F435871

General Info

Members Datasets Scaffolds Average Seq Length
405 259 810 124

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_101227726|Ga0070687_1012277262
Length 130
Sequence MTDQRSDQVFVSGLALHAYHGVMQHEAKVGQTFNLDLVLDIDLTEASRSDKLADTVGYDQVVDVASEAFRARRYRLVEAAAGAVAEAVLARFEQVTAIRVTIHKPHAPVAATFDDVGVSIFRNRPGRKNG

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 9.88
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_101227726 3300005343 Bacteria 554
2 Ga0065715_10828947 3300005293 Unclassified 599
3 Ga0065715_11150446 3300005293 Bacteria 509
4 Ga0070683_101504000 3300005329 Bacteria 647
5 Ga0070670_100023987 3300005331 Bacteria 5248
6 Ga0070666_10264522 3300005335 Bacteria 1220
7 Ga0070680_101687401 3300005336 Unclassified 549
8 Ga0070682_101369285 3300005337 Bacteria 604
9 Ga0070689_100140975 3300005340 Bacteria 1939
10 Ga0070661_100219239 3300005344 Bacteria 1459
11 Ga0070668_101847780 3300005347 Bacteria 556
12 Ga0070668_102260098 3300005347 Bacteria 503
13 Ga0070669_100145129 3300005353 Bacteria 1833
14 Ga0070675_102005365 3300005354 Unclassified 534
15 Ga0070671_100731086 3300005355 Bacteria 860
16 Ga0070674_100008072 3300005356 Bacteria 6243
17 Ga0070673_100286353 3300005364 Bacteria 1447
18 Ga0070673_100873713 3300005364 Bacteria 833
19 Ga0070673_101557495 3300005364 Bacteria 624
20 Ga0070688_101123263 3300005365 Bacteria 629
21 Ga0070709_10069544 3300005434 Bacteria 2268
22 Ga0070709_10634054 3300005434 Bacteria 826
23 Ga0070714_100034975 3300005435 Bacteria 4208
24 Ga0070714_100086639 3300005435 Bacteria 2737
25 Ga0070713_100184867 3300005436 Bacteria 1875
26 Ga0070713_100228760 3300005436 Bacteria 1690
27 Ga0070713_101689539 3300005436 Unclassified 615
28 Ga0070705_100312874 3300005440 Bacteria 1130
29 Ga0070700_100525003 3300005441 Bacteria 915
30 Ga0070663_101200119 3300005455 Bacteria 667
31 Ga0070678_100172749 3300005456 Bacteria 1762
32 Ga0070662_100844300 3300005457 Unclassified 780
33 Ga0070662_101327718 3300005457 Bacteria 619
34 Ga0070681_10683530 3300005458 Bacteria 942
35 Ga0070686_100490177 3300005544 Bacteria 952
36 Ga0070686_100777470 3300005544 Bacteria 770
37 Ga0070696_100088280 3300005546 Bacteria 2203
38 Ga0070665_100035718 3300005548 Bacteria 4999
39 Ga0068856_100616790 3300005614 Bacteria 1106
40 Ga0068856_101359276 3300005614 Bacteria 725
41 Ga0070702_100342927 3300005615 Bacteria 1049
42 Ga0068864_102285582 3300005618 Bacteria 547
43 Ga0068863_101183593 3300005841 Bacteria 770
44 Ga0068858_100071686 3300005842 Bacteria 3214
45 Ga0068858_101238335 3300005842 Bacteria 734
46 Ga0081455_10001167 3300005937 Bacteria 32856
47 Ga0081455_10169658 3300005937 Bacteria 1664
48 Ga0081540_1047176 3300005983 Bacteria 2168
49 Ga0070717_10019850 3300006028 Bacteria 5277
50 Ga0070717_10171940 3300006028 Bacteria 1885
51 Ga0070717_11152246 3300006028 Bacteria 706
52 Ga0075368_10023619 3300006042 Bacteria 2350
53 Ga0075363_100160045 3300006048 Bacteria 1274
54 Ga0075363_100643030 3300006048 Bacteria 638
55 Ga0075364_10263641 3300006051 Bacteria 1171
56 Ga0075364_10460048 3300006051 Bacteria 869
57 Ga0075364_10630845 3300006051 Bacteria 732
58 Ga0070715_10020835 3300006163 Bacteria 2533
59 Ga0070716_100013738 3300006173 Bacteria 4134
60 Ga0070716_100775867 3300006173 Bacteria 740
61 Ga0070712_100179338 3300006175 Bacteria 1649
62 Ga0070712_101151466 3300006175 Unclassified 674
63 Ga0075367_10114199 3300006178 Bacteria 1660
64 Ga0075367_10229003 3300006178 Bacteria 1164
65 Ga0075366_10748083 3300006195 Bacteria 607
66 Ga0097621_101103372 3300006237 Bacteria 745
67 Ga0075370_10054220 3300006353 Bacteria 2276
68 Ga0075370_10350199 3300006353 Bacteria 882
69 Ga0075428_101031762 3300006844 Bacteria 870
70 Ga0075428_101349820 3300006844 Bacteria 749
71 Ga0075430_100004348 3300006846 Bacteria 11969
72 Ga0075431_100005249 3300006847 Bacteria 12758
