F435874

General Info

Members Datasets Scaffolds Average Seq Length
405 202 810 327

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100023328|Ga0070671_1000233282
Length 372
Sequence MVIHRLTLVAQAVRPAFGPGSPTRLRATRFGASTVARARSVRERRWKGLRCLLLXXXVSASCARQQSPAGITIAVIPKGTSHVFWQSIHAGAAKAAQELGVSIIWRGPLREDDRAAQVSEVEGFVSRGVSGIVLAPLDDSALAPPVAAAKRRGIPVVVIDSGLKGDDYVSFVATDNRAGGRLAGEQLAKLLNDTGKVVMLRYAEGSESTAQREAGFLEAIEAHKGIQVVSANQYGGADVESAFKKSESLLGGLKKADGSLDVDGIFTPNESTTVAMVRVLQSNGWAGKRRFIGFDASDLLVKALADGHLDGLVLQDPVNMGYLGVKTMVAHLKGNTVDKRIDTGVRLVTRDHMNDPDAKELLHPDLAKWLKN

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
131 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
170 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 2.47
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100023328 3300005355 Bacteria 5063
2 SwRhRL3b_contig_494398 2162886006 Unclassified 1335
3 Ga0065715_10222482 3300005293 Bacteria 1257
4 Ga0070676_10011010 3300005328 Bacteria 4914
5 Ga0070676_10024120 3300005328 Bacteria 3424
6 Ga0070690_100038989 3300005330 Bacteria 3000
7 Ga0070670_100015938 3300005331 Bacteria 6449
8 Ga0068869_100003285 3300005334 Bacteria 9870
9 Ga0068869_100030821 3300005334 Bacteria 3769
10 Ga0068868_100017264 3300005338 Bacteria 5372
11 Ga0070689_100018846 3300005340 Bacteria 5094
12 Ga0070691_10003314 3300005341 Bacteria 7224
13 Ga0070687_100031176 3300005343 Bacteria 2614
14 Ga0070668_100025055 3300005347 Bacteria 4521
15 Ga0070669_100007157 3300005353 Bacteria 8017
16 Ga0070669_100063470 3300005353 Bacteria 2719
17 Ga0070669_100273922 3300005353 Unclassified 1350
18 Ga0070669_100277610 3300005353 Bacteria 1342
19 Ga0070675_100011846 3300005354 Bacteria 6831
20 Ga0070674_100010109 3300005356 Bacteria 5686
21 Ga0070674_100315872 3300005356 Bacteria 1251
22 Ga0070673_100112912 3300005364 Bacteria 2256
23 Ga0070673_100341090 3300005364 Bacteria 1328
24 Ga0070667_100016931 3300005367 Bacteria 6032
25 Ga0070701_10002840 3300005438 Bacteria 6749
26 Ga0070701_10004573 3300005438 Bacteria 5626
27 Ga0070705_100017655 3300005440 Bacteria 3727
28 Ga0070700_100018325 3300005441 Bacteria 4024
29 Ga0070700_100037813 3300005441 Bacteria 2937
30 Ga0070700_100053682 3300005441 Bacteria 2516
31 Ga0070694_100009094 3300005444 Bacteria 6093
32 Ga0070694_100088355 3300005444 Bacteria 2170
33 Ga0070708_100037617 3300005445 Bacteria 4223
34 Ga0070708_100147750 3300005445 Bacteria 2184
35 Ga0070678_100044984 3300005456 Bacteria 3156
36 Ga0070678_100153403 3300005456 Bacteria 1858
37 Ga0070678_100189458 3300005456 Bacteria 1690
38 Ga0068867_100012554 3300005459 Bacteria 5991
39 Ga0068867_100050909 3300005459 Bacteria 3054
40 Ga0068867_100129260 3300005459 Bacteria 1961
41 Ga0068867_100136912 3300005459 Unclassified 1910
42 Ga0070685_10087801 3300005466 Bacteria 1877
43 Ga0070706_100008256 3300005467 Bacteria 9713
44 Ga0070706_100013739 3300005467 Bacteria 7486
45 Ga0070706_100181447 3300005467 Bacteria 1965
46 Ga0070707_100004281 3300005468 Bacteria 13373
47 Ga0070707_100005838 3300005468 Bacteria 11479
48 Ga0070707_100016681 3300005468 Bacteria 6895
49 Ga0070707_100031996 3300005468 Bacteria 5011
50 Ga0070698_100001691 3300005471 Bacteria 24608
51 Ga0070698_100336145 3300005471 Bacteria 1442
52 Ga0070699_100006167 3300005518 Bacteria 10474
53 Ga0070699_100008450 3300005518 Bacteria 8922
54 Ga0070699_100116873 3300005518 Bacteria 2344
55 Ga0070699_100387862 3300005518 Unclassified 1262
56 Ga0070697_100014426 3300005536 Bacteria 6206
57 Ga0070672_100259931 3300005543 Bacteria 1464
58 Ga0070672_100331416 3300005543 Bacteria 1295
59 Ga0070686_100000585 3300005544 Bacteria 21569
60 Ga0070686_100104873 3300005544 Bacteria 1916
61 Ga0070695_100005216 3300005545 Bacteria 7664
62 Ga0070695_100006225 3300005545 Bacteria 7051
63 Ga0070695_100325397 3300005545 Unclassified 1144
64 Ga0070696_100030738 3300005546 Bacteria 3679
65 Ga0070696_100049077 3300005546 Bacteria 2931
66 Ga0070696_100101982 3300005546 Bacteria 2057
