F435864

General Info

Members Datasets Scaffolds Average Seq Length
405 196 810 295

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100001433|Ga0070670_10000143319
Length 310
Sequence MEMTPLPPDARGAPLSGVPALSEVGRLISVVVKHARDAFVDERTIASEWQPLNFTAAPDLGAAIDEYERFLEILRSSGAAIHQLPRTPETTLDSVYARDASIVSPKGLILCRMGKRARQSEPHAQEQAFRAMTPPVPVAGHINAPGLLEGGDVVWLDDRTLVVGLGYRTNAEGINQLRAIVGESVDVVEVPLPHWRGESDVMHLMSLISPVDRDLAVVYSRLLPVPFRQLLLDRGYRLIDVPDEEFDSMGCNVLALSPGRCVMVAGNPKTRAALEQTGVDVTEYVGHEISAKGAGGPTCLTRPIARAALE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100001433 3300005331 Bacteria 19191
2 MRS1b_contig_6635214 2162886011 Bacteria 1262
3 JGI25406J46586_10000701 3300003203 Bacteria 15649
4 JGI25406J46586_10004848 3300003203 Bacteria 6254
5 JGI25406J46586_10027343 3300003203 Bacteria 2189
6 Ga0065714_10078145 3300005288 Unclassified 2625
7 Ga0065704_10084663 3300005289 Bacteria 3310
8 Ga0065712_10000375 3300005290 Bacteria 12196
9 Ga0065712_10006902 3300005290 Unclassified 3672
10 Ga0065715_10000319 3300005293 Bacteria 16378
11 Ga0065715_10001450 3300005293 Bacteria 9174
12 Ga0065715_10171088 3300005293 Unclassified 1546
13 Ga0065707_10009483 3300005295 Unclassified 2456
14 Ga0065707_10114792 3300005295 Unclassified 2287
15 Ga0065707_10117658 3300005295 Bacteria 2206
16 Ga0070676_10011129 3300005328 Bacteria 4888
17 Ga0070676_10108258 3300005328 Bacteria 1727
18 Ga0070683_100063512 3300005329 Bacteria 3435
19 Ga0070670_100060217 3300005331 Unclassified 3259
20 Ga0070670_100391328 3300005331 Bacteria 1226
21 Ga0070670_100554806 3300005331 Bacteria 1025
22 Ga0070677_10000843 3300005333 Bacteria 10069
23 Ga0070677_10051186 3300005333 Bacteria 1671
24 Ga0068869_100026379 3300005334 Bacteria 4045
25 Ga0068869_100099569 3300005334 Unclassified 2197
26 Ga0070666_10002720 3300005335 Bacteria 10680
27 Ga0068868_100477513 3300005338 Bacteria 1088
28 Ga0070689_100035095 3300005340 Bacteria 3830
29 Ga0070689_100058506 3300005340 Bacteria 2993
30 Ga0070661_100013533 3300005344 Bacteria 5729
31 Ga0070692_10000087 3300005345 Bacteria 19775
32 Ga0070668_100304805 3300005347 Bacteria 1337
33 Ga0070669_100289601 3300005353 Bacteria 1314
34 Ga0070675_100039970 3300005354 Unclassified 3828
35 Ga0070675_100079977 3300005354 Bacteria 2724
36 Ga0070675_100227246 3300005354 Bacteria 1627
37 Ga0070671_100008027 3300005355 Bacteria 8448
38 Ga0070674_100000192 3300005356 Bacteria 29259
39 Ga0070674_100104130 3300005356 Bacteria 2073
40 Ga0070674_100310588 3300005356 Bacteria 1260
41 Ga0070674_100369816 3300005356 Bacteria 1163
42 Ga0070673_100006411 3300005364 Bacteria 7650
43 Ga0070673_100027254 3300005364 Bacteria 4234
44 Ga0070673_100034412 3300005364 Bacteria 3834
45 Ga0070673_100194493 3300005364 Bacteria 1744
46 Ga0070688_100013169 3300005365 Bacteria 4656
47 Ga0070667_100013748 3300005367 Bacteria 6692
48 Ga0070667_100099993 3300005367 Unclassified 2504