73 Ga0075431_100605961 3300006847 Bacteria 1079
74 Ga0075433_10032028 3300006852 Bacteria 4500
75 Ga0075434_100025834 3300006871 Bacteria 5748
76 Ga0075434_100470867 3300006871 Bacteria 1278
77 Ga0075434_101345412 3300006871 Unclassified 725
78 Ga0068865_100886621 3300006881 Bacteria 775
79 Ga0075435_100238627 3300007076 Bacteria 1546
80 Ga0075435_100301732 3300007076 Bacteria 1370
81 Ga0075435_101296160 3300007076 Bacteria 638
82 Ga0099795_10178132 3300007788 Bacteria 886
83 Ga0111539_10008421 3300009094 Bacteria 13120
84 Ga0111539_10142470 3300009094 Bacteria 2806
85 Ga0111539_10464652 3300009094 Bacteria 1473
86 Ga0105245_10808901 3300009098 Bacteria 975
87 Ga0105247_11020436 3300009101 Bacteria 647
88 Ga0114129_10013040 3300009147 Bacteria 11839
89 Ga0114129_10113255 3300009147 Bacteria 3741
90 Ga0114129_10189497 3300009147 Bacteria 2794
91 Ga0105243_10702919 3300009148 Bacteria 986
92 Ga0105248_10594049 3300009177 Bacteria 1249
93 Ga0105237_12184782 3300009545 Bacteria 563
94 Ga0105238_10564187 3300009551 Bacteria 1144
95 Ga0105246_10671778 3300011119 Bacteria 904
96 Ga0105246_11042854 3300011119 Bacteria 743
97 Ga0157374_11242256 3300013296 Bacteria 767
98 Ga0157378_10702661 3300013297 Bacteria 1031
99 Ga0157375_10518892 3300013308 Bacteria 1355
100 Ga0157375_12075977 3300013308 Bacteria 676
101 Ga0163163_10367548 3300014325 Bacteria 1495
102 Ga0163163_11196613 3300014325 Bacteria 822
103 Ga0157380_10207668 3300014326 Bacteria 1743
104 Ga0157380_11233920 3300014326 Bacteria 792
105 Ga0157380_12091763 3300014326 Bacteria 629
106 Ga0182008_10138174 3300014497 Bacteria 1218
107 Ga0157377_10293515 3300014745 Bacteria 1070
108 Ga0157379_10607171 3300014968 Bacteria 1022
109 Ga0157376_10383862 3300014969 Bacteria 1354
110 Ga0163161_10090483 3300017792 Bacteria 2264
111 Ga0163161_10526095 3300017792 Bacteria 966
112 Ga0213874_10323415 3300021377 Unclassified 585
113 Ga0213876_10671127 3300021384 Bacteria 551
114 Ga0213876_10715343 3300021384 Unclassified 533
115 Ga0213875_10268708 3300021388 Bacteria 805
116 Ga0224572_1037167 3300024225 Bacteria 921
117 Ga0228598_1002578 3300024227 Bacteria 3936
118 Ga0207692_10111427 3300025898 Bacteria 1518
119 Ga0207692_10331196 3300025898 Bacteria 934
120 Ga0207642_10303890 3300025899 Bacteria 926
121 Ga0207688_10446170 3300025901 Bacteria 806
122 Ga0207680_10100338 3300025903 Bacteria 1859
123 Ga0207685_10081038 3300025905 Bacteria 1343
124 Ga0207699_10048119 3300025906 Bacteria 2503
125 Ga0207699_11311770 3300025906 Bacteria 536
126 Ga0207707_10441590 3300025912 Bacteria 1114
127 Ga0207671_11170624 3300025914 Bacteria 602
128 Ga0207693_10025457 3300025915 Bacteria 4692
129 Ga0207693_10057525 3300025915 Bacteria 3047
130 Ga0207663_10019858 3300025916 Bacteria 3794
131 Ga0207657_10106356 3300025919 Bacteria 2322
132 Ga0207650_10028392 3300025925 Bacteria 4011
133 Ga0207687_10841074 3300025927 Bacteria 784
134 Ga0207700_10039969 3300025928 Bacteria 3420
135 Ga0207700_10115942 3300025928 Unclassified 2164
136 Ga0207700_10544732 3300025928 Bacteria 1029
137 Ga0207664_10408791 3300025929 Bacteria 1208
138 Ga0207664_10628571 3300025929 Bacteria 965
139 Ga0207644_10461289 3300025931 Bacteria 1045
140 Ga0207644_11128637 3300025931 Bacteria 659
141 Ga0207690_10156684 3300025932 Bacteria 1694
142 Ga0207706_10226938 3300025933 Bacteria 1634
143 Ga0207670_10062406 3300025936 Bacteria 2547
144 Ga0207670_10106256 3300025936 Bacteria 2013
145 Ga0207669_10009927 3300025937 Bacteria 4559
146 Ga0207704_10800516 3300025938 Bacteria 787
147 Ga0207665_10000840 3300025939 Bacteria 20737
148 Ga0207665_10177776 3300025939 Bacteria 1540
149 Ga0207665_10863758 3300025939 Bacteria 717
150 Ga0207679_10039385 3300025945 Bacteria 3374
151 Ga0207651_10131157 3300025960 Bacteria 1919
152 Ga0207712_10044538 3300025961 Bacteria 3067
153 Ga0207658_10174994 3300025986 Bacteria 1772
