F435898

General Info

Members Datasets Scaffolds Average Seq Length
405 188 405 153

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_101453115|Ga0068856_1014531151
Length 177
Sequence LTSFRDSADVDAQARLDTFIDKYSPEVAGEARQALAFLNARLPGAFRLVYDNYNALVVGFGTSEKVGGIILSIALYPRYVTLFFLKGTSLPDPQGLLQGGGVTVRSVRLSPISRLETAEVAALIDAAVAQASPLSAGEGPLIIKSISAKQRSRRPKSERPRFFLCVSKSRTADSSSG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10068407 3300001990 Bacteria 1062
2 JGI24743J22301_10013624 3300001991 Bacteria 1491
3 JGI24743J22301_10037847 3300001991 Bacteria 962
4 Ga0065712_10000331 3300005290 Bacteria 19331
5 Ga0065712_10253958 3300005290 Bacteria 953
6 Ga0065715_10089542 3300005293 Bacteria 9611
7 Ga0070658_10000001 3300005327 Bacteria 856789
8 Ga0070658_10226606 3300005327 Bacteria 1582
9 Ga0070658_10442234 3300005327 Bacteria 1120
10 Ga0070658_10801950 3300005327 Bacteria 818
11 Ga0070658_11435698 3300005327 Unclassified 599
12 Ga0070676_10239676 3300005328 Bacteria 1206
13 Ga0070676_10316687 3300005328 Bacteria 1062
14 Ga0070676_10369936 3300005328 Bacteria 990
15 Ga0070683_100315947 3300005329 Bacteria 1486
16 Ga0070683_100925843 3300005329 Unclassified 836
17 Ga0070683_101465864 3300005329 Unclassified 656
18 Ga0070690_100433738 3300005330 Bacteria 971
19 Ga0070670_100003765 3300005331 Bacteria 12627
20 Ga0070670_100010136 3300005331 Bacteria 8038
21 Ga0070670_100284387 3300005331 Bacteria 1444
22 Ga0070670_100650587 3300005331 Bacteria 945
23 Ga0070677_10074184 3300005333 Bacteria 1439
24 Ga0070677_10260201 3300005333 Bacteria 865
25 Ga0068869_100176974 3300005334 Bacteria 1670
26 Ga0070666_10066550 3300005335 Bacteria 2445
27 Ga0070666_10220839 3300005335 Bacteria 1337
28 Ga0070666_10545803 3300005335 Bacteria 843
29 Ga0070666_10768118 3300005335 Bacteria 709
30 Ga0070680_100011939 3300005336 Bacteria 6739
31 Ga0070682_100493848 3300005337 Bacteria 947
32 Ga0068868_100052653 3300005338 Bacteria 3204
33 Ga0068868_100089457 3300005338 Bacteria 2479
34 Ga0068868_100117818 3300005338 Bacteria 2164
35 Ga0068868_100171634 3300005338 Bacteria 1795
36 Ga0070660_100000862 3300005339 Bacteria 20203
37 Ga0070660_100138459 3300005339 Bacteria 1951
38 Ga0070660_100545607 3300005339 Bacteria 967
39 Ga0070660_100759970 3300005339 Bacteria 814
40 Ga0070689_101338942 3300005340 Bacteria 646
41 Ga0070661_100021154 3300005344 Bacteria 4644
42 Ga0070661_100103001 3300005344 Bacteria 2125
43 Ga0070661_100279577 3300005344 Bacteria 1294
44 Ga0070661_101279004 3300005344 Bacteria 615
45 Ga0070668_100582903 3300005347 Bacteria 977
46 Ga0070669_100215193 3300005353 Bacteria 1517
47 Ga0070675_100009993 3300005354 Bacteria 7398
48 Ga0070675_100041218 3300005354 Bacteria 3771
49 Ga0070675_100103265 3300005354 Bacteria 2403
50 Ga0070675_100183790 3300005354 Bacteria 1809
51 Ga0070675_100188403 3300005354 Bacteria 1786
52 Ga0070675_100870699 3300005354 Bacteria 825
53 Ga0070675_101073283 3300005354 Bacteria 740
54 Ga0070671_100466503 3300005355 Bacteria 1084
55 Ga0070671_100800748 3300005355 Bacteria 820
56 Ga0070674_100018195 3300005356 Bacteria 4437
57 Ga0070673_100042723 3300005364 Bacteria 3497
58 Ga0070673_100062405 3300005364 Bacteria 2960
59 Ga0070673_100219901 3300005364 Bacteria 1643
60 Ga0070688_100012971 3300005365 Bacteria 4688
61 Ga0070659_100250993 3300005366 Bacteria 1466
62 Ga0070659_100361430 3300005366 Bacteria 1220
63 Ga0070659_100523589 3300005366 Bacteria 1012
64 Ga0070659_100525502 3300005366 Bacteria 1011
65 Ga0070667_100134595 3300005367 Bacteria 2160
66 Ga0070667_100301190 3300005367 Bacteria 1444
67 Ga0070667_100346673 3300005367 Bacteria 1344
68 Ga0070667_100470616 3300005367 Bacteria 1150
69 Ga0070667_100544179 3300005367 Bacteria 1067
70 Ga0070714_100340467 3300005435 Bacteria 1407
71 Ga0070663_100013864 3300005455 Bacteria 5156
72 Ga0070663_100091040 3300005455 Bacteria 2259
73 Ga0070663_100266775 3300005455 Bacteria 1360
74 Ga0070678_100002055 3300005456 Bacteria 10907
75 Ga0070678_100093936 3300005456 Bacteria 2307
76 Ga0070678_100146588 3300005456 Bacteria 1896
77 Ga0070678_100374284 3300005456 Bacteria 1231
78 Ga0070662_100099868 3300005457 Bacteria 2195
79 Ga0070662_100132189 3300005457 Bacteria 1925
80 Ga0070662_100236462 3300005457 Bacteria 1463
81 Ga0070681_11311053 3300005458 Bacteria 647
82 Ga0068867_100113370 3300005459 Bacteria 2086
83 Ga0068867_100151577 3300005459 Bacteria 1821
84 Ga0068867_100356677 3300005459 Bacteria 1222
85 Ga0070707_101276827 3300005468 Bacteria 700
86 Ga0070679_100259027 3300005530 Bacteria 1695
87 Ga0070684_100823562 3300005535 Bacteria 868
88 Ga0070684_101907189 3300005535 Unclassified 561
89 Ga0068853_100378492 3300005539 Bacteria 1322
90 Ga0070672_100003314 3300005543 Bacteria 10425
91 Ga0070672_100182219 3300005543 Bacteria 1750
92 Ga0070686_101524112 3300005544 Bacteria 564
93 Ga0070696_100279555 3300005546 Unclassified 1272
94 Ga0070693_100024008 3300005547 Bacteria 3265
95 Ga0070693_100054067 3300005547 Bacteria 2307
96 Ga0070693_100177824 3300005547 Bacteria 1368
97 Ga0070693_100259035 3300005547 Bacteria 1156
98 Ga0070665_100043533 3300005548 Bacteria 4512
99 Ga0070665_100214728 3300005548 Bacteria 1925
100 Ga0068855_100063522 3300005563 Bacteria 4309
101 Ga0068855_100421637 3300005563 Bacteria 1460
102 Ga0068855_101075374 3300005563 Unclassified 842
103 Ga0070664_100018503 3300005564 Bacteria 5725
104 Ga0070664_100128864 3300005564 Bacteria 2221
105 Ga0070664_100185568 3300005564 Bacteria 1851
106 Ga0070664_100955155 3300005564 Bacteria 805
107 Ga0068857_100324033 3300005577 Bacteria 1423
108 Ga0068854_100013859 3300005578 Bacteria 5302
109 Ga0068854_100034924 3300005578 Bacteria 3517
110 Ga0068854_100193591 3300005578 Bacteria 1594