67 Ga0070696_100166734 3300005546 Bacteria 1626
68 Ga0070665_100001505 3300005548 Bacteria 27126
69 Ga0070704_100008952 3300005549 Bacteria 6031
70 Ga0070704_100066019 3300005549 Bacteria 2607
71 Ga0070704_100335060 3300005549 Unclassified 1272
72 Ga0068857_100004626 3300005577 Bacteria 11660
73 Ga0068854_100012648 3300005578 Bacteria 5530
74 Ga0068854_100020086 3300005578 Bacteria 4512
75 Ga0070702_100001873 3300005615 Bacteria 8801
76 Ga0070702_100007657 3300005615 Bacteria 5180
77 Ga0068859_100001904 3300005617 Bacteria 21268
78 Ga0068859_100014769 3300005617 Bacteria 7846
79 Ga0068859_100056624 3300005617 Bacteria 3947
80 Ga0068859_100716570 3300005617 Unclassified 1091
81 Ga0068864_100046984 3300005618 Bacteria 3706
82 Ga0068864_100065640 3300005618 Bacteria 3148
83 Ga0068861_100020857 3300005719 Bacteria 4701
84 Ga0068861_100032639 3300005719 Bacteria 3834
85 Ga0068863_100010821 3300005841 Bacteria 8846
86 Ga0068863_100137801 3300005841 Bacteria 2331
87 Ga0068858_100014483 3300005842 Bacteria 7430
88 Ga0068858_100058087 3300005842 Bacteria 3576
89 Ga0068858_100067543 3300005842 Bacteria 3312
90 Ga0068858_100215120 3300005842 Bacteria 1819
91 Ga0068858_100332616 3300005842 Bacteria 1453
92 Ga0068860_100030546 3300005843 Bacteria 5182
93 Ga0068860_100440002 3300005843 Bacteria 1295
94 Ga0068862_100020698 3300005844 Bacteria 5496
95 Ga0068862_100315026 3300005844 Bacteria 1443
96 Ga0068862_100382814 3300005844 Bacteria 1312
97 Ga0081455_10014354 3300005937 Bacteria 7772
98 Ga0081539_10004763 3300005985 Bacteria 14649
99 Ga0075365_10021507 3300006038 Bacteria 4026
100 Ga0075368_10011373 3300006042 Bacteria 3237
101 Ga0075364_10074228 3300006051 Bacteria 2242
102 Ga0075432_10032072 3300006058 Bacteria 1820
103 Ga0075367_10009198 3300006178 Bacteria 5154
104 Ga0075366_10013686 3300006195 Bacteria 4625
105 Ga0075366_10014265 3300006195 Bacteria 4538
106 Ga0068871_100008766 3300006358 Bacteria 7282
107 Ga0068871_100085198 3300006358 Bacteria 2624
108 Ga0068871_100203561 3300006358 Bacteria 1710
109 Ga0075428_100028327 3300006844 Bacteria 6195
110 Ga0075428_100052117 3300006844 Bacteria 4486
111 Ga0075428_100091272 3300006844 Bacteria 3322
112 Ga0075428_100156810 3300006844 Bacteria 2472
113 Ga0075428_100248229 3300006844 Bacteria 1919
114 Ga0075428_100737843 3300006844 Bacteria 1048
115 Ga0075430_100143036 3300006846 Bacteria 1992
116 Ga0075430_100152471 3300006846 Bacteria 1924
117 Ga0075431_100074810 3300006847 Bacteria 3495
118 Ga0075431_100096363 3300006847 Bacteria 3054
119 Ga0075431_100210859 3300006847 Bacteria 1984
120 Ga0075433_10007640 3300006852 Bacteria 8585
121 Ga0075433_10021577 3300006852 Bacteria 5402
122 Ga0075433_10034152 3300006852 Bacteria 4366
123 Ga0075433_10068664 3300006852 Bacteria 3112
124 Ga0075433_10107940 3300006852 Bacteria 2469
125 Ga0075433_10128875 3300006852 Bacteria 2248
126 Ga0075434_100004060 3300006871 Bacteria 13124
127 Ga0075434_100026273 3300006871 Bacteria 5702
128 Ga0075434_100051462 3300006871 Bacteria 4094
129 Ga0075434_100209595 3300006871 Bacteria 1969
130 Ga0075429_100032322 3300006880 Bacteria 4548
131 Ga0075429_100049630 3300006880 Bacteria 3649
132 Ga0068865_100004343 3300006881 Bacteria 8553
133 Ga0068865_100020611 3300006881 Bacteria 4277
134 Ga0068865_100044828 3300006881 Bacteria 3029
135 Ga0075436_100015007 3300006914 Bacteria 5310
136 Ga0075436_100024572 3300006914 Bacteria 4142
137 Ga0075436_100044138 3300006914 Bacteria 3073
138 Ga0075436_100054461 3300006914 Bacteria 2761
139 Ga0097620_100001904 3300006931 Bacteria 21268
140 Ga0097620_100014769 3300006931 Bacteria 7846
141 Ga0097620_100056624 3300006931 Bacteria 3947
142 Ga0075435_100001012 3300007076 Bacteria 17824
143 Ga0075435_100001364 3300007076 Bacteria 15748
144 Ga0075435_100016808 3300007076 Bacteria 5521
145 Ga0075435_100017801 3300007076 Bacteria 5385
146 Ga0075435_100021500 3300007076 Bacteria 4964
147 Ga0075435_100099204 3300007076 Bacteria 2412
