2726
202 Ga0207674_10168384 3300026116 Bacteria 2145
203 Ga0207675_100010248 3300026118 Bacteria 8781
204 Ga0207675_100318469 3300026118 Bacteria 1518
205 Ga0207683_10008665 3300026121 Bacteria 8698
206 Ga0207683_10267598 3300026121 Bacteria 1561
207 Ga0207698_10164820 3300026142 Bacteria 1943
208 Ga0207428_10152855 3300027907 Bacteria 1756
209 Ga0268266_10001486 3300028379 Bacteria 27812
210 Ga0268266_10002963 3300028379 Bacteria 17509
211 Ga0268265_10054671 3300028380 Bacteria 3031
212 Ga0268265_10249962 3300028380 Bacteria 1570
213 Ga0268264_10000138 3300028381 Bacteria 172597
214 Ga0265318_10069307 3300028577 Bacteria 1308
215 Ga0265338_10076165 3300028800 Bacteria 2843
216 Ga0265330_10093882 3300031235 Bacteria 1287
217 Ga0265332_10028776 3300031238 Bacteria 2430
218 Ga0265320_10003358 3300031240 Bacteria 10794
219 Ga0265325_10014392 3300031241 Bacteria 4473
220 Ga0265329_10025269 3300031242 Bacteria 1967
221 Ga0265340_10003883 3300031247 Bacteria 8420
222 Ga0265340_10024701 3300031247 Bacteria 3050
223 Ga0265331_10036903 3300031250 Bacteria 2396
224 Ga0265316_10418592 3300031344 Bacteria 963
225 Ga0307408_100017024 3300031548 Bacteria 4861
226 Ga0316575_10230809 3300031665 Bacteria 774
227 Ga0316579_10001314 3300031691 Bacteria 8976
228 Ga0265342_10024094 3300031712 Bacteria 3845
229 Ga0265342_10096097 3300031712 Bacteria 1693
230 Ga0316576_10002082 3300031727 Bacteria 11246
231 Ga0316578_10001061 3300031728 Bacteria 10619
232 Ga0316578_10135906 3300031728 Bacteria 1480
233 Ga0316577_10001456 3300031733 Bacteria 11199
234 Ga0307407_10052640 3300031903 Bacteria 2339
235 Ga0307409_100001005 3300031995 Bacteria 13210
236 Ga0307416_100026158 3300032002 Bacteria 4294
237 Ga0316580_10019230 3300032139 Bacteria 2102
238 Ga0373930_0013199 3300034816 Bacteria 1519
239 Ga0373938_0023650 3300034957 Bacteria 1265
240 Ga0373929_0010669 3300035085 Bacteria 1721
241 Ga0373940_0069725 3300035088 Bacteria 1021
242 Ga0373949_0017416 3300035090 Bacteria 1620
243 Ga0373932_0068251 3300035112 Bacteria 1096
244 Ga0373941_0011174 3300035115 Bacteria 2313
245 Ga0373956_0000851 3300035119 Bacteria 12703
246 Ga0373960_0028880 3300035121 Bacteria 1533
247 Ga0316574_0003162 3300035398 Bacteria 8429
248 Ga0373931_0016477 3300035691 Bacteria 3638
249 Ga0373931_0159655 3300035691 Bacteria 1321
250 Ga0373937_0006713 3300036401 Bacteria 9927
251 Ga0316584_0080052 3300036712 Bacteria 2448
252 Ga0373925_0197679 3300037068 Bacteria 1598
253 Ga0395900_0466360 3300037418 Bacteria 1217
254 Ga0395901_0109697 3300038443 Bacteria 2897
255 Ga0436365_0074895 3300039437 Bacteria 1173
256 Ga0451853_2986595 3300041512 Bacteria 1678
257 Ga0439462_0049036 3300042015 Bacteria 1133
258 Ga0450909_036159 3300042185 Bacteria 755
259 Ga0466969_0120306 3300044656 Bacteria 1223
260 Ga0466972_0021733 3300044658 Bacteria 3197
261 Ga0466961_0011669 3300044693 Bacteria 5616