111 Ga0068856_101453115 3300005614 Bacteria 700
112 Ga0070702_100160517 3300005615 Unclassified 1453
113 Ga0068852_100114262 3300005616 Bacteria 2460
114 Ga0068852_100734233 3300005616 Bacteria 999
115 Ga0068852_100791557 3300005616 Bacteria 962
116 Ga0068852_100821215 3300005616 Bacteria 944
117 Ga0068859_100237075 3300005617 Bacteria 1913
118 Ga0068864_100004905 3300005618 Bacteria 10962
119 Ga0068864_100022589 3300005618 Bacteria 5275
120 Ga0068864_100278514 3300005618 Bacteria 1560
121 Ga0068864_100279632 3300005618 Bacteria 1557
122 Ga0068864_100443539 3300005618 Bacteria 1240
123 Ga0068864_101354200 3300005618 Bacteria 713
124 Ga0068866_10014247 3300005718 Bacteria 3506
125 Ga0068863_100029526 3300005841 Bacteria 5234
126 Ga0068863_100069207 3300005841 Bacteria 3337
127 Ga0068858_100002681 3300005842 Bacteria 17926
128 Ga0068860_101003030 3300005843 Bacteria 853
129 Ga0068860_101416607 3300005843 Bacteria 716
130 Ga0068862_100804080 3300005844 Bacteria 918
131 Ga0070717_10506192 3300006028 Bacteria 1092
132 Ga0070716_100136384 3300006173 Unclassified 1559
133 Ga0097621_100018075 3300006237 Bacteria 5375
134 Ga0097621_100929750 3300006237 Bacteria 811
135 Ga0068871_100006672 3300006358 Bacteria 8186
136 Ga0068871_101308483 3300006358 Bacteria 682
137 Ga0075431_101869858 3300006847 Bacteria 556
138 Ga0075434_100001049 3300006871 Bacteria 22542
139 Ga0075434_100030195 3300006871 Bacteria 5336
140 Ga0068865_101521929 3300006881 Bacteria 600
141 Ga0075436_100001088 3300006914 Bacteria 18303
142 Ga0075436_100001106 3300006914 Bacteria 18215
143 Ga0075436_100116048 3300006914 Bacteria 1871
144 Ga0075436_100548396 3300006914 Bacteria 848
145 Ga0075436_100583535 3300006914 Bacteria 822
146 Ga0097620_100237081 3300006931 Bacteria 1913
147 Ga0075435_100000213 3300007076 Bacteria 35518
148 Ga0075435_100000632 3300007076 Bacteria 21607
149 Ga0075435_100529907 3300007076 Bacteria 1019
150 Ga0105240_10820492 3300009093 Bacteria 1006
151 Ga0111539_10880304 3300009094 Bacteria 1042
152 Ga0105243_10268407 3300009148 Bacteria 1531
153 Ga0105241_10469993 3300009174 Bacteria 1116
154 Ga0105241_11040787 3300009174 Bacteria 768
155 Ga0105242_10538874 3300009176 Bacteria 1117
156 Ga0105248_10069391 3300009177 Bacteria 3957
157 Ga0105248_10168037 3300009177 Bacteria 2472
158 Ga0105248_10410117 3300009177 Bacteria 1525
159 Ga0105248_10672133 3300009177 Bacteria 1168
160 Ga0105248_12468718 3300009177 Bacteria 592
161 Ga0105238_10443107 3300009551 Bacteria 1295
162 Ga0105249_10042746 3300009553 Bacteria 4123
163 Ga0105249_10946059 3300009553 Bacteria 929
164 Ga0105239_12784976 3300010375 Bacteria 571
165 Ga0105246_10476892 3300011119 Bacteria 1054
166 Ga0157373_10117142 3300013100 Bacteria 1872
167 Ga0157373_10168402 3300013100 Bacteria 1542
168 Ga0157373_10684490 3300013100 Bacteria 751
169 Ga0157373_11321258 3300013100 Bacteria 546
170 Ga0157371_10054189 3300013102 Bacteria 2849
171 Ga0157371_10149173 3300013102 Bacteria 1667
172 Ga0157371_10451723 3300013102 Bacteria 945
173 Ga0157371_10496978 3300013102 Bacteria 900
174 Ga0157371_10632571 3300013102 Bacteria 798
175 Ga0157370_10001258 3300013104 Bacteria 31653
176 Ga0157370_10042854 3300013104 Bacteria 4358
177 Ga0157370_10126071 3300013104 Bacteria 2389
178 Ga0157369_10086608 3300013105 Bacteria 3345
179 Ga0157369_10108262 3300013105 Bacteria 2956
180 Ga0157374_10002117 3300013296 Bacteria 16704
181 Ga0157374_10008502 3300013296 Bacteria 8781
182 Ga0157374_12005888 3300013296 Bacteria 605
183 Ga0157378_10077621 3300013297 Bacteria 2994
184 Ga0157378_10286061 3300013297 Bacteria 1591
185 Ga0157378_10329552 3300013297 Bacteria 1485
186 Ga0157378_11890641 3300013297 Unclassified 646
187 Ga0163162_10048011 3300013306 Bacteria 4277
188 Ga0163162_10059996 3300013306 Bacteria 3837
189 Ga0157372_10700800 3300013307 Bacteria 1178
190 Ga0157375_10002436 3300013308 Bacteria 16100
191 Ga0157375_10009604 3300013308 Bacteria 8498
192 Ga0157375_10034173 3300013308 Bacteria 4841
193 Ga0157375_12153202 3300013308 Bacteria 664
194 Ga0163163_10030946 3300014325 Bacteria 5161
195 Ga0157380_11424813 3300014326 Unclassified 744
196 Ga0157377_10137536 3300014745 Unclassified 1498
197 Ga0157379_10172270 3300014968 Bacteria 1954
198 Ga0157379_10683563 3300014968 Bacteria 962
199 Ga0157376_10126205 3300014969 Bacteria 2276
200 Ga0213872_10064582 3300021361 Bacteria 1654
201 Ga0213876_10000332 3300021384 Bacteria 41214
202 Ga0213876_10010995 3300021384 Bacteria 4845
203 Ga0207697_10098732 3300025315 Bacteria 1243
204 Ga0207697_10184573 3300025315 Bacteria 915
205 Ga0207682_10006199 3300025893 Bacteria 4833
206 Ga0207642_10204889 3300025899 Bacteria 1092
207 Ga0207680_10034145 3300025903 Bacteria 2908
208 Ga0207680_10043797 3300025903 Bacteria 2627
209 Ga0207680_10332210 3300025903 Bacteria 1065
210 Ga0207645_10060995 3300025907 Bacteria 2409
211 Ga0207645_10166361 3300025907 Bacteria 1444
212 Ga0207645_10235075 3300025907 Bacteria 1210
213 Ga0207705_10000002 3300025909 Bacteria 2046852
214 Ga0207705_10345893 3300025909 Bacteria 1145
215 Ga0207705_10461168 3300025909 Bacteria 986
216 Ga0207684_10504062 3300025910 Bacteria 1037
217 Ga0207707_10601905 3300025912 Unclassified 930
218 Ga0207660_10018588 3300025917 Bacteria 4635
219 Ga0207660_11006870 3300025917 Bacteria 679
220 Ga0207657_10011456 3300025919 Bacteria 8805
221 Ga0207657_10173373 3300025919 Bacteria 1747
222 Ga0207657_10216508 3300025919 Bacteria 1536
223 Ga0207657_10649826 3300025919 Bacteria 821
224 Ga0207649_10021113 3300025920 Bacteria 3743
225 Ga0207649_10078414 3300025920 Bacteria 2131
226 Ga0207649_10106767 3300025920 Bacteria 1863
227 Ga0207649_11320990 3300025920 Archaea 570
228 Ga0207652_10611242 3300025921 Bacteria 977