148 Ga0105240_10109134 3300009093 Bacteria 3352
149 Ga0105240_10147907 3300009093 Bacteria 2801
150 Ga0111539_10005268 3300009094 Bacteria 16742
151 Ga0111539_10009089 3300009094 Bacteria 12579
152 Ga0111539_10032902 3300009094 Bacteria 6297
153 Ga0111539_10055042 3300009094 Bacteria 4730
154 Ga0111539_10852404 3300009094 Bacteria 1060
155 Ga0105245_10133190 3300009098 Bacteria 2333
156 Ga0105245_10159799 3300009098 Bacteria 2137
157 Ga0105245_10408736 3300009098 Bacteria 1358
158 Ga0105247_10007049 3300009101 Bacteria 6912
159 Ga0114129_10001468 3300009147 Bacteria 31889
160 Ga0114129_10002276 3300009147 Bacteria 26562
161 Ga0114129_10012665 3300009147 Bacteria 12008
162 Ga0114129_10019392 3300009147 Bacteria 9685
163 Ga0114129_10019888 3300009147 Bacteria 9555
164 Ga0114129_10026433 3300009147 Bacteria 8218
165 Ga0114129_10057540 3300009147 Bacteria 5440
166 Ga0114129_10078599 3300009147 Bacteria 4588
167 Ga0114129_10081673 3300009147 Bacteria 4493
168 Ga0114129_10083107 3300009147 Bacteria 4449
169 Ga0114129_10088590 3300009147 Bacteria 4290
170 Ga0114129_10157141 3300009147 Bacteria 3108
171 Ga0114129_10189190 3300009147 Bacteria 2796
172 Ga0114129_10299877 3300009147 Bacteria 2142
173 Ga0114129_10453305 3300009147 Bacteria 1682
174 Ga0105243_10008565 3300009148 Bacteria 7849
175 Ga0105243_10011158 3300009148 Bacteria 6796
176 Ga0105243_10211655 3300009148 Bacteria 1707
177 Ga0105243_10214961 3300009148 Bacteria 1695
178 Ga0105241_10264373 3300009174 Bacteria 1463
179 Ga0105242_10000992 3300009176 Bacteria 22210
180 Ga0105242_10003809 3300009176 Bacteria 11731
181 Ga0105248_10003548 3300009177 Bacteria 17288
182 Ga0105248_10016809 3300009177 Bacteria 8054
183 Ga0105248_10021472 3300009177 Bacteria 7151
184 Ga0105248_10205973 3300009177 Bacteria 2216
185 Ga0105248_10330153 3300009177 Bacteria 1718
186 Ga0105249_10060591 3300009553 Bacteria 3472
187 Ga0105249_10192770 3300009553 Unclassified 1990
188 Ga0105246_10107583 3300011119 Bacteria 2042
189 Ga0157374_10009099 3300013296 Bacteria 8512
190 Ga0157378_10190704 3300013297 Bacteria 1933
191 Ga0163162_10018582 3300013306 Bacteria 6811
192 Ga0157375_10028254 3300013308 Bacteria 5255
193 Ga0157375_10182304 3300013308 Bacteria 2252
194 Ga0163163_10017244 3300014325 Bacteria 6731
195 Ga0163163_10154419 3300014325 Bacteria 2339
196 Ga0157380_10029155 3300014326 Bacteria 4217
197 Ga0157380_10031855 3300014326 Bacteria 4050
198 Ga0157380_10037147 3300014326 Bacteria 3772
199 Ga0157380_10429434 3300014326 Bacteria 1263
200 Ga0157379_10083137 3300014968 Bacteria 2869
201 Ga0157379_10147679 3300014968 Bacteria 2120
202 Ga0157376_10037826 3300014969 Bacteria 3922
203 Ga0157376_10342884 3300014969 Bacteria 1427
204 Ga0207653_10027562 3300025885 Bacteria 1824
205 Ga0207710_10010384 3300025900 Bacteria 3921
206 Ga0207680_10022242 3300025903 Bacteria 3445
207 Ga0207680_10107837 3300025903 Bacteria 1801
208 Ga0207645_10010107 3300025907 Bacteria 6495
209 Ga0207643_10019756 3300025908 Bacteria 3693
210 Ga0207684_10007958 3300025910 Bacteria 9474
211 Ga0207684_10149994 3300025910 Bacteria 2006
212 Ga0207654_10167171 3300025911 Bacteria 1425
213 Ga0207695_10113552 3300025913 Bacteria 2685
214 Ga0207660_10148010 3300025917 Bacteria 1802
215 Ga0207662_10071249 3300025918 Bacteria 2104
216 Ga0207646_10005054 3300025922 Bacteria 14028
217 Ga0207646_10067182 3300025922 Bacteria 3201
218 Ga0207646_10073279 3300025922 Bacteria 3059
219 Ga0207646_10102936 3300025922 Bacteria 2560
220 Ga0207681_10287982 3300025923 Unclassified 1295
221 Ga0207650_10008122 3300025925 Bacteria 7152
222 Ga0207650_10056998 3300025925 Bacteria 2905
223 Ga0207659_10114814 3300025926 Bacteria 2053
224 Ga0207690_10032845 3300025932 Bacteria 3333
225 Ga0207706_10014098 3300025933 Bacteria 7247
226 Ga0207706_10092388 3300025933 Bacteria 2661
227 Ga0207706_10233379 3300025933 Unclassified 1609
228 Ga0207686_10005858 3300025934 Bacteria 6596
229 Ga0207686_10014955 3300025934 Bacteria 4330