262 Ga0466961_0023114 3300044693 Bacteria 3997
263 Ga0466961_0047459 3300044693 Bacteria 2746
264 Ga0466961_0062383 3300044693 Bacteria 2369
265 Ga0466963_0003475 3300044694 Bacteria 9034
266 Ga0466963_0048793 3300044694 Bacteria 2799
267 Ga0466963_0197956 3300044694 Bacteria 1405
268 Ga0466971_0234057 3300044719 Bacteria 873
269 Ga0466970_0006735 3300044765 Bacteria 5751
270 Ga0466970_0137238 3300044765 Bacteria 1346
271 Ga0466957_0032800 3300044842 Bacteria 3112
272 Ga0466957_0180406 3300044842 Bacteria 1379
273 Ga0466960_0001769 3300044901 Bacteria 7925
274 Ga0466960_0067699 3300044901 Bacteria 1769
275 Ga0466959_0012001 3300045049 Bacteria 6250
276 Ga0466958_0003575 3300045836 Bacteria 8096
277 Ga0466958_0005612 3300045836 Bacteria 6768
278 Ga0466967_0003498 3300045976 Bacteria 10264
279 Ga0466967_0044495 3300045976 Bacteria 3852
280 Ga0466967_0192972 3300045976 Bacteria 1926
281 Ga0466967_0245118 3300045976 Bacteria 1710
282 Ga0466967_0474195 3300045976 Bacteria 1225
283 Ga0466967_0579357 3300045976 Bacteria 1106
284 Ga0495603_0169977 3300046455 Bacteria 1263
285 Ga0495580_0312966 3300046472 Bacteria 1068
286 Ga0495665_0321599 3300046531 Bacteria 790
287 Ga0495668_0219651 3300046616 Bacteria 1041
288 Ga0495658_0294971 3300046683 Bacteria 1025
289 Ga0495600_0424268 3300046809 Bacteria 825
290 Ga0495672_0156421 3300047320 Bacteria 1177
291 Ga0495680_0092500 3300047322 Bacteria 2265
292 Ga0496100_0231249 3300048903 Bacteria 1360
293 Ga0496100_0239787 3300048903 Bacteria 1337
294 Ga0496100_0338605 3300048903 Bacteria 1134
295 Ga0496101_0159191 3300048904 Bacteria 1731
296 Ga0496101_0211459 3300048904 Bacteria 1503
297 Ga0496101_0372538 3300048904 Bacteria 1123
298 Ga0496102_0006944 3300048905 Bacteria 9658
299 Ga0496102_0211426 3300048905 Bacteria 1828
300 Ga0496102_0290281 3300048905 Bacteria 1542
301 Ga0496102_0564862 3300048905 Bacteria 1060
302 Ga0496103_0006042 3300048906 Bacteria 7235
303 Ga0496104_0003915 3300048907 Bacteria 12894
304 Ga0496104_0018528 3300048907 Bacteria 6352
305 Ga0496104_0133141 3300048907 Bacteria 2388
306 Ga0496104_0290269 3300048907 Bacteria 1548
307 Ga0496104_0481959 3300048907 Bacteria 1152
308 Ga0496104_0652507 3300048907 Bacteria 961
309 Ga0496105_0027798 3300048908 Bacteria 4623
310 Ga0496105_0043195 3300048908 Bacteria 3717
311 Ga0496105_0084295 3300048908 Bacteria 2625
312 Ga0496105_0117666 3300048908 Bacteria 2192
313 Ga0496106_0130690 3300048909 Bacteria 1969
314 Ga0496107_0063658 3300048910 Bacteria 2673
315 Ga0496107_0336339 3300048910 Bacteria 1123
316 Ga0496108_0020179 3300048911 Bacteria 5476
317 Ga0496108_0031301 3300048911 Bacteria 4414
318 Ga0496108_0043456 3300048911 Bacteria 3753
319 Ga0496108_0083599 3300048911 Bacteria 2708
320 Ga0496108_0143568 3300048911 Bacteria 2057
321 Ga0496109_0015203 3300048912 Bacteria 6700
322 Ga0496109_0047036 3300048912 Bacteria 3921
323 Ga0496109_0216607 3300048912 Bacteria 1800