229 Ga0207652_10711329 3300025921 Bacteria 896
230 Ga0207650_10004449 3300025925 Bacteria 9574
231 Ga0207650_10016499 3300025925 Bacteria 5164
232 Ga0207650_10105505 3300025925 Bacteria 2175
233 Ga0207659_10090140 3300025926 Bacteria 2288
234 Ga0207659_10097927 3300025926 Bacteria 2204
235 Ga0207659_10135335 3300025926 Bacteria 1907
236 Ga0207659_10149827 3300025926 Bacteria 1821
237 Ga0207659_10751418 3300025926 Bacteria 837
238 Ga0207659_11327304 3300025926 Bacteria 617
239 Ga0207687_10255781 3300025927 Bacteria 1394
240 Ga0207687_11178144 3300025927 Bacteria 658
241 Ga0207664_10650476 3300025929 Bacteria 947
242 Ga0207644_10005983 3300025931 Bacteria 7929
243 Ga0207644_10019287 3300025931 Bacteria 4624
244 Ga0207644_10033759 3300025931 Bacteria 3579
245 Ga0207690_10485354 3300025932 Bacteria 998
246 Ga0207706_10004181 3300025933 Bacteria 13592
247 Ga0207706_10196914 3300025933 Bacteria 1767
248 Ga0207669_10079617 3300025937 Bacteria 2092
249 Ga0207669_10084130 3300025937 Bacteria 2049
250 Ga0207704_10118098 3300025938 Bacteria 1808
251 Ga0207704_10192108 3300025938 Bacteria 1486
252 Ga0207665_10030374 3300025939 Bacteria 3570
253 Ga0207691_10002062 3300025940 Bacteria 19627
254 Ga0207691_10186783 3300025940 Bacteria 1809
255 Ga0207691_10260232 3300025940 Bacteria 1496
256 Ga0207691_10274785 3300025940 Bacteria 1450
257 Ga0207691_11355102 3300025940 Unclassified 586
258 Ga0207711_10028294 3300025941 Bacteria 4715
259 Ga0207711_10104306 3300025941 Bacteria 2512
260 Ga0207711_10188195 3300025941 Bacteria 1880
261 Ga0207689_10178442 3300025942 Bacteria 1752
262 Ga0207689_10228601 3300025942 Bacteria 1538
263 Ga0207661_10509803 3300025944 Bacteria 1099
264 Ga0207661_11772755 3300025944 Bacteria 563
265 Ga0207661_11818809 3300025944 Bacteria 555
266 Ga0207679_10011221 3300025945 Bacteria 5791
267 Ga0207679_10391594 3300025945 Bacteria 1220
268 Ga0207679_10478198 3300025945 Bacteria 1108
269 Ga0207667_10112744 3300025949 Bacteria 2804
270 Ga0207667_10496714 3300025949 Bacteria 1238
271 Ga0207667_10586845 3300025949 Bacteria 1125
272 Ga0207667_11280820 3300025949 Archaea 710
273 Ga0207651_10006617 3300025960 Bacteria 6089
274 Ga0207651_10014585 3300025960 Bacteria 4543
275 Ga0207651_10099180 3300025960 Bacteria 2156
276 Ga0207668_10576799 3300025972 Bacteria 977
277 Ga0207658_10060336 3300025986 Bacteria 2829
278 Ga0207658_10270912 3300025986 Bacteria 1451
279 Ga0207658_10737125 3300025986 Bacteria 892
280 Ga0207677_10069141 3300026023 Bacteria 2482
281 Ga0207677_10229042 3300026023 Bacteria 1496
282 Ga0207677_10396092 3300026023 Bacteria 1170
283 Ga0207677_10510394 3300026023 Bacteria 1041
284 Ga0207703_10040111 3300026035 Bacteria 3745
285 Ga0207639_10275253 3300026041 Bacteria 1478
286 Ga0207678_10017428 3300026067 Bacteria 6309
287 Ga0207678_10292977 3300026067 Bacteria 1398
288 Ga0207678_10296454 3300026067 Bacteria 1389
289 Ga0207708_10551441 3300026075 Bacteria 972
290 Ga0207702_10117684 3300026078 Bacteria 2373
291 Ga0207702_11258305 3300026078 Bacteria 734
292 Ga0207641_10004486 3300026088 Bacteria 12077
293 Ga0207648_10016932 3300026089 Bacteria 6642
294 Ga0207648_10566101 3300026089 Bacteria 1045
295 Ga0207676_10003805 3300026095 Bacteria 10670
296 Ga0207676_10252442 3300026095 Bacteria 1588
297 Ga0207676_10359814 3300026095 Bacteria 1348
298 Ga0207676_10776406 3300026095 Bacteria 933
299 Ga0207676_10990108 3300026095 Bacteria 828
300 Ga0207675_100719520 3300026118 Bacteria 1008
301 Ga0207683_10005966 3300026121 Bacteria 10436
302 Ga0207683_10008629 3300026121 Bacteria 8714
303 Ga0207683_10216485 3300026121 Bacteria 1745
304 Ga0207683_10343920 3300026121 Bacteria 1368
305 Ga0207698_10281069 3300026142 Bacteria 1539
306 Ga0207698_10325403 3300026142 Bacteria 1442
307 Ga0207698_10618502 3300026142 Bacteria 1070
308 Ga0207698_11633469 3300026142 Bacteria 660
309 Ga0268266_10025926 3300028379 Bacteria 4987
310 Ga0268266_10030425 3300028379 Bacteria 4587
311 Ga0268266_10641907 3300028379 Bacteria 1021
312 Ga0268264_10930306 3300028381 Bacteria 874
313 Ga0395900_0299000 3300037418 Bacteria 1596
314 Ga0395900_0302277 3300037418 Bacteria 1586
315 Ga0395900_0484780 3300037418 Bacteria 1188
316 Ga0395900_0906484 3300037418 Bacteria 805
317 Ga0395900_1065217 3300037418 Unclassified 727
318 Ga0395900_1303928 3300037418 Unclassified 640
319 Ga0395898_0134495 3300037466 Bacteria 2367
320 Ga0395905_0013011 3300037471 Bacteria 7995
321 Ga0395905_0030989 3300037471 Bacteria 5037
322 Ga0395905_0325980 3300037471 Unclassified 1426
323 Ga0395905_0719419 3300037471 Bacteria 901
324 Ga0395901_0057737 3300038443 Bacteria 4036
325 Ga0395901_0383590 3300038443 Bacteria 1446
326 Ga0395901_0769696 3300038443 Bacteria 954
327 Ga0395901_1645199 3300038443 Bacteria 594
328 Ga0436365_0010969 3300039437 Bacteria 175809
329 Ga0436365_1623269 3300039437 Bacteria 2080
330 Ga0436360_0541431 3300039438 Bacteria 1040
331 Ga0436361_0955442 3300039447 Bacteria 3679
332 Ga0436362_1136156 3300039453 Bacteria 864
333 Ga0439455_0208135 3300042012 Unclassified 567
334 Ga0466966_0044059 3300044684 Bacteria 2858
335 Ga0466966_0202132 3300044684 Bacteria 1202
336 Ga0466961_0000742 3300044693 Bacteria 20416
337 Ga0466961_0007548 3300044693 Bacteria 6922
338 Ga0466961_0206253 3300044693 Bacteria 1214
339 Ga0466963_0007693 3300044694 Bacteria 6435
340 Ga0466963_0411691 3300044694 Bacteria 953
341 Ga0466964_0011029 3300044706 Bacteria 3415
342 Ga0466968_0002444 3300044735 Bacteria 6811
343 Ga0466970_0056120 3300044765 Bacteria 2104
344 Ga0466970_0387098 3300044765 Bacteria 797
345 Ga0466959_0030165 3300045049 Bacteria 4016
346 Ga0451576_1898814 3300045051 Bacteria 615
347 Ga0466958_0017748 3300045836 Bacteria 4120
348 Ga0466958_0040488 3300045836 Bacteria 2800