230 Ga0207709_10092985 3300025935 Bacteria 1976
231 Ga0207670_10021297 3300025936 Bacteria 3998
232 Ga0207669_10004265 3300025937 Bacteria 6276
233 Ga0207704_10037717 3300025938 Bacteria 2794
234 Ga0207704_10156812 3300025938 Bacteria 1614
235 Ga0207711_10066102 3300025941 Bacteria 3127
236 Ga0207711_10091860 3300025941 Bacteria 2670
237 Ga0207689_10006571 3300025942 Bacteria 10253
238 Ga0207689_10017627 3300025942 Bacteria 6037
239 Ga0207679_10063118 3300025945 Bacteria 2764
240 Ga0207712_10060877 3300025961 Bacteria 2678
241 Ga0207712_10096796 3300025961 Bacteria 2185
242 Ga0207668_10324296 3300025972 Unclassified 1279
243 Ga0207640_10001726 3300025981 Bacteria 11726
244 Ga0207640_10009312 3300025981 Bacteria 5494
245 Ga0207658_10100702 3300025986 Bacteria 2262
246 Ga0207658_10268505 3300025986 Unclassified 1457
247 Ga0207703_10044093 3300026035 Bacteria 3583
248 Ga0207703_10045359 3300026035 Bacteria 3536
249 Ga0207703_10265284 3300026035 Bacteria 1554
250 Ga0207708_10002297 3300026075 Bacteria 14057
251 Ga0207708_10008120 3300026075 Bacteria 7773
252 Ga0207708_10029910 3300026075 Bacteria 4130
253 Ga0207708_10145936 3300026075 Bacteria 1859
254 Ga0207641_10014633 3300026088 Bacteria 6432
255 Ga0207648_10002841 3300026089 Bacteria 18343
256 Ga0207648_10025986 3300026089 Bacteria 5207
257 Ga0207648_10154883 3300026089 Bacteria 2023
258 Ga0207676_10041208 3300026095 Bacteria 3543
259 Ga0207674_10007413 3300026116 Bacteria 12784
260 Ga0207674_10199700 3300026116 Bacteria 1949
261 Ga0207675_100036360 3300026118 Bacteria 4594
262 Ga0207675_100045495 3300026118 Bacteria 4100
263 Ga0207675_100047229 3300026118 Bacteria 4020
264 Ga0207675_100064598 3300026118 Bacteria 3421
265 Ga0207675_100238759 3300026118 Bacteria 1756
266 Ga0207683_10033336 3300026121 Bacteria 4473
267 Ga0207683_10069801 3300026121 Bacteria 3103
268 Ga0207683_10070732 3300026121 Bacteria 3083
269 Ga0207428_10000139 3300027907 Bacteria 98277
270 Ga0207428_10034923 3300027907 Bacteria 4115
271 Ga0207428_10043105 3300027907 Bacteria 3646
272 Ga0207428_10076700 3300027907 Bacteria 2617
273 Ga0268266_10020122 3300028379 Bacteria 5689
274 Ga0268266_10026781 3300028379 Bacteria 4906
275 Ga0268265_10235015 3300028380 Unclassified 1613
276 Ga0268264_10224045 3300028381 Bacteria 1733
277 Ga0307408_100085763 3300031548 Bacteria 2365
278 Ga0307408_100334721 3300031548 Unclassified 1279
279 Ga0307408_100407937 3300031548 Bacteria 1168
280 Ga0307406_10072826 3300031901 Bacteria 2257
281 Ga0307412_10139758 3300031911 Bacteria 1772
282 Ga0307412_10238720 3300031911 Bacteria 1404
283 Ga0307411_10080465 3300032005 Bacteria 2240
284 Ga0373950_0000125 3300034818 Bacteria 13264
285 Ga0373958_0008116 3300034819 Bacteria 1693
286 Ga0373959_0002052 3300034820 Bacteria 3214
287 Ga0373938_0000240 3300034957 Bacteria 8530
288 Ga0373928_0002738 3300035084 Bacteria 3403
289 Ga0373929_0001025 3300035085 Bacteria 5425
290 Ga0373949_0000368 3300035090 Bacteria 15951
291 Ga0373951_0006438 3300035091 Bacteria 2685
292 Ga0373952_0000893 3300035092 Bacteria 5425
293 Ga0373932_0001404 3300035112 Bacteria 6747
294 Ga0373939_0027740 3300035114 Bacteria 1606
295 Ga0373941_0000812 3300035115 Bacteria 6403
296 Ga0373960_0019216 3300035121 Bacteria 1792
297 Ga0373955_0007200 3300035172 Bacteria 5102
298 Ga0373942_0000385 3300035207 Bacteria 12202
299 Ga0373961_0001950 3300035241 Bacteria 5590
300 Ga0373961_0016017 3300035241 Bacteria 1927
301 Ga0373962_0004865 3300035242 Bacteria 3246
302 Ga0373937_0033634 3300036401 Bacteria 4658
303 Ga0373937_0101739 3300036401 Bacteria 2667
304 Ga0373937_0293048 3300036401 Bacteria 1537
305 Ga0439431_0004721 3300041997 Bacteria 2997
306 Ga0439433_0003686 3300041999 Bacteria 3290
307 Ga0439442_024884 3300042002 Bacteria 1246
308 Ga0439464_0000947 3300042439 Bacteria 6547
309 Ga0451576_0029882 3300045051 Bacteria 5829
310 Ga0451576_0035619 3300045051 Bacteria 5279
311 Ga0495638_0001351 3300046460 Bacteria 22516
312 Ga0495638_0007282 3300046460 Bacteria 7953