324 Ga0496109_0608239 3300048912 Bacteria 1029
325 Ga0496110_0193342 3300048913 Bacteria 1847
326 Ga0496110_0479122 3300048913 Bacteria 1133
327 Ga0496112_0011097 3300048915 Bacteria 8210
328 Ga0496112_0013176 3300048915 Bacteria 7630
329 Ga0496112_0242179 3300048915 Bacteria 1756
330 Ga0496113_0084047 3300048916 Bacteria 2443
331 Ga0496113_0400224 3300048916 Bacteria 1102
332 Ga0496114_0005246 3300048917 Bacteria 10130
333 Ga0496114_0067030 3300048917 Bacteria 3010
334 Ga0496114_1366111 3300048917 Bacteria 596
335 Ga0496115_0018205 3300048918 Bacteria 5388
336 Ga0496117_0007974 3300048920 Bacteria 10170
337 Ga0496118_0055424 3300048921 Bacteria 2992
338 Ga0496118_0337708 3300048921 Bacteria 809
339 Ga0496121_0027311 3300048924 Bacteria 5343
340 Ga0496122_0049334 3300048925 Bacteria 3225
341 Ga0496123_0026663 3300048926 Bacteria 4323
342 Ga0496124_0027464 3300048927 Bacteria 5108
343 Ga0496126_0000003 3300048929 Bacteria 961576
344 Ga0501031_0002328 3300049568 Bacteria 12028
345 Ga0501031_0121079 3300049568 Bacteria 1709
346 Ga0501032_0021101 3300049569 Bacteria 4530
347 Ga0501032_0093224 3300049569 Bacteria 1997
348 Ga0501033_0010968 3300049570 Bacteria 6944
349 Ga0501033_0066969 3300049570 Bacteria 2641
350 Ga0501034_0126565 3300049571 Bacteria 2540
351 Ga0501036_0000492 3300049572 Bacteria 28207
352 Ga0501036_0065546 3300049572 Bacteria 3074
353 Ga0501037_0237793 3300049573 Bacteria 1277
354 Ga0501038_0008223 3300049574 Bacteria 9601
355 Ga0501038_0023581 3300049574 Bacteria 5499
356 Ga0501039_0053527 3300049575 Bacteria 3123
357 Ga0501039_0755909 3300049575 Bacteria 759
358 Ga0501039_1010448 3300049575 Bacteria 646
359 Ga0501040_0004834 3300049576 Bacteria 8730
360 Ga0501040_0281591 3300049576 Bacteria 1188
361 Ga0501041_0001354 3300049577 Bacteria 13499
362 Ga0501042_0042165 3300049578 Bacteria 3247
363 Ga0501042_1029861 3300049578 Bacteria 600
364 Ga0501043_0010084 3300049579 Bacteria 7408
365 Ga0501043_0025919 3300049579 Bacteria 4600
366 Ga0501046_0003757 3300049580 Bacteria 13904
367 Ga0501046_0070040 3300049580 Bacteria 2728
368 Ga0501047_0000076 3300049581 Bacteria 124949
369 Ga0501048_0000435 3300049582 Bacteria 29287
370 Ga0501048_0000946 3300049582 Bacteria 21465
371 Ga0501069_0190600 3300049585 Bacteria 1186
372 Ga0501070_0097434 3300049586 Bacteria 2433
373 Ga0501070_0137026 3300049586 Bacteria 2021
374 Ga0501070_0209109 3300049586 Bacteria 1602
375 Ga0501071_0001298 3300049587 Bacteria 14234
376 Ga0501072_0006954 3300049588 Bacteria 8590
377 Ga0501072_0618312 3300049588 Bacteria 854
378 Ga0501073_0136766 3300049589 Bacteria 1698
379 Ga0501074_0199697 3300049590 Bacteria 1425
380 Ga0501075_0000808 3300049591 Bacteria 19593
381 Ga0501076_0002452 3300049592 Bacteria 12733
382 Ga0501079_0408324 3300049741 Bacteria 1065
383 Ga0501080_0069877 3300049742 Bacteria 3266
384 Ga0501081_0002240 3300049743 Bacteria 12155