349 Ga0466967_0083723 3300045976 Bacteria 2885
350 Ga0466967_0084153 3300045976 Bacteria 2878
351 Ga0466967_0311076 3300045976 Bacteria 1517
352 Ga0466967_0661138 3300045976 Bacteria 1034
353 Ga0466967_1570244 3300045976 Bacteria 655
354 Ga0495580_0127202 3300046472 Bacteria 1769
355 Ga0495643_0000008 3300046522 Bacteria 367010
356 Ga0495663_0288330 3300046525 Bacteria 589
357 Ga0495598_0006622 3300046537 Bacteria 2625
358 Ga0495598_0279562 3300046537 Bacteria 626
359 Ga0495669_0060374 3300046684 Bacteria 1714
360 Ga0495669_0361036 3300046684 Bacteria 702
361 Ga0495670_0017219 3300046691 Bacteria 3556
362 Ga0495671_0199032 3300046692 Bacteria 972
363 Ga0495636_0366119 3300047318 Bacteria 682
364 Ga0496101_0100431 3300048904 Bacteria 2165
365 Ga0496101_0208247 3300048904 Bacteria 1514
366 Ga0496101_0346007 3300048904 Bacteria 1168
367 Ga0496102_0250245 3300048905 Bacteria 1671
368 Ga0496103_0194718 3300048906 Bacteria 1303
369 Ga0496104_0418790 3300048907 Bacteria 1251
370 Ga0496105_0314995 3300048908 Bacteria 1255
371 Ga0496106_0181472 3300048909 Bacteria 1671
372 Ga0496107_0122238 3300048910 Bacteria 1918
373 Ga0496107_0143194 3300048910 Unclassified 1767
374 Ga0496107_0280936 3300048910 Bacteria 1239
375 Ga0496107_0443170 3300048910 Bacteria 965
376 Ga0496108_0071248 3300048911 Bacteria 2932
377 Ga0496108_0246676 3300048911 Unclassified 1553
378 Ga0496109_0008875 3300048912 Bacteria 8561
379 Ga0496109_0052367 3300048912 Bacteria 3720
380 Ga0496110_0002993 3300048913 Bacteria 12815
381 Ga0496110_0029394 3300048913 Bacteria 4729
382 Ga0496110_0721888 3300048913 Bacteria 899
383 Ga0496111_0139175 3300048914 Bacteria 1798
384 Ga0496111_0145523 3300048914 Bacteria 1757
385 Ga0496111_0264042 3300048914 Bacteria 1277
386 Ga0496112_0000175 3300048915 Bacteria 40859
387 Ga0496112_0037389 3300048915 Bacteria 4738
388 Ga0496112_0679193 3300048915 Bacteria 958
389 Ga0496113_0042043 3300048916 Bacteria 3375
390 Ga0496113_0108365 3300048916 Bacteria 2159
391 Ga0501040_0622374 3300049576 Unclassified 780
392 Ga0501076_0228863 3300049592 Bacteria 1520
393 Ga0501079_0062711 3300049741 Bacteria 2867
394 nmdc:mga06r32_1853180_c1 3300050510 Bacteria 538
395 nmdc:mga08y16_759056_c1 3300050511 Bacteria 965
396 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
397 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
398 nmdc:mga0rr50_461_c1 3300050513 Bacteria 21669
399 nmdc:mga08x19_3660_c1 3300050514 Bacteria 9153
400 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
401 nmdc:mga08x19_70084_c1 3300050514 Bacteria 2284
402 nmdc:mga08x19_941_c1 3300050514 Bacteria 18307
403 Ga0501082_0064803 3300060353 Bacteria 3147
404 Ga0466962_0006197 3300061719 Bacteria 5745
405 Ga0530510_0420090 3300061734 Bacteria 1009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100030195 Ga0075434_1000301952 131
2 3300006914 Ga0075436_100583535 Ga0075436_1005835352 131
3 3300006871 Ga0075434_100001049 Ga0075434_1000010498 139
4 3300006914 Ga0075436_100001106 Ga0075436_10000110611 139
5 3300007076 Ga0075435_100000213 Ga0075435_1000002138 139
6 3300005547 Ga0070693_100024008 Ga0070693_1000240083 144
7 3300005290 Ga0065712_10253958 Ga0065712_102539582 145
8 3300005329 Ga0070683_101465864 Ga0070683_1014658641 145
9 3300005331 Ga0070670_100650587 Ga0070670_1006505871 145
10 3300005354 Ga0070675_100870699 Ga0070675_1008706991 145
11 3300005535 Ga0070684_101907189 Ga0070684_1019071891 145
12 3300005615 Ga0070702_100160517 Ga0070702_1001605172 145
13 3300006173 Ga0070716_100136384 Ga0070716_1001363842 145
14 3300025939 Ga0207665_10030374 Ga0207665_100303745 145
15 3300021384 Ga0213876_10000332 Ga0213876_1000033213 146
16 3300039437 Ga0436365_0010969 Ga0436365_0010969_35619_36098 146
17 3300001991 JGI24743J22301_10037847 JGI24743J22301_100378472 147
18 3300005327 Ga0070658_10226606 Ga0070658_102266062 147
19 3300005330 Ga0070690_100433738 Ga0070690_1004337382 147
20 3300005333 Ga0070677_10260201 Ga0070677_102602012 147
21 3300005335 Ga0070666_10066550 Ga0070666_100665505 147
22 3300005338 Ga0068868_100117818 Ga0068868_1001178185 147
23 3300005344 Ga0070661_100021154 Ga0070661_1000211545 147
24 3300005354 Ga0070675_100183790 Ga0070675_1001837902 147
25 3300005354 Ga0070675_100188403 Ga0070675_1001884032 147
26 3300005367 Ga0070667_100134595 Ga0070667_1001345952 147
27 3300005456 Ga0070678_100146588 Ga0070678_1001465883 147
28 3300005457 Ga0070662_100099868 Ga0070662_1000998682 147
29 3300005459 Ga0068867_100113370 Ga0068867_1001133703 147
30 3300005543 Ga0070672_100003314 Ga0070672_1000033146 147
31 3300005543 Ga0070672_100182219 Ga0070672_1001822192 147
32 3300005548 Ga0070665_100214728 Ga0070665_1002147282 147
33 3300005564 Ga0070664_100128864 Ga0070664_1001288643 147
34 3300005614 Ga0068856_101453115 Ga0068856_1014531151 147
35 3300005616 Ga0068852_100114262 Ga0068852_1001142625 147
36 3300005618 Ga0068864_100279632 Ga0068864_1002796322 147
37 3300005841 Ga0068863_100069207 Ga0068863_1000692075 147
38 3300005842 Ga0068858_100002681 Ga0068858_1000026816 147
39 3300005843 Ga0068860_101003030 Ga0068860_1010030302 147
40 3300006237 Ga0097621_100018075 Ga0097621_1000180753 147
41 3300006358 Ga0068871_100006672 Ga0068871_1000066727 147
42 3300006914 Ga0075436_100001088 Ga0075436_1000010883 147
43 3300007076 Ga0075435_100000632 Ga0075435_10000063217 147
44 3300009094 Ga0111539_10880304 Ga0111539_108803042 147
45 3300009177 Ga0105248_10069391 Ga0105248_100693916 147
46 3300013102 Ga0157371_10054189 Ga0157371_100541894 147
47 3300013296 Ga0157374_10002117 Ga0157374_1000211714 147
48 3300013297 Ga0157378_10286061 Ga0157378_102860612 147
49 3300013306 Ga0163162_10048011 Ga0163162_100480115 147
50 3300013308 Ga0157375_10002436 Ga0157375_1000243613 147