313 Ga0495653_0275344 3300046463 Unclassified 1107
314 Ga0495584_0000198 3300046491 Bacteria 42784
315 Ga0495585_0067685 3300046492 Bacteria 1952
316 Ga0495634_0079585 3300046642 Bacteria 2146
317 Ga0495635_0102989 3300046663 Bacteria 1951
318 Ga0495661_0080565 3300046665 Bacteria 1878
319 Ga0495647_0087838 3300046681 Bacteria 1270
320 Ga0495658_0053077 3300046683 Bacteria 2301
321 Ga0496102_0433951 3300048905 Bacteria 1233
322 Ga0496104_0125674 3300048907 Unclassified 2463
323 Ga0496106_0345211 3300048909 Bacteria 1195
324 Ga0496107_0283209 3300048910 Bacteria 1234
325 Ga0496108_0030105 3300048911 Bacteria 4499
326 Ga0496112_0060873 3300048915 Bacteria 3720
327 Ga0496112_0162360 3300048915 Bacteria 2201
328 Ga0496114_0137248 3300048917 Bacteria 2115
329 Ga0496114_0168472 3300048917 Bacteria 1908
330 Ga0496115_0132510 3300048918 Bacteria 2054
331 Ga0501291_009976 3300049514 Bacteria 1342
332 Ga0501299_004292 3300049522 Bacteria 2121
333 Ga0501036_0126577 3300049572 Bacteria 2158
334 Ga0501040_0141848 3300049576 Bacteria 1693
335 Ga0501042_0106058 3300049578 Bacteria 2022
336 Ga0501067_0099202 3300049583 Bacteria 1618
337 Ga0501068_0179013 3300049584 Unclassified 1340
338 Ga0501071_0040818 3300049587 Bacteria 3322
339 Ga0501072_0030002 3300049588 Bacteria 4250
340 Ga0501074_0070230 3300049590 Bacteria 2518
341 Ga0501075_0024767 3300049591 Bacteria 4406
342 Ga0501075_0051048 3300049591 Bacteria 3109
343 Ga0501076_0032790 3300049592 Bacteria 4056
344 Ga0501076_0149776 3300049592 Unclassified 1898
345 Ga0501217_012787 3300049661 Bacteria 1875
346 Ga0501079_0050405 3300049741 Bacteria 3214
347 Ga0501080_0225960 3300049742 Bacteria 1712
348 Ga0501081_0081745 3300049743 Bacteria 2263
349 Ga0501081_0257026 3300049743 Bacteria 1276
350 Ga0501045_0092792 3300049824 Bacteria 2233
351 Ga0501045_0169376 3300049824 Bacteria 1627
352 nmdc:mga03683_36138_c1 3300050489 Bacteria 2008
353 nmdc:mga0k408_26282_c1 3300050493 Bacteria 3300
354 nmdc:mga06z11_9707_c1 3300050494 Bacteria 4065
355 nmdc:mga05p37_173510_c1 3300050507 Bacteria 2628
356 nmdc:mga05p37_201177_c1 3300050507 Bacteria 2412
357 nmdc:mga05p37_211576_c1 3300050507 Bacteria 2344
358 nmdc:mga05p37_22199_c1 3300050507 Bacteria 7694
359 nmdc:mga05p37_284204_c1 3300050507 Bacteria 1972
360 nmdc:mga05p37_38721_c1 3300050507 Bacteria 5849
361 nmdc:mga05p37_43831_c1 3300050507 Bacteria 5505
362 nmdc:mga05p37_44628_c1 3300050507 Bacteria 5454
363 nmdc:mga05p37_45501_c1 3300050507 Bacteria 5397
364 nmdc:mga05p37_66140_c1 3300050507 Bacteria 4446
365 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
366 nmdc:mga05p37_69565_c1 3300050507 Bacteria 3987
367 nmdc:mga09592_112340_c1 3300050508 Bacteria 2337
368 nmdc:mga09592_171042_c1 3300050508 Bacteria 1879
369 nmdc:mga09592_22383_c1 3300050508 Bacteria 5215
370 nmdc:mga09592_39564_c1 3300050508 Bacteria 3961
371 nmdc:mga0qj67_49492_c1 3300050509 Bacteria 3322
372 nmdc:mga06r32_119970_c1 3300050510 Bacteria 2593
373 nmdc:mga06r32_121422_c1 3300050510 Bacteria 2578
374 nmdc:mga06r32_147524_c1 3300050510 Bacteria 2330
375 nmdc:mga06r32_32262_c1 3300050510 Bacteria 4927
376 nmdc:mga06r32_97385_c1 3300050510 Bacteria 2882
377 nmdc:mga08y16_17853_c2 3300050511 Bacteria 7111
378 nmdc:mga08y16_289116_c1 3300050511 Bacteria 1690
379 nmdc:mga08y16_31736_c1 3300050511 Bacteria 5554
380 nmdc:mga08y16_9106_c1 3300050511 Bacteria 10425
381 nmdc:mga0n895_101116_c1 3300050512 Bacteria 2892
382 nmdc:mga0n895_206310_c1 3300050512 Bacteria 1996
383 nmdc:mga0n895_2922_c1 3300050512 Bacteria 13544
384 nmdc:mga0n895_45978_c1 3300050512 Bacteria 4263
385 nmdc:mga0n895_53142_c1 3300050512 Bacteria 3979
386 nmdc:mga0n895_68009_c1 3300050512 Bacteria 3528
387 nmdc:mga0rr50_125354_c1 3300050513 Bacteria 2050
388 nmdc:mga0rr50_21406_c1 3300050513 Bacteria 4414
389 nmdc:mga0rr50_2144_c1 3300050513 Bacteria 11031
390 nmdc:mga0rr50_217175_c1 3300050513 Bacteria 1578
391 nmdc:mga0rr50_63574_c1 3300050513 Bacteria 2787