49 Ga0070705_100004014 3300005440 Bacteria 7187
50 Ga0070705_100020385 3300005440 Bacteria 3508
51 Ga0070700_100043878 3300005441 Bacteria 2752
52 Ga0070700_100167787 3300005441 Bacteria 1518
53 Ga0070694_100001263 3300005444 Bacteria 14687
54 Ga0070694_100001421 3300005444 Bacteria 14035
55 Ga0070694_100002505 3300005444 Bacteria 10845
56 Ga0070708_100235796 3300005445 Bacteria 1717
57 Ga0070663_100423316 3300005455 Bacteria 1093
58 Ga0070678_100127992 3300005456 Bacteria 2013
59 Ga0070678_100246460 3300005456 Bacteria 1496
60 Ga0070662_100025846 3300005457 Bacteria 4059
61 Ga0070681_10078581 3300005458 Bacteria 3256
62 Ga0068867_100072093 3300005459 Unclassified 2585
63 Ga0070685_10001382 3300005466 Bacteria 12755
64 Ga0070685_10041081 3300005466 Unclassified 2634
65 Ga0070706_100078007 3300005467 Bacteria 3067
66 Ga0070706_100130016 3300005467 Unclassified 2350
67 Ga0070707_100060306 3300005468 Bacteria 3639
68 Ga0070707_100228695 3300005468 Bacteria 1811
69 Ga0070707_100259620 3300005468 Bacteria 1690
70 Ga0070698_100006494 3300005471 Bacteria 12684
71 Ga0070698_100024963 3300005471 Bacteria 6230
72 Ga0070699_100005528 3300005518 Bacteria 11075
73 Ga0070699_100011804 3300005518 Bacteria 7538
74 Ga0070684_100061250 3300005535 Bacteria 3293
75 Ga0070697_100210635 3300005536 Bacteria 1655
76 Ga0070672_100019473 3300005543 Bacteria 4926
77 Ga0070672_100039953 3300005543 Bacteria 3597
78 Ga0070672_100062025 3300005543 Bacteria 2949
79 Ga0070672_100149792 3300005543 Bacteria 1929
80 Ga0070686_100013152 3300005544 Unclassified 4728
81 Ga0070686_100017209 3300005544 Bacteria 4220
82 Ga0070686_100085887 3300005544 Unclassified 2094
83 Ga0070686_100328961 3300005544 Unclassified 1142
84 Ga0070686_100338579 3300005544 Bacteria 1127
85 Ga0070695_100000155 3300005545 Bacteria 32258
86 Ga0070695_100012116 3300005545 Bacteria 5168
87 Ga0070695_100139586 3300005545 Unclassified 1679
88 Ga0070696_100000499 3300005546 Bacteria 24777
89 Ga0070696_100018420 3300005546 Bacteria 4719
90 Ga0070696_100020527 3300005546 Bacteria 4476
91 Ga0070665_100127266 3300005548 Unclassified 2550
92 Ga0070665_100542356 3300005548 Bacteria 1175
93 Ga0070704_100001916 3300005549 Bacteria 11493
94 Ga0070704_100021875 3300005549 Bacteria 4154
95 Ga0070704_100022977 3300005549 Bacteria 4065
96 Ga0070704_100062787 3300005549 Bacteria 2664
97 Ga0070704_100122239 3300005549 Bacteria 2002
98 Ga0070664_100010026 3300005564 Bacteria 7678
99 Ga0070664_100033709 3300005564 Bacteria 4292
100 Ga0068857_100034333 3300005577 Bacteria 4486
101 Ga0068857_100161724 3300005577 Unclassified 2032
102 Ga0070702_100121131 3300005615 Bacteria 1638
103 Ga0070702_100133334 3300005615 Bacteria 1572
104 Ga0068852_100354186 3300005616 Bacteria 1434
105 Ga0068859_100013649 3300005617 Bacteria 8143
106 Ga0068859_100021732 3300005617 Bacteria 6437
107 Ga0068859_100137800 3300005617 Unclassified 2514