154 Ga0207703_10129845 3300026035 Bacteria 2175
155 Ga0207703_11273009 3300026035 Bacteria 707
156 Ga0207678_11313836 3300026067 Bacteria 640
157 Ga0207708_10269324 3300026075 Bacteria 1377
158 Ga0207708_10348647 3300026075 Bacteria 1214
159 Ga0207702_10180473 3300026078 Bacteria 1944
160 Ga0207648_10587007 3300026089 Bacteria 1026
161 Ga0207675_100412786 3300026118 Bacteria 1332
162 Ga0207683_10235229 3300026121 Bacteria 1671
163 Ga0209813_10012037 3300027866 Bacteria 2276
164 Ga0207428_10407294 3300027907 Bacteria 995
165 Ga0207428_10502790 3300027907 Bacteria 880
166 Ga0268266_10101582 3300028379 Bacteria 2536
167 Ga0307511_10269711 3300030521 Bacteria 798
168 Ga0265332_10298923 3300031238 Bacteria 665
169 Ga0265325_10026392 3300031241 Bacteria 3146
170 Ga0265325_10329901 3300031241 Bacteria 677
171 Ga0265340_10147394 3300031247 Bacteria 1074
172 Ga0265340_10161501 3300031247 Bacteria 1018
173 Ga0265331_10188044 3300031250 Bacteria 932
174 Ga0307405_11290149 3300031731 Bacteria 635
175 Ga0373930_0026110 3300034816 Bacteria 1176
176 Ga0373930_0192649 3300034816 Bacteria 528
177 Ga0373958_0018359 3300034819 Bacteria 1267
178 Ga0373938_0159736 3300034957 Bacteria 605
179 Ga0373928_0042719 3300035084 Bacteria 1046
180 Ga0373929_0084849 3300035085 Bacteria 777
181 Ga0373940_0226999 3300035088 Bacteria 622
182 Ga0373949_0035785 3300035090 Bacteria 1202
183 Ga0373952_0121799 3300035092 Bacteria 708
184 Ga0373923_0164796 3300035111 Bacteria 1013
185 Ga0373936_0091025 3300035113 Bacteria 1279
186 Ga0373941_0006146 3300035115 Bacteria 2874
187 Ga0373941_0350410 3300035115 Bacteria 600
188 Ga0373941_0380805 3300035115 Bacteria 580
189 Ga0373953_0019080 3300035117 Bacteria 2547
190 Ga0373953_0214824 3300035117 Bacteria 833
191 Ga0373954_0082176 3300035118 Bacteria 1540
192 Ga0373954_0121616 3300035118 Bacteria 1267
193 Ga0373956_0211629 3300035119 Bacteria 920
194 Ga0373956_0290639 3300035119 Bacteria 778
195 Ga0373960_0103446 3300035121 Bacteria 926
196 Ga0373943_0067916 3300035170 Bacteria 1799
197 Ga0373943_0652624 3300035170 Bacteria 622
198 Ga0373955_0033073 3300035172 Bacteria 2721
199 Ga0373942_0007590 3300035207 Bacteria 2519
200 Ga0373961_0161665 3300035241 Bacteria 769
201 Ga0373962_0018673 3300035242 Bacteria 1808
202 Ga0373924_0031152 3300035410 Bacteria 2143
203 Ga0373931_0012410 3300035691 Bacteria 4127
204 Ga0373935_0153556 3300035692 Bacteria 1564
205 Ga0373927_0343081 3300035695 Bacteria 984
206 Ga0373933_0049057 3300035724 Bacteria 2516
207 Ga0373933_0265212 3300035724 Bacteria 1108
208 Ga0373933_0537327 3300035724 Bacteria 767
209 Ga0373933_1012344 3300035724 Bacteria 547
210 Ga0373947_0064822 3300035725 Bacteria 2228
211 Ga0373947_0070699 3300035725 Bacteria 2139
212 Ga0373937_0175352 3300036401 Bacteria 2012
213 Ga0373937_0343405 3300036401 Bacteria 1414
214 Ga0373937_0360698 3300036401 Bacteria 1377
215 Ga0373937_1845329 3300036401 Bacteria 551
216 Ga0373925_0194559 3300037068 Bacteria 1610
217 Ga0373925_0713750 3300037068 Bacteria 827
218 Ga0373925_0826828 3300037068 Bacteria 763
219 Ga0436364_0177041 3300037853 Bacteria 901
220 Ga0436364_1049479 3300037853 Bacteria 2058
221 Ga0395901_1265378 3300038443 Bacteria 701
222 Ga0436365_0347986 3300039437 Bacteria 754
223 Ga0436365_0684871 3300039437 Unclassified 533
224 Ga0436365_0929367 3300039437 Bacteria 2589
225 Ga0436365_1405842 3300039437 Bacteria 1494
226 Ga0436360_0435908 3300039438 Bacteria 719
227 Ga0436363_1304549 3300039450 Unclassified 574
228 Ga0436362_0418204 3300039453 Bacteria 717
229 Ga0451841_0588400 3300041498 Bacteria 506
230 Ga0466966_0920967 3300044684 Bacteria 527
231 Ga0466961_0216514 3300044693 Bacteria 1181
232 Ga0466957_0094702 3300044842 Bacteria 1875
233 Ga0466959_0177902 3300045049 Bacteria 1489
234 Ga0466967_0375506 3300045976 Bacteria 1380
235 Ga0495592_0059715 3300046454 Bacteria 2807
236 Ga0495603_0131009 3300046455 Bacteria 1460