392 nmdc:mga08x19_10108_c1 3300050514 Bacteria 5660
393 nmdc:mga08x19_30469_c1 3300050514 Bacteria 3389
394 nmdc:mga08x19_7519_c1 3300050514 Bacteria 6473
395 nmdc:mga08x19_97015_c1 3300050514 Bacteria 1951
396 nmdc:mga0a205_15122_c1 3300050515 Bacteria 7208
397 nmdc:mga0a205_23329_c1 3300050515 Bacteria 5868
398 nmdc:mga0a205_4603_c1 3300050515 Bacteria 12368
399 nmdc:mga0a205_97301_c1 3300050515 Bacteria 2842
400 Ga0501084_0019033 3300054114 Bacteria 5718
401 Ga0590071_000567 3300059421 Bacteria 10670
402 Ga0590074_000928 3300059423 Bacteria 4585
403 Ga0590075_001923 3300059424 Bacteria 5034
404 Ga0501082_0099543 3300060353 Bacteria 2514
405 Ga0501082_0210259 3300060353 Bacteria 1693
406 Ga0070671_100023328
407 SwRhRL3b_contig_494398
408 Ga0065715_10222482
409 Ga0070676_10011010
410 Ga0070676_10024120
411 Ga0070690_100038989
412 Ga0070670_100015938
413 Ga0068869_100003285
414 Ga0068869_100030821
415 Ga0068868_100017264
416 Ga0070689_100018846
417 Ga0070691_10003314
418 Ga0070687_100031176
419 Ga0070668_100025055
420 Ga0070669_100007157
421 Ga0070669_100063470
422 Ga0070669_100273922
423 Ga0070669_100277610
424 Ga0070675_100011846
425 Ga0070674_100010109
426 Ga0070674_100315872
427 Ga0070673_100112912
428 Ga0070673_100341090
429 Ga0070667_100016931
430 Ga0070701_10002840
431 Ga0070701_10004573
432 Ga0070705_100017655
433 Ga0070700_100018325
434 Ga0070700_100037813
435 Ga0070700_100053682
436 Ga0070694_100009094
437 Ga0070694_100088355
438 Ga0070708_100037617
439 Ga0070708_100147750
440 Ga0070678_100044984
441 Ga0070678_100153403
442 Ga0070678_100189458
443 Ga0068867_100012554
444 Ga0068867_100050909
445 Ga0068867_100129260
446 Ga0068867_100136912
447 Ga0070685_10087801
448 Ga0070706_100008256
449 Ga0070706_100013739
450 Ga0070706_100181447
451 Ga0070707_100004281
452 Ga0070707_100005838
453 Ga0070707_100016681
454 Ga0070707_100031996
455 Ga0070698_100001691
456 Ga0070698_100336145
457 Ga0070699_100006167
458 Ga0070699_100008450
459 Ga0070699_100116873
460 Ga0070699_100387862
461 Ga0070697_100014426
462 Ga0070672_100259931
463 Ga0070672_100331416
464 Ga0070686_100000585
465 Ga0070686_100104873
466 Ga0070695_100005216
467 Ga0070695_100006225
468 Ga0070695_100325397
469 Ga0070696_100030738
470 Ga0070696_100049077
471 Ga0070696_100101982
472 Ga0070696_100166734
473 Ga0070665_100001505
474 Ga0070704_100008952
475 Ga0070704_100066019
476 Ga0070704_100335060
477 Ga0068857_100004626
478 Ga0068854_100012648
479 Ga0068854_100020086
480 Ga0070702_100001873
481 Ga0070702_100007657
482 Ga0068859_100001904
483 Ga0068859_100014769
484 Ga0068859_100056624
485 Ga0068859_100716570
486 Ga0068864_100046984
487 Ga0068864_100065640
488 Ga0068861_100020857
489 Ga0068861_100032639
490 Ga0068863_100010821
491 Ga0068863_100137801
492 Ga0068858_100014483
493 Ga0068858_100058087
494 Ga0068858_100067543
495 Ga0068858_100215120
496 Ga0068858_100332616
497 Ga0068860_100030546
498 Ga0068860_100440002
499 Ga0068862_100020698
500 Ga0068862_100315026
501 Ga0068862_100382814
502 Ga0081455_10014354
503 Ga0081539_10004763
504 Ga0075365_10021507
505 Ga0075368_10011373
506 Ga0075364_10074228
507 Ga0075432_10032072
508 Ga0075367_10009198
509 Ga0075366_10013686
510 Ga0075366_10014265
511 Ga0068871_100008766
512 Ga0068871_100085198
513 Ga0068871_100203561
514 Ga0075428_100028327
515 Ga0075428_100052117
516 Ga0075428_100091272
517 Ga0075428_100156810
518 Ga0075428_100248229
519 Ga0075428_100737843
520 Ga0075430_100143036
521 Ga0075430_100152471
522 Ga0075431_100074810
523 Ga0075431_100096363
524 Ga0075431_100210859
525 Ga0075433_10007640
526 Ga0075433_10021577
527 Ga0075433_10034152
528 Ga0075433_10068664
529 Ga0075433_10107940
530 Ga0075433_10128875
531 Ga0075434_100004060
532 Ga0075434_100026273
533 Ga0075434_100051462
534 Ga0075434_100209595
535 Ga0075429_100032322
536 Ga0075429_100049630
537 Ga0068865_100004343
538 Ga0068865_100020611
539 Ga0068865_100044828
540 Ga0075436_100015007
541 Ga0075436_100024572
542 Ga0075436_100044138