51 3300014325 Ga0163163_10030946 Ga0163163_100309466 147
52 3300014326 Ga0157380_11424813 Ga0157380_114248132 147
53 3300014968 Ga0157379_10172270 Ga0157379_101722702 147
54 3300021361 Ga0213872_10064582 Ga0213872_100645822 147
55 3300025903 Ga0207680_10034145 Ga0207680_100341453 147
56 3300025909 Ga0207705_10461168 Ga0207705_104611682 147
57 3300025920 Ga0207649_10021113 Ga0207649_100211135 147
58 3300025925 Ga0207650_10004449 Ga0207650_100044496 147
59 3300025926 Ga0207659_10135335 Ga0207659_101353352 147
60 3300025926 Ga0207659_10149827 Ga0207659_101498272 147
61 3300025931 Ga0207644_10005983 Ga0207644_100059833 147
62 3300025933 Ga0207706_10004181 Ga0207706_1000418110 147
63 3300025937 Ga0207669_10084130 Ga0207669_100841302 147
64 3300025938 Ga0207704_10192108 Ga0207704_101921082 147
65 3300025940 Ga0207691_10002062 Ga0207691_100020627 147
66 3300025940 Ga0207691_11355102 Ga0207691_113551021 147
67 3300025941 Ga0207711_10028294 Ga0207711_100282943 147
68 3300025945 Ga0207679_10011221 Ga0207679_100112216 147
69 3300025960 Ga0207651_10014585 Ga0207651_100145853 147
70 3300025986 Ga0207658_10060336 Ga0207658_100603363 147
71 3300026023 Ga0207677_10229042 Ga0207677_102290423 147
72 3300026035 Ga0207703_10040111 Ga0207703_100401115 147
73 3300026075 Ga0207708_10551441 Ga0207708_105514412 147
74 3300026095 Ga0207676_10003805 Ga0207676_100038058 147
75 3300026118 Ga0207675_100719520 Ga0207675_1007195202 147
76 3300026121 Ga0207683_10005966 Ga0207683_100059666 147
77 3300026142 Ga0207698_10325403 Ga0207698_103254032 147
78 3300028379 Ga0268266_10030425 Ga0268266_100304256 147
79 3300028381 Ga0268264_10930306 Ga0268264_109303062 147
80 3300037471 Ga0395905_0325980 Ga0395905_0325980_131_580 147
81 3300039438 Ga0436360_0541431 Ga0436360_0541431_140_628 147
82 3300039447 Ga0436361_0955442 Ga0436361_0955442_2703_3191 147
83 3300039453 Ga0436362_1136156 Ga0436362_1136156_280_768 147
84 3300045051 Ga0451576_1898814 Ga0451576_1898814_64_561 147
85 3300046472 Ga0495580_0127202 Ga0495580_0127202_545_991 147
86 3300048904 Ga0496101_0100431 Ga0496101_0100431_1489_1935 147
87 3300048911 Ga0496108_0071248 Ga0496108_0071248_1071_1517 147
88 3300048913 Ga0496110_0029394 Ga0496110_0029394_162_608 147
89 3300048914 Ga0496111_0139175 Ga0496111_0139175_261_707 147
90 3300048915 Ga0496112_0037389 Ga0496112_0037389_4049_4495 147
91 3300048916 Ga0496113_0108365 Ga0496113_0108365_1307_1753 147
92 3300050511 nmdc:mga08y16_759056_c1 nmdc:mga08y16_759056_c1_71_517 147
93 3300050513 nmdc:mga0rr50_461_c1 nmdc:mga0rr50_461_c1_4701_5177 147
94 3300050514 nmdc:mga08x19_941_c1 nmdc:mga08x19_941_c1_17121_17597 147
95 3300001991 JGI24743J22301_10013624 JGI24743J22301_100136242 148
96 3300005327 Ga0070658_10801950 Ga0070658_108019502 148
97 3300005329 Ga0070683_100315947 Ga0070683_1003159471 148
98 3300005335 Ga0070666_10220839 Ga0070666_102208392 148
99 3300005339 Ga0070660_100759970 Ga0070660_1007599701 148
100 3300005347 Ga0070668_100582903 Ga0070668_1005829031 148
101 3300005354 Ga0070675_100041218 Ga0070675_1000412182 148
102 3300005355 Ga0070671_100800748 Ga0070671_1008007482 148
103 3300005364 Ga0070673_100062405 Ga0070673_1000624052 148
104 3300005366 Ga0070659_100525502 Ga0070659_1005255022 148
105 3300005367 Ga0070667_100301190 Ga0070667_1003011902 148
106 3300005367 Ga0070667_100544179 Ga0070667_1005441792 148
107 3300005456 Ga0070678_100002055 Ga0070678_1000020555 148
108 3300005535 Ga0070684_100823562 Ga0070684_1008235622 148
109 3300005548 Ga0070665_100043533 Ga0070665_1000435332 148
110 3300005564 Ga0070664_100185568 Ga0070664_1001855682 148
111 3300005564 Ga0070664_100955155 Ga0070664_1009551552 148
112 3300005577 Ga0068857_100324033 Ga0068857_1003240333 148
113 3300005618 Ga0068864_100022589 Ga0068864_1000225894 148
114 3300005618 Ga0068864_100278514 Ga0068864_1002785142 148
115 3300006237 Ga0097621_100929750 Ga0097621_1009297501 148
116 3300006914 Ga0075436_100116048 Ga0075436_1001160482 148
117 3300009177 Ga0105248_10410117 Ga0105248_104101172 148
118 3300009177 Ga0105248_10672133 Ga0105248_106721331 148
119 3300013100 Ga0157373_11321258 Ga0157373_113212581 148
120 3300013102 Ga0157371_10149173 Ga0157371_101491732 148
121 3300013105 Ga0157369_10108262 Ga0157369_101082622 148
122 3300013296 Ga0157374_10008502 Ga0157374_100085028 148
123 3300013297 Ga0157378_11890641 Ga0157378_118906411 148
124 3300013307 Ga0157372_10700800 Ga0157372_107008002 148
125 3300013308 Ga0157375_10009604 Ga0157375_100096045 148
126 3300013308 Ga0157375_12153202 Ga0157375_121532022 148
127 3300025315 Ga0207697_10098732 Ga0207697_100987322 148
128 3300025903 Ga0207680_10043797 Ga0207680_100437972 148
129 3300025912 Ga0207707_10601905 Ga0207707_106019052 148
130 3300025919 Ga0207657_10649826 Ga0207657_106498261 148
131 3300025920 Ga0207649_11320990 Ga0207649_113209901 148
132 3300025926 Ga0207659_10097927 Ga0207659_100979272 148
133 3300025931 Ga0207644_10019287 Ga0207644_100192873 148
134 3300025931 Ga0207644_10033759 Ga0207644_100337593 148
135 3300025932 Ga0207690_10485354 Ga0207690_104853542 148
136 3300025940 Ga0207691_10186783 Ga0207691_101867832 148
137 3300025940 Ga0207691_10260232 Ga0207691_102602322 148
138 3300025941 Ga0207711_10104306 Ga0207711_101043062 148
139 3300025944 Ga0207661_10509803 Ga0207661_105098033 148
140 3300025944 Ga0207661_11818809 Ga0207661_118188091 148
141 3300025945 Ga0207679_10391594 Ga0207679_103915942 148
142 3300025949 Ga0207667_11280820 Ga0207667_112808201 148
143 3300025960 Ga0207651_10006617 Ga0207651_100066172 148
144 3300025972 Ga0207668_10576799 Ga0207668_105767992 148
145 3300025986 Ga0207658_10270912 Ga0207658_102709121 148
146 3300025986 Ga0207658_10737125 Ga0207658_107371252 148