237 Ga0495629_0572887 3300046459 Bacteria 757
238 Ga0495629_0607825 3300046459 Bacteria 731
239 Ga0495641_0382730 3300046461 Bacteria 638
240 Ga0495653_0193027 3300046463 Bacteria 1388
241 Ga0495580_0134114 3300046472 Bacteria 1717
242 Ga0495605_0124006 3300046474 Bacteria 1170
243 Ga0495662_0514818 3300046476 Bacteria 586
244 Ga0495584_0533773 3300046491 Bacteria 598
245 Ga0495594_0152679 3300046499 Bacteria 1311
246 Ga0495607_0172831 3300046501 Bacteria 1090
247 Ga0495618_0104171 3300046514 Bacteria 1816
248 Ga0495628_0142012 3300046516 Bacteria 1832
249 Ga0495628_0151067 3300046516 Bacteria 1769
250 Ga0495630_0288634 3300046517 Bacteria 1254
251 Ga0495630_0712975 3300046517 Bacteria 767
252 Ga0495648_0010822 3300046524 Bacteria 6928
253 Ga0495666_0298001 3300046526 Bacteria 730
254 Ga0495652_0095799 3300046529 Bacteria 2418
255 Ga0495652_0218800 3300046529 Bacteria 1432
256 Ga0495665_0166535 3300046531 Bacteria 1148
257 Ga0495665_0537352 3300046531 Bacteria 587
258 Ga0495640_0111080 3300046533 Bacteria 1791
259 Ga0495587_0084896 3300046536 Bacteria 1833
260 Ga0495598_0062367 3300046537 Bacteria 1153
261 Ga0495645_0275546 3300046543 Bacteria 1108
262 Ga0495645_0287005 3300046543 Bacteria 1080
263 Ga0495667_0036699 3300046559 Bacteria 3269
264 Ga0495667_0597301 3300046559 Bacteria 688
265 Ga0495634_0135327 3300046642 Bacteria 1568
266 Ga0495599_0120666 3300046678 Bacteria 1630
267 Ga0495623_0058244 3300046679 Bacteria 2429
268 Ga0495623_0380100 3300046679 Bacteria 764
269 Ga0495658_0019006 3300046683 Bacteria 3581
270 Ga0495658_0286687 3300046683 Bacteria 1040
271 Ga0495613_0071284 3300046689 Bacteria 2533
272 Ga0495624_0784326 3300046690 Unclassified 564
273 Ga0495671_0420967 3300046692 Bacteria 639
274 Ga0495600_0059844 3300046809 Bacteria 2488
275 Ga0495581_0114401 3300047315 Bacteria 1569
276 Ga0495581_0546678 3300047315 Unclassified 672
277 Ga0495604_0009808 3300047317 Bacteria 7575
278 Ga0495604_0268301 3300047317 Bacteria 1157
279 Ga0495674_0541551 3300047319 Bacteria 927
280 Ga0495674_0895048 3300047319 Bacteria 685
281 Ga0495680_0057996 3300047322 Bacteria 2993
282 Ga0495680_0509686 3300047322 Bacteria 815
283 Ga0495675_0218729 3300047444 Bacteria 1154
284 Ga0495681_0094664 3300047470 Bacteria 1314
285 Ga0495684_0758924 3300047471 Bacteria 637
286 Ga0495602_0054626 3300048088 Bacteria 3524
287 Ga0495602_0158821 3300048088 Bacteria 1767
288 Ga0496100_0104678 3300048903 Bacteria 1956
289 Ga0496100_0120901 3300048903 Bacteria 1832
290 Ga0496101_0049517 3300048904 Bacteria 3023
291 Ga0496101_0219286 3300048904 Bacteria 1476
292 Ga0496101_0240732 3300048904 Bacteria 1408
293 Ga0496101_0768639 3300048904 Bacteria 760
294 Ga0496102_0201406 3300048905 Bacteria 1877
295 Ga0496105_0114587 3300048908 Bacteria 2223
296 Ga0496105_1166768 3300048908 Bacteria 569
297 Ga0496106_0166322 3300048909 Bacteria 1746
298 Ga0496106_0249209 3300048909 Bacteria 1420
299 Ga0496106_0257582 3300048909 Bacteria 1396
300 Ga0496107_0097636 3300048910 Bacteria 2151
301 Ga0496107_1226977 3300048910 Bacteria 538
302 Ga0496108_0503974 3300048911 Bacteria 1057
303 Ga0496108_0796771 3300048911 Bacteria 815
304 Ga0496108_0850114 3300048911 Unclassified 785
305 Ga0496109_0226109 3300048912 Bacteria 1760
306 Ga0496109_0407375 3300048912 Bacteria 1285
307 Ga0496109_1517269 3300048912 Bacteria 605
308 Ga0496110_0568536 3300048913 Bacteria 1030
309 Ga0496110_0578440 3300048913 Bacteria 1020
310 Ga0496110_0737572 3300048913 Bacteria 888
311 Ga0496111_0075083 3300048914 Bacteria 2463
312 Ga0496111_0079600 3300048914 Bacteria 2391
313 Ga0496112_0011620 3300048915 Bacteria 8053
314 Ga0496112_0274471 3300048915 Bacteria 1634
315 Ga0496112_0345643 3300048915 Bacteria 1430
316 Ga0496112_0546043 3300048915 Bacteria 1093
317 Ga0496112_0885469 3300048915 Bacteria 815
318 Ga0496113_0308153 3300048916 Bacteria 1268