385 Ga0501035_0064743 3300049822 Bacteria 3248
386 Ga0501035_0219132 3300049822 Bacteria 1625
387 Ga0501035_0287296 3300049822 Bacteria 1389
388 Ga0501044_0101226 3300049823 Bacteria 2899
389 Ga0501045_0080766 3300049824 Bacteria 2397
390 Ga0501045_0348895 3300049824 Bacteria 1102
391 nmdc:mga0rr50_17868_c1 3300050513 Bacteria 4749
392 nmdc:mga0a205_13908_c1 3300050515 Bacteria 7503
393 Ga0495619_0119679 3300053085 Bacteria 1805
394 Ga0501084_0006063 3300054114 Bacteria 9944
395 Ga0501082_0004397 3300060353 Bacteria 12304
396 Ga0466962_0038259 3300061719 Bacteria 2297
397 Ga0466962_0051427 3300061719 Bacteria 1970
398 Ga0530510_0002474 3300061734 Bacteria 12698
399 2799183289 2799112218 Bacteria 4315149
400 2808872296 2808606365 Bacteria 4301966
401 2837271927 2837268691 Bacteria 7850704
402 2868089884 2868088558 Bacteria 7609351
403 2915360191 2915358134 Bacteria 6050864
404 2917744901 2917736166 Bacteria 9690793
405 8054477812 8054472261 Bacteria 7464355
406 Ga0105243_10011774
407 JGI24735J21928_10061637
408 Ga0070658_10008321
409 Ga0070683_100042339
410 Ga0070683_100250731
411 Ga0070666_10039929
412 Ga0070680_100337748
413 Ga0070660_100331259
414 Ga0070660_100370320
415 Ga0070691_10017217
416 Ga0070687_100083641
417 Ga0070661_100077177
418 Ga0070692_10165318
419 Ga0070668_100008403
420 Ga0070668_100091149
421 Ga0070668_100292474
422 Ga0070669_100094115
423 Ga0070671_100003629
424 Ga0070671_100023232
425 Ga0070674_100020747
426 Ga0070674_100078494
427 Ga0070674_100523668
428 Ga0070673_100011592
429 Ga0070659_100051580
430 Ga0070667_100030646
431 Ga0070703_10020144
432 Ga0070709_10158299
433 Ga0070714_100035809
434 Ga0070713_100036855
435 Ga0070711_100024827
436 Ga0070700_100000015
437 Ga0070700_100796686
438 Ga0070694_100037738
439 Ga0070663_100008145
440 Ga0070678_100208413
441 Ga0070662_100011104
442 Ga0070681_10195468
443 Ga0070679_100092386
444 Ga0070679_100159786
445 Ga0070672_100054188
446 Ga0070695_100005806
447 Ga0070696_100010816
448 Ga0070693_100003357
449 Ga0070665_100002075
450 Ga0070665_100062705
451 Ga0070704_100031657
452 Ga0068855_100005745
453 Ga0070664_100184742
454 Ga0068854_100024394
455 Ga0068856_100006479
456 Ga0068856_100041921
457 Ga0070702_100025554
458 Ga0068852_100181012
459 Ga0068859_100115794
460 Ga0068864_100167833
461 Ga0068866_10030764
462 Ga0068861_100006598
463 Ga0068851_10068324
464 Ga0068863_100032501
465 Ga0068863_100080880
466 Ga0068858_100111211
467 Ga0068860_100000465
468 Ga0068860_100608542
469 Ga0068862_100071761
470 Ga0081455_10121978
471 Ga0081540_1070359
472 Ga0070717_10152637
473 Ga0075432_10060260
474 Ga0070715_10037571
475 Ga0097621_100205661
476 Ga0068871_100340818
477 Ga0075433_10110810
478 Ga0075434_100012019
479 Ga0068865_100004755
480 Ga0075436_100293816
481 Ga0097620_100115792
482 Ga0075435_100019907
483 Ga0105250_10167539
484 Ga0105240_10023497
485 Ga0105240_10056745