108 Ga0068864_100006351 3300005618 Bacteria 9693
109 Ga0068864_100018848 3300005618 Bacteria 5770
110 Ga0068864_100022739 3300005618 Bacteria 5257
111 Ga0068864_100031978 3300005618 Bacteria 4468
112 Ga0068861_100016529 3300005719 Bacteria 5222
113 Ga0068870_10014057 3300005840 Unclassified 3774
114 Ga0068870_10029164 3300005840 Unclassified 2777
115 Ga0068870_10154392 3300005840 Bacteria 1355
116 Ga0068870_10201163 3300005840 Unclassified 1208
117 Ga0068863_100012665 3300005841 Bacteria 8133
118 Ga0068863_100060573 3300005841 Bacteria 3579
119 Ga0068858_100048179 3300005842 Bacteria 3949
120 Ga0068860_100010476 3300005843 Bacteria 9164
121 Ga0068862_100007446 3300005844 Bacteria 9076
122 Ga0068862_100053872 3300005844 Unclassified 3444
123 Ga0068862_100067718 3300005844 Bacteria 3079
124 Ga0081539_10000093 3300005985 Bacteria 207314
125 Ga0081539_10001136 3300005985 Bacteria 48290
126 Ga0081539_10009894 3300005985 Bacteria 7865
127 Ga0070717_10610844 3300006028 Unclassified 989
128 Ga0097621_100054679 3300006237 Unclassified 3257
129 Ga0097621_100432357 3300006237 Bacteria 1183
130 Ga0068871_100025290 3300006358 Bacteria 4617
131 Ga0068871_100237891 3300006358 Bacteria 1582
132 Ga0068871_100247724 3300006358 Bacteria 1551
133 Ga0075428_100000607 3300006844 Bacteria 36552
134 Ga0075428_100001280 3300006844 Bacteria 26808
135 Ga0075428_100011749 3300006844 Bacteria 9748
136 Ga0075428_100108950 3300006844 Bacteria 3019
137 Ga0075428_100575325 3300006844 Bacteria 1204
138 Ga0075430_100001572 3300006846 Bacteria 18678
139 Ga0075430_100004185 3300006846 Bacteria 12176
140 Ga0075430_100068393 3300006846 Bacteria 2980
141 Ga0075430_100073792 3300006846 Unclassified 2860
142 Ga0075431_100002665 3300006847 Bacteria 17289
143 Ga0075431_100011953 3300006847 Bacteria 8758
144 Ga0075431_100123227 3300006847 Bacteria 2674
145 Ga0075433_10020715 3300006852 Bacteria 5503
146 Ga0075433_10022945 3300006852 Bacteria 5245
147 Ga0075433_10031706 3300006852 Bacteria 4520
148 Ga0075433_10069749 3300006852 Bacteria 3088
149 Ga0075434_100000553 3300006871 Bacteria 28642
150 Ga0075434_100002820 3300006871 Bacteria 15389
151 Ga0075434_100007812 3300006871 Bacteria 9910
152 Ga0075434_100195249 3300006871 Bacteria 2044
153 Ga0075434_100345764 3300006871 Bacteria 1508
154 Ga0075429_100000181 3300006880 Bacteria 41066
155 Ga0075429_100067113 3300006880 Bacteria 3122
156 Ga0075429_100351808 3300006880 Bacteria 1290
157 Ga0097620_100013648 3300006931 Bacteria 8143
158 Ga0097620_100021731 3300006931 Bacteria 6437
159 Ga0097620_100137803 3300006931 Unclassified 2514
160 Ga0075435_100229558 3300007076 Bacteria 1577
161 Ga0111539_10000324 3300009094 Bacteria 58406
162 Ga0111539_10001197 3300009094 Bacteria 34523
163 Ga0111539_10003864 3300009094 Bacteria 19722
164 Ga0111539_10049988 3300009094 Bacteria 4982
165 Ga0111539_10063595 3300009094 Unclassified 4366