319 Ga0496114_0229413 3300048917 Bacteria 1631
320 Ga0496114_0476755 3300048917 Bacteria 1104
321 Ga0496114_0524302 3300048917 Bacteria 1048
322 Ga0496115_0076530 3300048918 Bacteria 2720
323 Ga0496115_0483226 3300048918 Bacteria 997
324 Ga0496115_0740235 3300048918 Bacteria 770
325 Ga0496115_0757671 3300048918 Bacteria 759
326 Ga0496115_1090933 3300048918 Bacteria 605
327 Ga0496115_1132908 3300048918 Bacteria 591
328 Ga0501031_0083883 3300049568 Bacteria 2077
329 Ga0501032_0181501 3300049569 Bacteria 1378
330 Ga0501034_0389632 3300049571 Bacteria 1317
331 Ga0501034_0661876 3300049571 Bacteria 945
332 Ga0501036_0258987 3300049572 Bacteria 1457
333 Ga0501037_0060703 3300049573 Bacteria 2758
334 Ga0501038_0687053 3300049574 Bacteria 768
335 Ga0501047_0018838 3300049581 Bacteria 6622
336 Ga0501048_1270880 3300049582 Bacteria 529
337 Ga0501067_0040567 3300049583 Bacteria 2585
338 Ga0501067_0201107 3300049583 Bacteria 1110
339 Ga0501067_0217706 3300049583 Bacteria 1063
340 Ga0501070_0443989 3300049586 Bacteria 1046
341 Ga0501071_1087579 3300049587 Bacteria 618
342 Ga0501072_1286174 3300049588 Bacteria 567
343 Ga0501073_0114424 3300049589 Bacteria 1870
344 Ga0501073_0218101 3300049589 Bacteria 1318
345 Ga0501074_1150953 3300049590 Bacteria 544
346 Ga0501076_0276150 3300049592 Bacteria 1376
347 Ga0501076_1000621 3300049592 Bacteria 689
348 Ga0501079_0341458 3300049741 Bacteria 1173
349 Ga0501079_0428063 3300049741 Bacteria 1039
350 Ga0501079_1236675 3300049741 Bacteria 588
351 Ga0501080_0342091 3300049742 Bacteria 1352
352 Ga0501080_0389147 3300049742 Bacteria 1255
353 Ga0501080_0408197 3300049742 Bacteria 1221
354 Ga0501083_0636532 3300049744 Bacteria 694
355 Ga0501044_0056272 3300049823 Bacteria 4038
356 nmdc:mga03n38_394515_c1 3300050490 Bacteria 761
357 nmdc:mga03n38_548579_c1 3300050490 Bacteria 654
358 nmdc:mga00v17_62459_c1 3300050491 Bacteria 2292
359 nmdc:mga0yw44_306004_c1 3300050492 Bacteria 1066
360 nmdc:mga0yw44_452094_c1 3300050492 Bacteria 870
361 nmdc:mga0k408_406799_c1 3300050493 Bacteria 538
362 nmdc:mga0k408_854287_c1 3300050493 Bacteria 529
363 nmdc:mga06z11_183035_c1 3300050494 Bacteria 1209
364 nmdc:mga06z11_60092_c1 3300050494 Bacteria 1978
365 nmdc:mga06z11_8848_c1 3300050494 Bacteria 4218
366 nmdc:mga04h51_410290_c1 3300050495 Bacteria 568
367 nmdc:mga04h51_5126_c1 3300050495 Bacteria 3321
368 nmdc:mga07m45_543697_c1 3300050496 Bacteria 672
369 nmdc:mga07m45_77023_c1 3300050496 Bacteria 1902
370 nmdc:mga05p37_18437_c1 3300050507 Bacteria 8431
371 nmdc:mga05p37_584897_c1 3300050507 Bacteria 1263
372 nmdc:mga0qj67_9708_c1 3300050509 Bacteria 7169
373 nmdc:mga06r32_26456_c1 3300050510 Bacteria 5409
374 nmdc:mga06r32_336516_c1 3300050510 Bacteria 1494
375 nmdc:mga06r32_870502_c1 3300050510 Bacteria 859
376 nmdc:mga08y16_1015240_c1 3300050511 Unclassified 809
377 nmdc:mga08y16_140991_c1 3300050511 Bacteria 2506
378 nmdc:mga08y16_20745_c1 3300050511 Bacteria 6936
379 nmdc:mga0n895_483748_c1 3300050512 Bacteria 1248
380 nmdc:mga0n895_642120_c1 3300050512 Bacteria 1061
381 nmdc:mga0n895_66696_c1 3300050512 Bacteria 3563
382 nmdc:mga0n895_85844_c1 3300050512 Bacteria 3143
383 nmdc:mga0rr50_1311420_c1 3300050513 Unclassified 614
384 nmdc:mga0rr50_1590569_c1 3300050513 Bacteria 552
385 nmdc:mga0rr50_395331_c1 3300050513 Bacteria 1167
386 nmdc:mga08x19_823430_c1 3300050514 Bacteria 659
387 nmdc:mga0a205_909331_c1 3300050515 Bacteria 727
388 nmdc:mga0sz30_22564_c1 3300050516 Bacteria 2556
389 Ga0495601_0087291 3300053077 Bacteria 2005
390 Ga0495601_0269185 3300053077 Bacteria 1111
391 Ga0495601_0427817 3300053077 Bacteria 857
392 Ga0495612_0009416 3300053078 Bacteria 3963
393 Ga0495612_0137444 3300053078 Bacteria 1058
394 Ga0495655_0003740 3300053083 Bacteria 2539
395 Ga0495655_0120386 3300053083 Bacteria 798
396 Ga0495595_0091277 3300053084 Bacteria 1461