486 Ga0105240_10198666
487 Ga0105240_10707541
488 Ga0111539_10262756
489 Ga0105245_10009193
490 Ga0105245_10278283
491 Ga0105245_10287515
492 Ga0105245_10301241
493 Ga0105245_10384824
494 Ga0105247_10015978
495 Ga0105243_10152480
496 Ga0105243_10264599
497 Ga0105243_10597317
498 Ga0105241_10539450
499 Ga0105241_10923281
500 Ga0105242_10064711
501 Ga0105242_10174299
502 Ga0105248_10033243
503 Ga0105237_10025003
504 Ga0105237_10037555
505 Ga0105238_10142896
506 Ga0105238_10874654
507 Ga0105249_10003157
508 Ga0105249_10195830
509 Ga0105239_10017809
510 Ga0105239_10040208
511 Ga0105239_10584687
512 Ga0105246_10389186
513 Ga0157371_10023891
514 Ga0157370_10034574
515 Ga0157370_10210206
516 Ga0157370_10814762
517 Ga0157370_10946245
518 Ga0157369_10004700
519 Ga0157369_10017125
520 Ga0157369_10171586
521 Ga0157374_10016799
522 Ga0157374_10214998
523 Ga0157374_10906463
524 Ga0163162_10015180
525 Ga0163162_10302292
526 Ga0157372_10000004
527 Ga0157375_10006011
528 Ga0157375_10136393
529 Ga0157375_10336754
530 Ga0157375_11233977
531 Ga0163163_10010070
532 Ga0163163_10169087
533 Ga0163163_10269279
534 Ga0157380_10222554
535 Ga0157380_10251403
536 Ga0157377_10103588
537 Ga0157379_10009583
538 Ga0157379_10037848
539 Ga0157376_10019319
540 Ga0157376_10443998
541 Ga0157376_10814143
542 Ga0163161_10008848
543 Ga0163161_10010580
544 Ga0163161_10339976
545 Ga0197907_10126009
546 Ga0197907_11383671
547 Ga0206353_10701103
548 Ga0207653_10012721
549 Ga0207642_10032952
550 Ga0207688_10005592
551 Ga0207688_10057718
552 Ga0207680_10025825
553 Ga0207647_10082624
554 Ga0207705_10006990
555 Ga0207705_10039228
556 Ga0207695_10133511
557 Ga0207671_10024070
558 Ga0207693_10000501
559 Ga0207662_10133220
560 Ga0207657_10288923
561 Ga0207657_10329690
562 Ga0207652_10113160
563 Ga0207652_10248605
564 Ga0207681_10323575
565 Ga0207694_10031345
566 Ga0207664_10046279
567 Ga0207664_10302922
568 Ga0207644_10009971
569 Ga0207644_10022132
570 Ga0207690_10244567
571 Ga0207690_10400128
572 Ga0207706_10015702
573 Ga0207686_10013741
574 Ga0207686_10122841
575 Ga0207669_10024317
576 Ga0207669_10098243
577 Ga0207665_10002286
578 Ga0207691_10028692
579 Ga0207711_10086563
580 Ga0207661_10040154
581 Ga0207661_10706816
582 Ga0207679_10766633
583 Ga0207667_10288224
584 Ga0207667_10434174
585 Ga0207712_10016245
586 Ga0207712_10128243
587 Ga0207668_10004062
588 Ga0207668_10343420
589 Ga0207640_10031412
590 Ga0207640_10455470
591 Ga0207658_10367368
592 Ga0207677_10024317
593 Ga0207677_10108193
594 Ga0207677_10610797
595 Ga0207703_10010307
596 Ga0207703_10332148
597 Ga0207639_10167514
598 Ga0207678_10004095
599 Ga0207678_10071587
600 Ga0207678_10119119
601 Ga0207678_10312908
602 Ga0207678_10592839
603 Ga0207708_10000004
604 Ga0207702_10186447
605 Ga0207641_10035914
606 Ga0207676_10075045
607 Ga0207674_10168384
608 Ga0207675_100010248
609 Ga0207675_100318469
610 Ga0207683_10008665
611 Ga0207683_10267598