166 Ga0111539_10080919 3300009094 Bacteria 3821
167 Ga0111539_10122736 3300009094 Bacteria 3045
168 Ga0105245_10236264 3300009098 Bacteria 1770
169 Ga0114129_10002976 3300009147 Bacteria 23733
170 Ga0114129_10016230 3300009147 Bacteria 10597
171 Ga0114129_10027426 3300009147 Bacteria 8062
172 Ga0114129_10057341 3300009147 Bacteria 5451
173 Ga0114129_10252072 3300009147 Bacteria 2369
174 Ga0105243_10038268 3300009148 Bacteria 3735
175 Ga0105242_10150347 3300009176 Bacteria 2030
176 Ga0105248_10101435 3300009177 Bacteria 3244
177 Ga0105248_10263823 3300009177 Unclassified 1939
178 Ga0105249_10000918 3300009553 Bacteria 26060
179 Ga0105249_10197116 3300009553 Bacteria 1969
180 Ga0105249_10419299 3300009553 Bacteria 1372
181 Ga0105246_10009021 3300011119 Bacteria 6141
182 Ga0157378_10032310 3300013297 Bacteria 4625
183 Ga0157378_10046818 3300013297 Bacteria 3843
184 Ga0157375_10255871 3300013308 Unclassified 1912
185 Ga0157375_10317935 3300013308 Bacteria 1721
186 Ga0163163_10011235 3300014325 Bacteria 8114
187 Ga0163163_10036276 3300014325 Bacteria 4789
188 Ga0157380_10008748 3300014326 Bacteria 7233
189 Ga0157380_10009758 3300014326 Bacteria 6889
190 Ga0157377_10003692 3300014745 Bacteria 6944
191 Ga0157377_10020487 3300014745 Bacteria 3466
192 Ga0163161_10021667 3300017792 Bacteria 4516
193 Ga0163161_10057022 3300017792 Unclassified 2838
194 Ga0207697_10001216 3300025315 Bacteria 14092
195 Ga0207697_10016986 3300025315 Unclassified 2993
196 Ga0207682_10000256 3300025893 Bacteria 23951
197 Ga0207688_10007265 3300025901 Bacteria 6029
198 Ga0207688_10020554 3300025901 Bacteria 3605
199 Ga0207680_10116832 3300025903 Bacteria 1739
200 Ga0207645_10001189 3300025907 Bacteria 21501
201 Ga0207643_10009439 3300025908 Bacteria 5243
202 Ga0207643_10015276 3300025908 Bacteria 4178
203 Ga0207643_10058397 3300025908 Unclassified 2199
204 Ga0207662_10032685 3300025918 Bacteria 3030
205 Ga0207662_10087136 3300025918 Bacteria 1915
206 Ga0207657_10464841 3300025919 Bacteria 992
207 Ga0207649_10018941 3300025920 Bacteria 3927
208 Ga0207646_10082472 3300025922 Bacteria 2875
209 Ga0207646_10182646 3300025922 Unclassified 1895
210 Ga0207646_10204946 3300025922 Bacteria 1782
211 Ga0207681_10171679 3300025923 Bacteria 1644
212 Ga0207681_10193131 3300025923 Bacteria 1559
213 Ga0207650_10285500 3300025925 Bacteria 1345
214 Ga0207659_10011871 3300025926 Bacteria 5519
215 Ga0207659_10048884 3300025926 Bacteria 2998
216 Ga0207659_10080868 3300025926 Unclassified 2401
217 Ga0207659_10267060 3300025926 Bacteria 1394
218 Ga0207659_10428355 3300025926 Bacteria 1111
219 Ga0207687_10377230 3300025927 Bacteria 1161
220 Ga0207644_10004067 3300025931 Bacteria 9485
221 Ga0207706_10000390 3300025933 Bacteria 47471
222 Ga0207706_10129896 3300025933 Unclassified 2216
223 Ga0207706_10535756 3300025933 Bacteria 1009
224 Ga0207686_10138500 3300025934 Bacteria 1679
225 Ga0207670_10098065 3300025936 Bacteria 2088