397 Ga0495595_0206914 3300053084 Bacteria 977
398 Ga0495619_0281006 3300053085 Bacteria 1153
399 Ga0500646_0154015 3300053090 Bacteria 763
400 Ga0500641_0020183 3300053096 Bacteria 2527
401 Ga0500595_012220 3300053119 Bacteria 3329
402 Ga0500559_0249341 3300053136 Bacteria 837
403 Ga0501082_0101488 3300060353 Bacteria 2489
404 Ga0501082_1527398 3300060353 Bacteria 583
405 Ga0530510_1420203 3300061734 Bacteria 533
406 Ga0070687_101227726
407 Ga0065715_10828947
408 Ga0065715_11150446
409 Ga0070683_101504000
410 Ga0070670_100023987
411 Ga0070666_10264522
412 Ga0070680_101687401
413 Ga0070682_101369285
414 Ga0070689_100140975
415 Ga0070661_100219239
416 Ga0070668_101847780
417 Ga0070668_102260098
418 Ga0070669_100145129
419 Ga0070675_102005365
420 Ga0070671_100731086
421 Ga0070674_100008072
422 Ga0070673_100286353
423 Ga0070673_100873713
424 Ga0070673_101557495
425 Ga0070688_101123263
426 Ga0070709_10069544
427 Ga0070709_10634054
428 Ga0070714_100034975
429 Ga0070714_100086639
430 Ga0070713_100184867
431 Ga0070713_100228760
432 Ga0070713_101689539
433 Ga0070705_100312874
434 Ga0070700_100525003
435 Ga0070663_101200119
436 Ga0070678_100172749
437 Ga0070662_100844300
438 Ga0070662_101327718
439 Ga0070681_10683530
440 Ga0070686_100490177
441 Ga0070686_100777470
442 Ga0070696_100088280
443 Ga0070665_100035718
444 Ga0068856_100616790
445 Ga0068856_101359276
446 Ga0070702_100342927
447 Ga0068864_102285582
448 Ga0068863_101183593
449 Ga0068858_100071686
450 Ga0068858_101238335
451 Ga0081455_10001167
452 Ga0081455_10169658
453 Ga0081540_1047176
454 Ga0070717_10019850
455 Ga0070717_10171940
456 Ga0070717_11152246
457 Ga0075368_10023619
458 Ga0075363_100160045
459 Ga0075363_100643030
460 Ga0075364_10263641
461 Ga0075364_10460048
462 Ga0075364_10630845
463 Ga0070715_10020835
464 Ga0070716_100013738
465 Ga0070716_100775867
466 Ga0070712_100179338
467 Ga0070712_101151466
468 Ga0075367_10114199
469 Ga0075367_10229003
470 Ga0075366_10748083
471 Ga0097621_101103372
472 Ga0075370_10054220
473 Ga0075370_10350199
474 Ga0075428_101031762
475 Ga0075428_101349820
476 Ga0075430_100004348
477 Ga0075431_100005249
478 Ga0075431_100605961
479 Ga0075433_10032028
480 Ga0075434_100025834
481 Ga0075434_100470867
482 Ga0075434_101345412
483 Ga0068865_100886621
484 Ga0075435_100238627
485 Ga0075435_100301732
486 Ga0075435_101296160
487 Ga0099795_10178132
488 Ga0111539_10008421
489 Ga0111539_10142470
490 Ga0111539_10464652
491 Ga0105245_10808901
492 Ga0105247_11020436
493 Ga0114129_10013040
494 Ga0114129_10113255
495 Ga0114129_10189497
496 Ga0105243_10702919
497 Ga0105248_10594049
498 Ga0105237_12184782
499 Ga0105238_10564187
500 Ga0105246_10671778
501 Ga0105246_11042854
502 Ga0157374_11242256
503 Ga0157378_10702661
504 Ga0157375_10518892
505 Ga0157375_12075977
506 Ga0163163_10367548
507 Ga0163163_11196613
508 Ga0157380_10207668
509 Ga0157380_11233920
510 Ga0157380_12091763
511 Ga0182008_10138174
512 Ga0157377_10293515
513 Ga0157379_10607171
514 Ga0157376_10383862
515 Ga0163161_10090483
516 Ga0163161_10526095
517 Ga0213874_10323415
518 Ga0213876_10671127
519 Ga0213876_10715343
520 Ga0213875_10268708
521 Ga0224572_1037167
522 Ga0228598_1002578
523 Ga0207692_10111427
524 Ga0207692_10331196
525 Ga0207642_10303890
526 Ga0207688_10446170
527 Ga0207680_10100338
528 Ga0207685_10081038
529 Ga0207699_10048119
530 Ga0207699_11311770
531 Ga0207707_10441590
532 Ga0207671_11170624
533 Ga0207693_10025457
534 Ga0207693_10057525
535 Ga0207663_10019858
536 Ga0207657_10106356
537 Ga0207650_10028392
538 Ga0207687_10841074
539 Ga0207700_10039969
540 Ga0207700_10115942
541 Ga0207700_10544732
542 Ga0207664_10408791
543 Ga0207664_10628571
544 Ga0207644_10461289
545 Ga0207644_11128637
546 Ga0207690_10156684
547 Ga0207706_10226938
548 Ga0207670_10062406
549 Ga0207670_10106256
550 Ga0207669_10009927
551 Ga0207704_10800516
552 Ga0207665_10000840
553 Ga0207665_10177776