612 Ga0207698_10164820
613 Ga0207428_10152855
614 Ga0268266_10001486
615 Ga0268266_10002963
616 Ga0268265_10054671
617 Ga0268265_10249962
618 Ga0268264_10000138
619 Ga0265318_10069307
620 Ga0265338_10076165
621 Ga0265330_10093882
622 Ga0265332_10028776
623 Ga0265320_10003358
624 Ga0265325_10014392
625 Ga0265329_10025269
626 Ga0265340_10003883
627 Ga0265340_10024701
628 Ga0265331_10036903
629 Ga0265316_10418592
630 Ga0307408_100017024
631 Ga0316575_10230809
632 Ga0316579_10001314
633 Ga0265342_10024094
634 Ga0265342_10096097
635 Ga0316576_10002082
636 Ga0316578_10001061
637 Ga0316578_10135906
638 Ga0316577_10001456
639 Ga0307407_10052640
640 Ga0307409_100001005
641 Ga0307416_100026158
642 Ga0316580_10019230
643 Ga0373930_0013199
644 Ga0373938_0023650
645 Ga0373929_0010669
646 Ga0373940_0069725
647 Ga0373949_0017416
648 Ga0373932_0068251
649 Ga0373941_0011174
650 Ga0373956_0000851
651 Ga0373960_0028880
652 Ga0316574_0003162
653 Ga0373931_0016477
654 Ga0373931_0159655
655 Ga0373937_0006713
656 Ga0316584_0080052
657 Ga0373925_0197679
658 Ga0395900_0466360
659 Ga0395901_0109697
660 Ga0436365_0074895
661 Ga0451853_2986595
662 Ga0439462_0049036
663 Ga0450909_036159
664 Ga0466969_0120306
665 Ga0466972_0021733
666 Ga0466961_0011669
667 Ga0466961_0023114
668 Ga0466961_0047459
669 Ga0466961_0062383
670 Ga0466963_0003475
671 Ga0466963_0048793
672 Ga0466963_0197956
673 Ga0466971_0234057
674 Ga0466970_0006735
675 Ga0466970_0137238
676 Ga0466957_0032800
677 Ga0466957_0180406
678 Ga0466960_0001769
679 Ga0466960_0067699
680 Ga0466959_0012001
681 Ga0466958_0003575
682 Ga0466958_0005612
683 Ga0466967_0003498
684 Ga0466967_0044495
685 Ga0466967_0192972
686 Ga0466967_0245118
687 Ga0466967_0474195
688 Ga0466967_0579357
689 Ga0495603_0169977
690 Ga0495580_0312966
691 Ga0495665_0321599
692 Ga0495668_0219651
693 Ga0495658_0294971
694 Ga0495600_0424268
695 Ga0495672_0156421
696 Ga0495680_0092500
697 Ga0496100_0231249
698 Ga0496100_0239787
699 Ga0496100_0338605
700 Ga0496101_0159191
701 Ga0496101_0211459
702 Ga0496101_0372538
703 Ga0496102_0006944
704 Ga0496102_0211426
705 Ga0496102_0290281
706 Ga0496102_0564862
707 Ga0496103_0006042
708 Ga0496104_0003915
709 Ga0496104_0018528
710 Ga0496104_0133141
711 Ga0496104_0290269
712 Ga0496104_0481959
713 Ga0496104_0652507
714 Ga0496105_0027798
715 Ga0496105_0043195
716 Ga0496105_0084295
717 Ga0496105_0117666
718 Ga0496106_0130690
719 Ga0496107_0063658
720 Ga0496107_0336339
721 Ga0496108_0020179
722 Ga0496108_0031301
723 Ga0496108_0043456
724 Ga0496108_0083599
725 Ga0496108_0143568
726 Ga0496109_0015203
727 Ga0496109_0047036
728 Ga0496109_0216607
729 Ga0496109_0608239
730 Ga0496110_0193342
731 Ga0496110_0479122
732 Ga0496112_0011097
733 Ga0496112_0013176
734 Ga0496112_0242179
735 Ga0496113_0084047
736 Ga0496113_0400224
737 Ga0496114_0005246
738 Ga0496114_0067030
739 Ga0496114_1366111
740 Ga0496115_0018205
741 Ga0496117_0007974