147 3300026078 Ga0207702_10117684 Ga0207702_101176841 148
148 3300026095 Ga0207676_10359814 Ga0207676_103598142 148
149 3300026095 Ga0207676_10776406 Ga0207676_107764062 148
150 3300026121 Ga0207683_10008629 Ga0207683_100086296 148
151 3300028379 Ga0268266_10025926 Ga0268266_100259263 148
152 3300037418 Ga0395900_1065217 Ga0395900_1065217_65_514 148
153 3300037418 Ga0395900_1303928 Ga0395900_1303928_139_588 148
154 3300037471 Ga0395905_0719419 Ga0395905_0719419_122_571 148
155 3300044684 Ga0466966_0202132 Ga0466966_0202132_585_1031 148
156 3300044693 Ga0466961_0007548 Ga0466961_0007548_207_653 148
157 3300044706 Ga0466964_0011029 Ga0466964_0011029_336_782 148
158 3300044735 Ga0466968_0002444 Ga0466968_0002444_5607_6053 148
159 3300044765 Ga0466970_0056120 Ga0466970_0056120_259_705 148
160 3300044765 Ga0466970_0387098 Ga0466970_0387098_85_534 148
161 3300045049 Ga0466959_0030165 Ga0466959_0030165_3396_3842 148
162 3300045836 Ga0466958_0017748 Ga0466958_0017748_190_636 148
163 3300045976 Ga0466967_0084153 Ga0466967_0084153_441_887 148
164 3300045976 Ga0466967_0661138 Ga0466967_0661138_322_771 148
165 3300045976 Ga0466967_1570244 Ga0466967_1570244_109_558 148
166 3300046525 Ga0495663_0288330 Ga0495663_0288330_88_537 148
167 3300046537 Ga0495598_0006622 Ga0495598_0006622_767_1216 148
168 3300046684 Ga0495669_0060374 Ga0495669_0060374_272_721 148
169 3300046691 Ga0495670_0017219 Ga0495670_0017219_1467_1916 148
170 3300047318 Ga0495636_0366119 Ga0495636_0366119_123_572 148
171 3300048904 Ga0496101_0208247 Ga0496101_0208247_486_935 148
172 3300048910 Ga0496107_0443170 Ga0496107_0443170_65_514 148
173 3300048912 Ga0496109_0052367 Ga0496109_0052367_3025_3474 148
174 3300048913 Ga0496110_0721888 Ga0496110_0721888_80_529 148
175 3300048914 Ga0496111_0145523 Ga0496111_0145523_290_739 148
176 3300048915 Ga0496112_0679193 Ga0496112_0679193_281_730 148
177 3300049576 Ga0501040_0622374 Ga0501040_0622374_20_541 148
178 3300049592 Ga0501076_0228863 Ga0501076_0228863_373_894 148
179 3300049741 Ga0501079_0062711 Ga0501079_0062711_1181_1702 148
180 3300050514 nmdc:mga08x19_70084_c1 nmdc:mga08x19_70084_c1_745_1206 148
181 3300060353 Ga0501082_0064803 Ga0501082_0064803_1694_2215 148
182 3300061734 Ga0530510_0420090 Ga0530510_0420090_264_785 148
183 3300001990 JGI24737J22298_10068407 JGI24737J22298_100684072 149
184 3300005290 Ga0065712_10000331 Ga0065712_1000033111 149
185 3300005293 Ga0065715_10089542 Ga0065715_1008954211 149
186 3300005327 Ga0070658_10000001 Ga0070658_10000001219 149
187 3300005327 Ga0070658_10442234 Ga0070658_104422342 149
188 3300005327 Ga0070658_11435698 Ga0070658_114356981 149
189 3300005328 Ga0070676_10239676 Ga0070676_102396762 149
190 3300005328 Ga0070676_10316687 Ga0070676_103166872 149
191 3300005328 Ga0070676_10369936 Ga0070676_103699362 149
192 3300005329 Ga0070683_100925843 Ga0070683_1009258431 149
193 3300005331 Ga0070670_100003765 Ga0070670_1000037651 149
194 3300005331 Ga0070670_100010136 Ga0070670_10001013610 149
195 3300005331 Ga0070670_100284387 Ga0070670_1002843873 149
196 3300005333 Ga0070677_10074184 Ga0070677_100741841 149
197 3300005334 Ga0068869_100176974 Ga0068869_1001769742 149
198 3300005335 Ga0070666_10545803 Ga0070666_105458032 149
199 3300005335 Ga0070666_10768118 Ga0070666_107681182 149
200 3300005336 Ga0070680_100011939 Ga0070680_1000119394 149
201 3300005337 Ga0070682_100493848 Ga0070682_1004938482 149
202 3300005338 Ga0068868_100052653 Ga0068868_1000526533 149
203 3300005338 Ga0068868_100089457 Ga0068868_1000894573 149
204 3300005338 Ga0068868_100171634 Ga0068868_1001716342 149
205 3300005339 Ga0070660_100000862 Ga0070660_10000086211 149
206 3300005339 Ga0070660_100138459 Ga0070660_1001384592 149
207 3300005339 Ga0070660_100545607 Ga0070660_1005456072 149
208 3300005340 Ga0070689_101338942 Ga0070689_1013389421 149
209 3300005344 Ga0070661_100103001 Ga0070661_1001030011 149
210 3300005344 Ga0070661_100279577 Ga0070661_1002795772 149
211 3300005344 Ga0070661_101279004 Ga0070661_1012790041 149
212 3300005353 Ga0070669_100215193 Ga0070669_1002151933 149
213 3300005354 Ga0070675_100009993 Ga0070675_1000099938 149
214 3300005354 Ga0070675_100103265 Ga0070675_1001032652 149
215 3300005354 Ga0070675_101073283 Ga0070675_1010732832 149
216 3300005355 Ga0070671_100466503 Ga0070671_1004665031 149
217 3300005356 Ga0070674_100018195 Ga0070674_1000181957 149
218 3300005364 Ga0070673_100042723 Ga0070673_1000427232 149
219 3300005364 Ga0070673_100219901 Ga0070673_1002199013 149
220 3300005365 Ga0070688_100012971 Ga0070688_1000129713 149
221 3300005366 Ga0070659_100250993 Ga0070659_1002509933 149
222 3300005366 Ga0070659_100361430 Ga0070659_1003614301 149
223 3300005366 Ga0070659_100523589 Ga0070659_1005235892 149
224 3300005367 Ga0070667_100346673 Ga0070667_1003466733 149
225 3300005367 Ga0070667_100470616 Ga0070667_1004706162 149
226 3300005435 Ga0070714_100340467 Ga0070714_1003404671 149
227 3300005455 Ga0070663_100013864 Ga0070663_1000138646 149
228 3300005455 Ga0070663_100091040 Ga0070663_1000910403 149
229 3300005455 Ga0070663_100266775 Ga0070663_1002667753 149
230 3300005456 Ga0070678_100093936 Ga0070678_1000939362 149
231 3300005456 Ga0070678_100374284 Ga0070678_1003742841 149
232 3300005457 Ga0070662_100132189 Ga0070662_1001321894 149
233 3300005457 Ga0070662_100236462 Ga0070662_1002364623 149
234 3300005458 Ga0070681_11311053 Ga0070681_113110531 149
235 3300005459 Ga0068867_100151577 Ga0068867_1001515772 149
236 3300005459 Ga0068867_100356677 Ga0068867_1003566773 149
237 3300005468 Ga0070707_101276827 Ga0070707_1012768272 149
238 3300005530 Ga0070679_100259027 Ga0070679_1002590272 149
239 3300005539 Ga0068853_100378492 Ga0068853_1003784921 149
240 3300005544 Ga0070686_101524112 Ga0070686_1015241121 149