554 Ga0207665_10863758
555 Ga0207679_10039385
556 Ga0207651_10131157
557 Ga0207712_10044538
558 Ga0207658_10174994
559 Ga0207703_10129845
560 Ga0207703_11273009
561 Ga0207678_11313836
562 Ga0207708_10269324
563 Ga0207708_10348647
564 Ga0207702_10180473
565 Ga0207648_10587007
566 Ga0207675_100412786
567 Ga0207683_10235229
568 Ga0209813_10012037
569 Ga0207428_10407294
570 Ga0207428_10502790
571 Ga0268266_10101582
572 Ga0307511_10269711
573 Ga0265332_10298923
574 Ga0265325_10026392
575 Ga0265325_10329901
576 Ga0265340_10147394
577 Ga0265340_10161501
578 Ga0265331_10188044
579 Ga0307405_11290149
580 Ga0373930_0026110
581 Ga0373930_0192649
582 Ga0373958_0018359
583 Ga0373938_0159736
584 Ga0373928_0042719
585 Ga0373929_0084849
586 Ga0373940_0226999
587 Ga0373949_0035785
588 Ga0373952_0121799
589 Ga0373923_0164796
590 Ga0373936_0091025
591 Ga0373941_0006146
592 Ga0373941_0350410
593 Ga0373941_0380805
594 Ga0373953_0019080
595 Ga0373953_0214824
596 Ga0373954_0082176
597 Ga0373954_0121616
598 Ga0373956_0211629
599 Ga0373956_0290639
600 Ga0373960_0103446
601 Ga0373943_0067916
602 Ga0373943_0652624
603 Ga0373955_0033073
604 Ga0373942_0007590
605 Ga0373961_0161665
606 Ga0373962_0018673
607 Ga0373924_0031152
608 Ga0373931_0012410
609 Ga0373935_0153556
610 Ga0373927_0343081
611 Ga0373933_0049057
612 Ga0373933_0265212
613 Ga0373933_0537327
614 Ga0373933_1012344
615 Ga0373947_0064822
616 Ga0373947_0070699
617 Ga0373937_0175352
618 Ga0373937_0343405
619 Ga0373937_0360698
620 Ga0373937_1845329
621 Ga0373925_0194559
622 Ga0373925_0713750
623 Ga0373925_0826828
624 Ga0436364_0177041
625 Ga0436364_1049479
626 Ga0395901_1265378
627 Ga0436365_0347986
628 Ga0436365_0684871
629 Ga0436365_0929367
630 Ga0436365_1405842
631 Ga0436360_0435908
632 Ga0436363_1304549
633 Ga0436362_0418204
634 Ga0451841_0588400
635 Ga0466966_0920967
636 Ga0466961_0216514
637 Ga0466957_0094702
638 Ga0466959_0177902
639 Ga0466967_0375506
640 Ga0495592_0059715
641 Ga0495603_0131009
642 Ga0495629_0572887
643 Ga0495629_0607825
644 Ga0495641_0382730
645 Ga0495653_0193027
646 Ga0495580_0134114
647 Ga0495605_0124006
648 Ga0495662_0514818
649 Ga0495584_0533773
650 Ga0495594_0152679
651 Ga0495607_0172831
652 Ga0495618_0104171
653 Ga0495628_0142012
654 Ga0495628_0151067
655 Ga0495630_0288634
656 Ga0495630_0712975
657 Ga0495648_0010822
658 Ga0495666_0298001
659 Ga0495652_0095799
660 Ga0495652_0218800
661 Ga0495665_0166535
662 Ga0495665_0537352
663 Ga0495640_0111080
664 Ga0495587_0084896
665 Ga0495598_0062367
666 Ga0495645_0275546
667 Ga0495645_0287005
668 Ga0495667_0036699
669 Ga0495667_0597301
670 Ga0495634_0135327
671 Ga0495599_0120666
672 Ga0495623_0058244
673 Ga0495623_0380100
674 Ga0495658_0019006
675 Ga0495658_0286687
676 Ga0495613_0071284
677 Ga0495624_0784326
678 Ga0495671_0420967
679 Ga0495600_0059844
680 Ga0495581_0114401
681 Ga0495581_0546678
682 Ga0495604_0009808
683 Ga0495604_0268301
684 Ga0495674_0541551
685 Ga0495674_0895048
686 Ga0495680_0057996
687 Ga0495680_0509686
688 Ga0495675_0218729
689 Ga0495681_0094664
690 Ga0495684_0758924
691 Ga0495602_0054626
692 Ga0495602_0158821
693 Ga0496100_0104678
694 Ga0496100_0120901
695 Ga0496101_0049517
696 Ga0496101_0219286
697 Ga0496101_0240732
698 Ga0496101_0768639
699 Ga0496102_0201406
700 Ga0496105_0114587
701 Ga0496105_1166768
702 Ga0496106_0166322
703 Ga0496106_0249209
704 Ga0496106_0257582
705 Ga0496107_0097636
706 Ga0496107_1226977
707 Ga0496108_0503974
708 Ga0496108_0796771
709 Ga0496108_0850114
710 Ga0496109_0226109
711 Ga0496109_0407375
712 Ga0496109_1517269
713 Ga0496110_0568536
714 Ga0496110_0578440
715 Ga0496110_0737572
716 Ga0496111_0075083
717 Ga0496111_0079600
718 Ga0496112_0011620
719 Ga0496112_0274471
720 Ga0496112_0345643
721 Ga0496112_0546043
722 Ga0496112_0885469
723 Ga0496113_0308153
724 Ga0496114_0229413
725 Ga0496114_0476755
726 Ga0496114_0524302
727 Ga0496115_0076530