742 Ga0496118_0055424
743 Ga0496118_0337708
744 Ga0496121_0027311
745 Ga0496122_0049334
746 Ga0496123_0026663
747 Ga0496124_0027464
748 Ga0496126_0000003
749 Ga0501031_0002328
750 Ga0501031_0121079
751 Ga0501032_0021101
752 Ga0501032_0093224
753 Ga0501033_0010968
754 Ga0501033_0066969
755 Ga0501034_0126565
756 Ga0501036_0000492
757 Ga0501036_0065546
758 Ga0501037_0237793
759 Ga0501038_0008223
760 Ga0501038_0023581
761 Ga0501039_0053527
762 Ga0501039_0755909
763 Ga0501039_1010448
764 Ga0501040_0004834
765 Ga0501040_0281591
766 Ga0501041_0001354
767 Ga0501042_0042165
768 Ga0501042_1029861
769 Ga0501043_0010084
770 Ga0501043_0025919
771 Ga0501046_0003757
772 Ga0501046_0070040
773 Ga0501047_0000076
774 Ga0501048_0000435
775 Ga0501048_0000946
776 Ga0501069_0190600
777 Ga0501070_0097434
778 Ga0501070_0137026
779 Ga0501070_0209109
780 Ga0501071_0001298
781 Ga0501072_0006954
782 Ga0501072_0618312
783 Ga0501073_0136766
784 Ga0501074_0199697
785 Ga0501075_0000808
786 Ga0501076_0002452
787 Ga0501079_0408324
788 Ga0501080_0069877
789 Ga0501081_0002240
790 Ga0501035_0064743
791 Ga0501035_0219132
792 Ga0501035_0287296
793 Ga0501044_0101226
794 Ga0501045_0080766
795 Ga0501045_0348895
796 nmdc:mga0rr50_17868_c1
797 nmdc:mga0a205_13908_c1
798 Ga0495619_0119679
799 Ga0501084_0006063
800 Ga0501082_0004397
801 Ga0466962_0038259
802 Ga0466962_0051427
803 Ga0530510_0002474
804 2799183289
805 2808872296
806 2837271927
807 2868089884
808 2915360191
809 2917744901
810 8054477812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

21

207

0.96

PF07722

Peptidase_C26

Peptidase C26

70

189

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9348 11 199
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9312 11 200
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9311 11 200
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9308 11 200
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9284 11 196
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9755 13 199 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9655 11 207 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9653 13 199 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9488 12 198 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9467 11 207 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6G3VSS2-F1-model_v4 deleted 0.9944 86 216
AF-A0A1M5HXY8-F1-model_v4 Anthranilate synthase, component II 0.9934 11 227 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2W6FG63-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9914 11 227 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A352SCK5-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9894 91 197 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0046654
GO:0046820
AF-A0A6L6EN53-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9864 91 200 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map