543 Ga0075436_100054461
544 Ga0097620_100001904
545 Ga0097620_100014769
546 Ga0097620_100056624
547 Ga0075435_100001012
548 Ga0075435_100001364
549 Ga0075435_100016808
550 Ga0075435_100017801
551 Ga0075435_100021500
552 Ga0075435_100099204
553 Ga0105240_10109134
554 Ga0105240_10147907
555 Ga0111539_10005268
556 Ga0111539_10009089
557 Ga0111539_10032902
558 Ga0111539_10055042
559 Ga0111539_10852404
560 Ga0105245_10133190
561 Ga0105245_10159799
562 Ga0105245_10408736
563 Ga0105247_10007049
564 Ga0114129_10001468
565 Ga0114129_10002276
566 Ga0114129_10012665
567 Ga0114129_10019392
568 Ga0114129_10019888
569 Ga0114129_10026433
570 Ga0114129_10057540
571 Ga0114129_10078599
572 Ga0114129_10081673
573 Ga0114129_10083107
574 Ga0114129_10088590
575 Ga0114129_10157141
576 Ga0114129_10189190
577 Ga0114129_10299877
578 Ga0114129_10453305
579 Ga0105243_10008565
580 Ga0105243_10011158
581 Ga0105243_10211655
582 Ga0105243_10214961
583 Ga0105241_10264373
584 Ga0105242_10000992
585 Ga0105242_10003809
586 Ga0105248_10003548
587 Ga0105248_10016809
588 Ga0105248_10021472
589 Ga0105248_10205973
590 Ga0105248_10330153
591 Ga0105249_10060591
592 Ga0105249_10192770
593 Ga0105246_10107583
594 Ga0157374_10009099
595 Ga0157378_10190704
596 Ga0163162_10018582
597 Ga0157375_10028254
598 Ga0157375_10182304
599 Ga0163163_10017244
600 Ga0163163_10154419
601 Ga0157380_10029155
602 Ga0157380_10031855
603 Ga0157380_10037147
604 Ga0157380_10429434
605 Ga0157379_10083137
606 Ga0157379_10147679
607 Ga0157376_10037826
608 Ga0157376_10342884
609 Ga0207653_10027562
610 Ga0207710_10010384
611 Ga0207680_10022242
612 Ga0207680_10107837
613 Ga0207645_10010107
614 Ga0207643_10019756
615 Ga0207684_10007958
616 Ga0207684_10149994
617 Ga0207654_10167171
618 Ga0207695_10113552
619 Ga0207660_10148010
620 Ga0207662_10071249
621 Ga0207646_10005054
622 Ga0207646_10067182
623 Ga0207646_10073279
624 Ga0207646_10102936
625 Ga0207681_10287982
626 Ga0207650_10008122
627 Ga0207650_10056998
628 Ga0207659_10114814
629 Ga0207690_10032845
630 Ga0207706_10014098
631 Ga0207706_10092388
632 Ga0207706_10233379
633 Ga0207686_10005858
634 Ga0207686_10014955
635 Ga0207709_10092985
636 Ga0207670_10021297
637 Ga0207669_10004265
638 Ga0207704_10037717
639 Ga0207704_10156812
640 Ga0207711_10066102
641 Ga0207711_10091860
642 Ga0207689_10006571
643 Ga0207689_10017627
644 Ga0207679_10063118
645 Ga0207712_10060877
646 Ga0207712_10096796
647 Ga0207668_10324296
648 Ga0207640_10001726
649 Ga0207640_10009312
650 Ga0207658_10100702
651 Ga0207658_10268505
652 Ga0207703_10044093
653 Ga0207703_10045359
654 Ga0207703_10265284
655 Ga0207708_10002297
656 Ga0207708_10008120
657 Ga0207708_10029910
658 Ga0207708_10145936
659 Ga0207641_10014633
660 Ga0207648_10002841
661 Ga0207648_10025986
662 Ga0207648_10154883
663 Ga0207676_10041208
664 Ga0207674_10007413
665 Ga0207674_10199700
666 Ga0207675_100036360
667 Ga0207675_100045495
668 Ga0207675_100047229
669 Ga0207675_100064598
670 Ga0207675_100238759
671 Ga0207683_10033336
672 Ga0207683_10069801
673 Ga0207683_10070732
674 Ga0207428_10000139
675 Ga0207428_10034923
676 Ga0207428_10043105
677 Ga0207428_10076700
678 Ga0268266_10020122
679 Ga0268266_10026781
680 Ga0268265_10235015
681 Ga0268264_10224045
682 Ga0307408_100085763
683 Ga0307408_100334721
684 Ga0307408_100407937
685 Ga0307406_10072826
686 Ga0307412_10139758
687 Ga0307412_10238720
688 Ga0307411_10080465
689 Ga0373950_0000125
690 Ga0373958_0008116
691 Ga0373959_0002052
692 Ga0373938_0000240
693 Ga0373928_0002738
694 Ga0373929_0001025
695 Ga0373949_0000368
696 Ga0373951_0006438
697 Ga0373952_0000893
698 Ga0373932_0001404
699 Ga0373939_0027740
700 Ga0373941_0000812
701 Ga0373960_0019216
702 Ga0373955_0007200
703 Ga0373942_0000385
704 Ga0373961_0001950
705 Ga0373961_0016017
706 Ga0373962_0004865
707 Ga0373937_0033634
708 Ga0373937_0101739
709 Ga0373937_0293048
710 Ga0439431_0004721
711 Ga0439433_0003686
712 Ga0439442_024884
713 Ga0439464_0000947
714 Ga0451576_0029882
715 Ga0451576_0035619