241 3300005546 Ga0070696_100279555 Ga0070696_1002795551 149
242 3300005547 Ga0070693_100054067 Ga0070693_1000540673 149
243 3300005547 Ga0070693_100177824 Ga0070693_1001778242 149
244 3300005547 Ga0070693_100259035 Ga0070693_1002590351 149
245 3300005563 Ga0068855_100063522 Ga0068855_1000635228 149
246 3300005563 Ga0068855_100421637 Ga0068855_1004216372 149
247 3300005563 Ga0068855_101075374 Ga0068855_1010753742 149
248 3300005564 Ga0070664_100018503 Ga0070664_1000185032 149
249 3300005578 Ga0068854_100013859 Ga0068854_1000138593 149
250 3300005578 Ga0068854_100034924 Ga0068854_1000349244 149
251 3300005578 Ga0068854_100193591 Ga0068854_1001935912 149
252 3300005616 Ga0068852_100734233 Ga0068852_1007342332 149
253 3300005616 Ga0068852_100791557 Ga0068852_1007915572 149
254 3300005616 Ga0068852_100821215 Ga0068852_1008212152 149
255 3300005617 Ga0068859_100237075 Ga0068859_1002370752 149
256 3300005618 Ga0068864_100004905 Ga0068864_10000490515 149
257 3300005618 Ga0068864_100443539 Ga0068864_1004435392 149
258 3300005618 Ga0068864_101354200 Ga0068864_1013542001 149
259 3300005718 Ga0068866_10014247 Ga0068866_100142473 149
260 3300005841 Ga0068863_100029526 Ga0068863_1000295262 149
261 3300005843 Ga0068860_101416607 Ga0068860_1014166071 149
262 3300005844 Ga0068862_100804080 Ga0068862_1008040802 149
263 3300006028 Ga0070717_10506192 Ga0070717_105061922 149
264 3300006358 Ga0068871_101308483 Ga0068871_1013084831 149
265 3300006847 Ga0075431_101869858 Ga0075431_1018698581 149
266 3300006881 Ga0068865_101521929 Ga0068865_1015219292 149
267 3300006914 Ga0075436_100548396 Ga0075436_1005483962 149
268 3300006931 Ga0097620_100237081 Ga0097620_1002370812 149
269 3300007076 Ga0075435_100529907 Ga0075435_1005299071 149
270 3300009093 Ga0105240_10820492 Ga0105240_108204922 149
271 3300009148 Ga0105243_10268407 Ga0105243_102684072 149
272 3300009174 Ga0105241_10469993 Ga0105241_104699933 149
273 3300009174 Ga0105241_11040787 Ga0105241_110407872 149
274 3300009176 Ga0105242_10538874 Ga0105242_105388742 149
275 3300009177 Ga0105248_10168037 Ga0105248_101680373 149
276 3300009177 Ga0105248_12468718 Ga0105248_124687181 149
277 3300009551 Ga0105238_10443107 Ga0105238_104431073 149
278 3300009553 Ga0105249_10042746 Ga0105249_100427464 149
279 3300009553 Ga0105249_10946059 Ga0105249_109460592 149
280 3300010375 Ga0105239_12784976 Ga0105239_127849762 149
281 3300011119 Ga0105246_10476892 Ga0105246_104768922 149
282 3300013100 Ga0157373_10117142 Ga0157373_101171422 149
283 3300013100 Ga0157373_10168402 Ga0157373_101684022 149
284 3300013100 Ga0157373_10684490 Ga0157373_106844902 149
285 3300013102 Ga0157371_10451723 Ga0157371_104517232 149
286 3300013102 Ga0157371_10496978 Ga0157371_104969782 149
287 3300013102 Ga0157371_10632571 Ga0157371_106325711 149
288 3300013104 Ga0157370_10001258 Ga0157370_100012586 149
289 3300013104 Ga0157370_10042854 Ga0157370_100428544 149
290 3300013104 Ga0157370_10126071 Ga0157370_101260712 149
291 3300013105 Ga0157369_10086608 Ga0157369_100866083 149
292 3300013296 Ga0157374_12005888 Ga0157374_120058882 149
293 3300013297 Ga0157378_10077621 Ga0157378_100776213 149
294 3300013297 Ga0157378_10329552 Ga0157378_103295522 149
295 3300013306 Ga0163162_10059996 Ga0163162_100599964 149
296 3300013308 Ga0157375_10034173 Ga0157375_100341737 149
297 3300014745 Ga0157377_10137536 Ga0157377_101375362 149
298 3300014968 Ga0157379_10683563 Ga0157379_106835632 149
299 3300014969 Ga0157376_10126205 Ga0157376_101262052 149
300 3300021384 Ga0213876_10010995 Ga0213876_100109956 149
301 3300025315 Ga0207697_10184573 Ga0207697_101845732 149
302 3300025893 Ga0207682_10006199 Ga0207682_100061992 149
303 3300025899 Ga0207642_10204889 Ga0207642_102048892 149
304 3300025903 Ga0207680_10332210 Ga0207680_103322102 149
305 3300025907 Ga0207645_10060995 Ga0207645_100609953 149
306 3300025907 Ga0207645_10166361 Ga0207645_101663612 149
307 3300025907 Ga0207645_10235075 Ga0207645_102350753 149
308 3300025909 Ga0207705_10000002 Ga0207705_100000021660 149
309 3300025909 Ga0207705_10345893 Ga0207705_103458932 149
310 3300025910 Ga0207684_10504062 Ga0207684_105040621 149
311 3300025917 Ga0207660_10018588 Ga0207660_100185882 149
312 3300025917 Ga0207660_11006870 Ga0207660_110068702 149
313 3300025919 Ga0207657_10011456 Ga0207657_1001145610 149
314 3300025919 Ga0207657_10173373 Ga0207657_101733733 149
315 3300025919 Ga0207657_10216508 Ga0207657_102165081 149
316 3300025920 Ga0207649_10078414 Ga0207649_100784142 149
317 3300025920 Ga0207649_10106767 Ga0207649_101067671 149
318 3300025921 Ga0207652_10611242 Ga0207652_106112422 149
319 3300025921 Ga0207652_10711329 Ga0207652_107113292 149
320 3300025925 Ga0207650_10016499 Ga0207650_100164991 149
321 3300025925 Ga0207650_10105505 Ga0207650_101055052 149
322 3300025926 Ga0207659_10090140 Ga0207659_100901404 149
323 3300025926 Ga0207659_10751418 Ga0207659_107514182 149
324 3300025926 Ga0207659_11327304 Ga0207659_113273041 149
325 3300025927 Ga0207687_10255781 Ga0207687_102557812 149
326 3300025927 Ga0207687_11178144 Ga0207687_111781442 149
327 3300025929 Ga0207664_10650476 Ga0207664_106504762 149
328 3300025933 Ga0207706_10196914 Ga0207706_101969142 149
329 3300025937 Ga0207669_10079617 Ga0207669_100796172 149
330 3300025938 Ga0207704_10118098 Ga0207704_101180983 149
331 3300025940 Ga0207691_10274785 Ga0207691_102747852 149
332 3300025941 Ga0207711_10188195 Ga0207711_101881952 149
333 3300025942 Ga0207689_10178442 Ga0207689_101784422 149
334 3300025942 Ga0207689_10228601 Ga0207689_102286012 149
335 3300025944 Ga0207661_11772755 Ga0207661_117727551 149
336 3300025945 Ga0207679_10478198 Ga0207679_104781981 149
337 3300025949 Ga0207667_10112744 Ga0207667_101127441 149