226 Ga0207669_10001315 3300025937 Bacteria 10568
227 Ga0207669_10288328 3300025937 Bacteria 1242
228 Ga0207704_10403785 3300025938 Bacteria 1079
229 Ga0207691_10003570 3300025940 Bacteria 15135
230 Ga0207691_10008721 3300025940 Bacteria 9726
231 Ga0207691_10011389 3300025940 Bacteria 8536
232 Ga0207691_10056446 3300025940 Unclassified 3577
233 Ga0207691_10135641 3300025940 Bacteria 2170
234 Ga0207711_10033184 3300025941 Unclassified 4366
235 Ga0207689_10015707 3300025942 Bacteria 6410
236 Ga0207689_10043869 3300025942 Bacteria 3697
237 Ga0207689_10456035 3300025942 Unclassified 1069
238 Ga0207661_10206666 3300025944 Bacteria 1729
239 Ga0207679_10006630 3300025945 Bacteria 7325
240 Ga0207679_10050412 3300025945 Bacteria 3042
241 Ga0207651_10013572 3300025960 Bacteria 4668
242 Ga0207651_10018299 3300025960 Bacteria 4164
243 Ga0207651_10034020 3300025960 Bacteria 3295
244 Ga0207712_10005085 3300025961 Bacteria 8316
245 Ga0207668_10339083 3300025972 Unclassified 1253
246 Ga0207640_10114782 3300025981 Bacteria 1917
247 Ga0207658_10076056 3300025986 Bacteria 2557
248 Ga0207678_10200737 3300026067 Bacteria 1705
249 Ga0207708_10009222 3300026075 Bacteria 7304
250 Ga0207708_10075136 3300026075 Bacteria 2591
251 Ga0207708_10075600 3300026075 Bacteria 2583
252 Ga0207708_10123178 3300026075 Bacteria 2021
253 Ga0207648_10027493 3300026089 Bacteria 5049
254 Ga0207648_10049813 3300026089 Bacteria 3664
255 Ga0207648_10197153 3300026089 Bacteria 1785
256 Ga0207648_10541489 3300026089 Archaea 1068
257 Ga0207676_10035206 3300026095 Bacteria 3798
258 Ga0207674_10074662 3300026116 Unclassified 3402
259 Ga0207674_10256419 3300026116 Unclassified 1696
260 Ga0207674_10531290 3300026116 Bacteria 1136
261 Ga0207675_100011352 3300026118 Bacteria 8337
262 Ga0207675_100119205 3300026118 Unclassified 2496
263 Ga0207683_10001056 3300026121 Bacteria 25103
264 Ga0207683_10066263 3300026121 Unclassified 3184
265 Ga0207683_10076646 3300026121 Bacteria 2960
266 Ga0207683_10088414 3300026121 Unclassified 2756
267 Ga0268265_10008166 3300028380 Bacteria 7071
268 Ga0268265_10031877 3300028380 Unclassified 3811
269 Ga0268265_10046541 3300028380 Unclassified 3244
270 Ga0268265_10599069 3300028380 Bacteria 1053
271 Ga0307405_10061946 3300031731 Bacteria 2367
272 Ga0307411_10021505 3300032005 Bacteria 3777
273 Ga0373958_0022369 3300034819 Unclassified 1181
274 Ga0373932_0035712 3300035112 Bacteria 1407
275 Ga0373955_0133176 3300035172 Bacteria 1452
276 Ga0373935_0236068 3300035692 Bacteria 1275
277 Ga0450908_009879 3300042184 Bacteria 1766
278 Ga0439435_0015511 3300042436 Bacteria 1898
279 Ga0453683_0026774 3300044673 Bacteria 3661
280 Ga0451576_0006590 3300045051 Bacteria 14199
281 Ga0451576_0044131 3300045051 Bacteria 4701
282 Ga0495603_0088390 3300046455 Bacteria 1813
283 Ga0495629_0057321 3300046459 Bacteria 2724
284 Ga0495582_0156836 3300046473 Bacteria 1294