716 Ga0495638_0001351
717 Ga0495638_0007282
718 Ga0495653_0275344
719 Ga0495584_0000198
720 Ga0495585_0067685
721 Ga0495634_0079585
722 Ga0495635_0102989
723 Ga0495661_0080565
724 Ga0495647_0087838
725 Ga0495658_0053077
726 Ga0496102_0433951
727 Ga0496104_0125674
728 Ga0496106_0345211
729 Ga0496107_0283209
730 Ga0496108_0030105
731 Ga0496112_0060873
732 Ga0496112_0162360
733 Ga0496114_0137248
734 Ga0496114_0168472
735 Ga0496115_0132510
736 Ga0501291_009976
737 Ga0501299_004292
738 Ga0501036_0126577
739 Ga0501040_0141848
740 Ga0501042_0106058
741 Ga0501067_0099202
742 Ga0501068_0179013
743 Ga0501071_0040818
744 Ga0501072_0030002
745 Ga0501074_0070230
746 Ga0501075_0024767
747 Ga0501075_0051048
748 Ga0501076_0032790
749 Ga0501076_0149776
750 Ga0501217_012787
751 Ga0501079_0050405
752 Ga0501080_0225960
753 Ga0501081_0081745
754 Ga0501081_0257026
755 Ga0501045_0092792
756 Ga0501045_0169376
757 nmdc:mga03683_36138_c1
758 nmdc:mga0k408_26282_c1
759 nmdc:mga06z11_9707_c1
760 nmdc:mga05p37_173510_c1
761 nmdc:mga05p37_201177_c1
762 nmdc:mga05p37_211576_c1
763 nmdc:mga05p37_22199_c1
764 nmdc:mga05p37_284204_c1
765 nmdc:mga05p37_38721_c1
766 nmdc:mga05p37_43831_c1
767 nmdc:mga05p37_44628_c1
768 nmdc:mga05p37_45501_c1
769 nmdc:mga05p37_66140_c1
770 nmdc:mga05p37_687_c1
771 nmdc:mga05p37_69565_c1
772 nmdc:mga09592_112340_c1
773 nmdc:mga09592_171042_c1
774 nmdc:mga09592_22383_c1
775 nmdc:mga09592_39564_c1
776 nmdc:mga0qj67_49492_c1
777 nmdc:mga06r32_119970_c1
778 nmdc:mga06r32_121422_c1
779 nmdc:mga06r32_147524_c1
780 nmdc:mga06r32_32262_c1
781 nmdc:mga06r32_97385_c1
782 nmdc:mga08y16_17853_c2
783 nmdc:mga08y16_289116_c1
784 nmdc:mga08y16_31736_c1
785 nmdc:mga08y16_9106_c1
786 nmdc:mga0n895_101116_c1
787 nmdc:mga0n895_206310_c1
788 nmdc:mga0n895_2922_c1
789 nmdc:mga0n895_45978_c1
790 nmdc:mga0n895_53142_c1
791 nmdc:mga0n895_68009_c1
792 nmdc:mga0rr50_125354_c1
793 nmdc:mga0rr50_21406_c1
794 nmdc:mga0rr50_2144_c1
795 nmdc:mga0rr50_217175_c1
796 nmdc:mga0rr50_63574_c1
797 nmdc:mga08x19_10108_c1
798 nmdc:mga08x19_30469_c1
799 nmdc:mga08x19_7519_c1
800 nmdc:mga08x19_97015_c1
801 nmdc:mga0a205_15122_c1
802 nmdc:mga0a205_23329_c1
803 nmdc:mga0a205_4603_c1
804 nmdc:mga0a205_97301_c1
805 Ga0501084_0019033
806 Ga0590071_000567
807 Ga0590074_000928
808 Ga0590075_001923
809 Ga0501082_0099543
810 Ga0501082_0210259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

73

336

0.97

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

70

325

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksm-assembly3.cif.gz_B crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9493 30 306
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9472 27 313
2gx6-assembly1.cif.gz_A rational stabilization of e. coli ribose binding protein 0.9452 27 307
3ksm-assembly2.cif.gz_A crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9424 29 306
3ksm-assembly3.cif.gz_B crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9393 30 306
ID Description Score Start End Superfamily
3ksmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 30 128 3.40.50.2300
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9632 29 130 3.40.50.2300
af_P39265_27_132_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9594 31 124 3.40.50.2300
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9578 30 128 3.40.50.2300
5dteD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9389 27 124 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3M1X2L0-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9652 20 318 GO:0030246
GO:0030313
AF-A0A2D5ISX9-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9614 61 321 GO:0030246
GO:0030313
AF-A0A7V2TS05-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9595 237 322 GO:0030246
GO:0030313
AF-A0A536JKV2-F1-model_v4 Substrate-binding domain-containing protein 0.9583 26 319 GO:0030246
GO:0030313
AF-A0A2V9IGR4-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9553 19 324 GO:0030246
GO:0030313

Map