338 3300025949 Ga0207667_10496714 Ga0207667_104967142 149
339 3300025949 Ga0207667_10586845 Ga0207667_105868452 149
340 3300025960 Ga0207651_10099180 Ga0207651_100991803 149
341 3300026023 Ga0207677_10069141 Ga0207677_100691412 149
342 3300026023 Ga0207677_10396092 Ga0207677_103960922 149
343 3300026023 Ga0207677_10510394 Ga0207677_105103942 149
344 3300026041 Ga0207639_10275253 Ga0207639_102752532 149
345 3300026067 Ga0207678_10017428 Ga0207678_100174283 149
346 3300026067 Ga0207678_10292977 Ga0207678_102929773 149
347 3300026067 Ga0207678_10296454 Ga0207678_102964543 149
348 3300026078 Ga0207702_11258305 Ga0207702_112583052 149
349 3300026088 Ga0207641_10004486 Ga0207641_100044867 149
350 3300026089 Ga0207648_10016932 Ga0207648_100169326 149
351 3300026089 Ga0207648_10566101 Ga0207648_105661012 149
352 3300026095 Ga0207676_10252442 Ga0207676_102524422 149
353 3300026095 Ga0207676_10990108 Ga0207676_109901082 149
354 3300026121 Ga0207683_10216485 Ga0207683_102164852 149
355 3300026121 Ga0207683_10343920 Ga0207683_103439203 149
356 3300026142 Ga0207698_10281069 Ga0207698_102810692 149
357 3300026142 Ga0207698_10618502 Ga0207698_106185022 149
358 3300026142 Ga0207698_11633469 Ga0207698_116334692 149
359 3300028379 Ga0268266_10641907 Ga0268266_106419072 149
360 3300037418 Ga0395900_0299000 Ga0395900_0299000_749_1201 149
361 3300037418 Ga0395900_0302277 Ga0395900_0302277_544_996 149
362 3300037418 Ga0395900_0484780 Ga0395900_0484780_716_1171 149
363 3300037418 Ga0395900_0906484 Ga0395900_0906484_206_658 149
364 3300037466 Ga0395898_0134495 Ga0395898_0134495_457_909 149
365 3300037471 Ga0395905_0013011 Ga0395905_0013011_5628_6080 149
366 3300037471 Ga0395905_0030989 Ga0395905_0030989_2424_2876 149
367 3300038443 Ga0395901_0057737 Ga0395901_0057737_3032_3484 149
368 3300038443 Ga0395901_0383590 Ga0395901_0383590_311_763 149
369 3300038443 Ga0395901_0769696 Ga0395901_0769696_193_645 149
370 3300038443 Ga0395901_1645199 Ga0395901_1645199_110_565 149
371 3300039437 Ga0436365_1623269 Ga0436365_1623269_569_1018 149
372 3300042012 Ga0439455_0208135 Ga0439455_0208135_95_547 149
373 3300044684 Ga0466966_0044059 Ga0466966_0044059_1134_1586 149
374 3300044693 Ga0466961_0000742 Ga0466961_0000742_15658_16137 149
375 3300044693 Ga0466961_0206253 Ga0466961_0206253_148_600 149
376 3300044694 Ga0466963_0007693 Ga0466963_0007693_5832_6284 149
377 3300044694 Ga0466963_0411691 Ga0466963_0411691_42_494 149
378 3300045836 Ga0466958_0040488 Ga0466958_0040488_466_918 149
379 3300045976 Ga0466967_0083723 Ga0466967_0083723_389_841 149
380 3300045976 Ga0466967_0311076 Ga0466967_0311076_423_875 149
381 3300046522 Ga0495643_0000008 Ga0495643_0000008_76786_77253 149
382 3300046537 Ga0495598_0279562 Ga0495598_0279562_84_536 149
383 3300046684 Ga0495669_0361036 Ga0495669_0361036_129_581 149
384 3300046692 Ga0495671_0199032 Ga0495671_0199032_303_776 149
385 3300048904 Ga0496101_0346007 Ga0496101_0346007_584_1114 149
386 3300048905 Ga0496102_0250245 Ga0496102_0250245_190_642 149
387 3300048906 Ga0496103_0194718 Ga0496103_0194718_755_1207 149
388 3300048907 Ga0496104_0418790 Ga0496104_0418790_683_1213 149
389 3300048908 Ga0496105_0314995 Ga0496105_0314995_569_1099 149
390 3300048909 Ga0496106_0181472 Ga0496106_0181472_914_1444 149
391 3300048910 Ga0496107_0122238 Ga0496107_0122238_1040_1492 149
392 3300048910 Ga0496107_0143194 Ga0496107_0143194_692_1222 149
393 3300048910 Ga0496107_0280936 Ga0496107_0280936_575_1105 149
394 3300048911 Ga0496108_0246676 Ga0496108_0246676_328_858 149
395 3300048912 Ga0496109_0008875 Ga0496109_0008875_727_1257 149
396 3300048913 Ga0496110_0002993 Ga0496110_0002993_7159_7689 149
397 3300048914 Ga0496111_0264042 Ga0496111_0264042_439_969 149
398 3300048915 Ga0496112_0000175 Ga0496112_0000175_29874_30404 149
399 3300048916 Ga0496113_0042043 Ga0496113_0042043_178_708 149
400 3300050510 nmdc:mga06r32_1853180_c1 nmdc:mga06r32_1853180_c1_38_487 149
401 3300050512 nmdc:mga0n895_173_c1 nmdc:mga0n895_173_c1_10868_11335 149
402 3300050513 nmdc:mga0rr50_2_c1 nmdc:mga0rr50_2_c1_316712_317179 149
403 3300050514 nmdc:mga08x19_3660_c1 nmdc:mga08x19_3660_c1_4473_4943 149
404 3300050514 nmdc:mga08x19_452_c1 nmdc:mga08x19_452_c1_18559_19026 149
405 3300061719 Ga0466962_0006197 Ga0466962_0006197_5127_5579 149

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0o-assembly1.cif.gz_A crystal structure of acetate kinase from entamoeba histolytica 0.7109 36 73
5f7r-assembly1.cif.gz_E rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.6612 35 66
8cwo-assembly1.cif.gz_K cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.6147 33 65
7pkq-assembly1.cif.gz_k small subunit of the chlamydomonas reinhardtii mitoribosome 0.6136 36 65
7jil-assembly1.cif.gz_p 70s ribosome flavobacterium johnsoniae 0.6066 34 65
ID Description Score Start End Superfamily
4h0oA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7109 36 73 3.30.420.40
1xc3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7103 36 65 3.30.420.40
af_P9WKV1_107_237_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7096 36 65 3.30.420.40
af_Q9VEQ0_8_287_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.681 36 66 3.30.420.40
af_Q7JVK1_21_159_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.6616 35 65 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A2U1G343-F1-model_v4 deleted 1.001 1 149
AF-A0A258RKT7-F1-model_v4 YdhG-like domain-containing protein 0.9963 1 149
AF-A0A258RKT7-F1-model_v4 YdhG-like domain-containing protein 0.9896 1 149
AF-A0A7G8BCU4-F1-model_v4 Uncharacterized protein 0.9894 1 149
AF-A0A7Y5QLH9-F1-model_v4 YdhG-like domain-containing protein 0.9843 1 149

Feature Viewer

pLDDT pTM Quality
95.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map