285 Ga0495584_0057969 3300046491 Bacteria 1948
286 Ga0495663_0028317 3300046525 Bacteria 1648
287 Ga0495598_0015356 3300046537 Bacteria 1932
288 Ga0495621_0004158 3300046539 Bacteria 4039
289 Ga0495621_0035034 3300046539 Bacteria 1736
290 Ga0495635_0027213 3300046663 Bacteria 3978
291 Ga0495659_0040166 3300046664 Bacteria 1666
292 Ga0495659_0117272 3300046664 Unclassified 1045
293 Ga0495658_0353367 3300046683 Unclassified 934
294 Ga0495669_0021187 3300046684 Bacteria 2819
295 Ga0495636_0065495 3300047318 Unclassified 1543
296 Ga0495676_0020998 3300047321 Bacteria 5715
297 Ga0495677_0056415 3300047445 Bacteria 1451
298 Ga0495685_020804 3300047447 Bacteria 2256
299 Ga0496100_0358304 3300048903 Bacteria 1103
300 Ga0496101_0531037 3300048904 Unclassified 930
301 Ga0496104_0044216 3300048907 Unclassified 4185
302 Ga0496108_0233833 3300048911 Bacteria 1598
303 Ga0496108_0519132 3300048911 Bacteria 1040
304 Ga0496109_0004075 3300048912 Bacteria 12214
305 Ga0496110_0072018 3300048913 Bacteria 3066
306 Ga0501031_0005681 3300049568 Bacteria 8127
307 Ga0501031_0041982 3300049568 Bacteria 2986
308 Ga0501032_0009519 3300049569 Bacteria 7040
309 Ga0501032_0025499 3300049569 Bacteria 4075
310 Ga0501033_0000468 3300049570 Bacteria 38258
311 Ga0501033_0012216 3300049570 Bacteria 6555
312 Ga0501033_0019271 3300049570 Bacteria 5156
313 Ga0501034_0007511 3300049571 Bacteria 11596
314 Ga0501034_0054494 3300049571 Bacteria 4025
315 Ga0501036_0003443 3300049572 Bacteria 12639
316 Ga0501036_0008878 3300049572 Bacteria 8254
317 Ga0501036_0032613 3300049572 Bacteria 4402
318 Ga0501037_0002140 3300049573 Bacteria 14294
319 Ga0501038_0005382 3300049574 Bacteria 11892
320 Ga0501038_0006096 3300049574 Bacteria 11156
321 Ga0501038_0034586 3300049574 Bacteria 4442
322 Ga0501039_0003770 3300049575 Bacteria 11396
323 Ga0501041_0043831 3300049577 Unclassified 2720
324 Ga0501042_0008787 3300049578 Bacteria 6697
325 Ga0501043_0010864 3300049579 Bacteria 7129
326 Ga0501043_0037405 3300049579 Bacteria 3817
327 Ga0501043_0048854 3300049579 Bacteria 3325
328 Ga0501046_0004454 3300049580 Bacteria 12707
329 Ga0501046_0019269 3300049580 Bacteria 5659
330 Ga0501046_0177555 3300049580 Bacteria 1594
331 Ga0501047_0009075 3300049581 Bacteria 9391
332 Ga0501047_0070390 3300049581 Bacteria 3368
333 Ga0501048_0002710 3300049582 Bacteria 13512
334 Ga0501048_0014280 3300049582 Bacteria 5882
335 Ga0501048_0018089 3300049582 Bacteria 5185
336 Ga0501067_0000350 3300049583 Bacteria 25133
337 Ga0501068_0001746 3300049584 Bacteria 11555
338 Ga0501068_0040053 3300049584 Bacteria 2811
339 Ga0501069_0001158 3300049585 Bacteria 12763
340 Ga0501069_0011560 3300049585 Bacteria 4678
341 Ga0501069_0020568 3300049585 Bacteria 3576
342 Ga0501070_0007306 3300049586 Bacteria 9382
343 Ga0501070_0024467 3300049586 Bacteria 5064
344 Ga0501071_0036522 3300049587 Unclassified 3505
345 Ga0501071_0077537 3300049587 Bacteria 2427