728 Ga0496115_0483226
729 Ga0496115_0740235
730 Ga0496115_0757671
731 Ga0496115_1090933
732 Ga0496115_1132908
733 Ga0501031_0083883
734 Ga0501032_0181501
735 Ga0501034_0389632
736 Ga0501034_0661876
737 Ga0501036_0258987
738 Ga0501037_0060703
739 Ga0501038_0687053
740 Ga0501047_0018838
741 Ga0501048_1270880
742 Ga0501067_0040567
743 Ga0501067_0201107
744 Ga0501067_0217706
745 Ga0501070_0443989
746 Ga0501071_1087579
747 Ga0501072_1286174
748 Ga0501073_0114424
749 Ga0501073_0218101
750 Ga0501074_1150953
751 Ga0501076_0276150
752 Ga0501076_1000621
753 Ga0501079_0341458
754 Ga0501079_0428063
755 Ga0501079_1236675
756 Ga0501080_0342091
757 Ga0501080_0389147
758 Ga0501080_0408197
759 Ga0501083_0636532
760 Ga0501044_0056272
761 nmdc:mga03n38_394515_c1
762 nmdc:mga03n38_548579_c1
763 nmdc:mga00v17_62459_c1
764 nmdc:mga0yw44_306004_c1
765 nmdc:mga0yw44_452094_c1
766 nmdc:mga0k408_406799_c1
767 nmdc:mga0k408_854287_c1
768 nmdc:mga06z11_183035_c1
769 nmdc:mga06z11_60092_c1
770 nmdc:mga06z11_8848_c1
771 nmdc:mga04h51_410290_c1
772 nmdc:mga04h51_5126_c1
773 nmdc:mga07m45_543697_c1
774 nmdc:mga07m45_77023_c1
775 nmdc:mga05p37_18437_c1
776 nmdc:mga05p37_584897_c1
777 nmdc:mga0qj67_9708_c1
778 nmdc:mga06r32_26456_c1
779 nmdc:mga06r32_336516_c1
780 nmdc:mga06r32_870502_c1
781 nmdc:mga08y16_1015240_c1
782 nmdc:mga08y16_140991_c1
783 nmdc:mga08y16_20745_c1
784 nmdc:mga0n895_483748_c1
785 nmdc:mga0n895_642120_c1
786 nmdc:mga0n895_66696_c1
787 nmdc:mga0n895_85844_c1
788 nmdc:mga0rr50_1311420_c1
789 nmdc:mga0rr50_1590569_c1
790 nmdc:mga0rr50_395331_c1
791 nmdc:mga08x19_823430_c1
792 nmdc:mga0a205_909331_c1
793 nmdc:mga0sz30_22564_c1
794 Ga0495601_0087291
795 Ga0495601_0269185
796 Ga0495601_0427817
797 Ga0495612_0009416
798 Ga0495612_0137444
799 Ga0495655_0003740
800 Ga0495655_0120386
801 Ga0495595_0091277
802 Ga0495595_0206914
803 Ga0495619_0281006
804 Ga0500646_0154015
805 Ga0500641_0020183
806 Ga0500595_012220
807 Ga0500559_0249341
808 Ga0501082_0101488
809 Ga0501082_1527398
810 Ga0530510_1420203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

9

121

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9529 2 119
2cg8-assembly1.cif.gz_A-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9491 2 119
2nm2-assembly1.cif.gz_C crystal structure of dihydroneopterin aldolase from s. aureus in complex with (1s,2r)-neopterin at 1.50 angstrom resolution 0.9488 1 119
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.9477 2 120
7su4-assembly1.cif.gz_C-2 dihydroneopterin aldolase (dhna) tyr53phe from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.9477 3 120
ID Description Score Start End Superfamily
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9519 1 119 3.30.1130.10
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.951 3 122 3.30.1130.10
2cg8A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9478 2 120 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9454 3 120 3.30.1130.10
2cg8A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9397 2 120 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A2S0N764-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9788 1 120 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A5A7W8E5-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9722 1 120 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A101I8I9-F1-model_v4 deleted 0.971 1 103
AF-A0A847HA30-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.9707 1 99 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A1G4WBT8-F1-model_v4 Bifunctional folate synthesis protein [Includes: Dihydroneopterin aldolase (DHNA) (EC 4.1.2.25) (7,8-dihydroneopterin aldolase); 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) (PPPK) (7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase) (HPPK)] 0.9702 3 119 GO:0003848
GO:0004150
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map