346 Ga0501072_0031998 3300049588 Bacteria 4118
347 Ga0501073_0004471 3300049589 Bacteria 10499
348 Ga0501073_0014209 3300049589 Bacteria 5782
349 Ga0501073_0064652 3300049589 Bacteria 2551
350 Ga0501074_0002277 3300049590 Bacteria 13353
351 Ga0501074_0008235 3300049590 Bacteria 7559
352 Ga0501074_0063127 3300049590 Bacteria 2668
353 Ga0501075_0115244 3300049591 Unclassified 2043
354 Ga0501076_0087340 3300049592 Bacteria 2507
355 Ga0501079_0007827 3300049741 Bacteria 8090
356 Ga0501079_0008910 3300049741 Bacteria 7597
357 Ga0501079_0013088 3300049741 Bacteria 6327
358 Ga0501080_0005023 3300049742 Bacteria 11784
359 Ga0501080_0019306 3300049742 Bacteria 6314
360 Ga0501080_0050189 3300049742 Bacteria 3884
361 Ga0501083_0013506 3300049744 Bacteria 5708
362 Ga0501083_0017269 3300049744 Bacteria 5031
363 Ga0501035_0010139 3300049822 Bacteria 8744
364 Ga0501035_0016240 3300049822 Bacteria 6870
365 Ga0501035_0038683 3300049822 Bacteria 4318
366 Ga0501044_0012129 3300049823 Bacteria 9332
367 Ga0501044_0165657 3300049823 Bacteria 2184
368 Ga0501045_0048871 3300049824 Bacteria 3083
369 Ga0501045_0052800 3300049824 Bacteria 2969
370 nmdc:mga05p37_61461_c1 3300050507 Bacteria 4624
371 nmdc:mga05p37_7663_c1 3300050507 Bacteria 12739
372 nmdc:mga09592_17655_c1 3300050508 Bacteria 5848
373 nmdc:mga09592_392447_c1 3300050508 Bacteria 1200
374 nmdc:mga09592_9218_c1 3300050508 Bacteria 8026
375 nmdc:mga0qj67_169030_c1 3300050509 Unclassified 1775
376 nmdc:mga0qj67_402_c1 3300050509 Bacteria 29827
377 nmdc:mga0qj67_66376_c1 3300050509 Bacteria 2874
378 nmdc:mga0qj67_937_c1 3300050509 Bacteria 20089
379 nmdc:mga06r32_21926_c1 3300050510 Bacteria 5898
380 nmdc:mga06r32_27812_c1 3300050510 Bacteria 5286
381 nmdc:mga06r32_3800_c1 3300050510 Unclassified 4217
382 nmdc:mga06r32_55180_c1 3300050510 Bacteria 3811
383 nmdc:mga06r32_90819_c1 3300050510 Bacteria 2984
384 nmdc:mga08y16_46813_c1 3300050511 Bacteria 4528
385 nmdc:mga08y16_610436_c1 3300050511 Bacteria 1099
386 nmdc:mga0n895_123465_c1 3300050512 Bacteria 2612
387 nmdc:mga0n895_14275_c1 3300050512 Bacteria 7207
388 nmdc:mga0n895_368946_c1 3300050512 Bacteria 1453
389 nmdc:mga0n895_3887_c1 3300050512 Bacteria 12137
390 nmdc:mga0n895_4653_c1 3300050512 Bacteria 11318
391 nmdc:mga0n895_522408_c1 3300050512 Bacteria 1195
392 nmdc:mga0rr50_114490_c1 3300050513 Bacteria 2139
393 nmdc:mga0rr50_203944_c1 3300050513 Bacteria 1626
394 nmdc:mga0rr50_24440_c1 3300050513 Bacteria 4184
395 nmdc:mga0rr50_310125_c1 3300050513 Unclassified 1321
396 nmdc:mga0a205_21905_c1 3300050515 Bacteria 6044
397 nmdc:mga0a205_39916_c1 3300050515 Bacteria 1601
398 nmdc:mga0a205_52311_c1 3300050515 Bacteria 3942
399 Ga0495601_0021083 3300053077 Unclassified 3987
400 Ga0495595_0029562 3300053084 Unclassified 2453
401 Ga0501084_0003177 3300054114 Bacteria 13288
402 Ga0501084_0064879 3300054114 Bacteria 3055
403 Ga0501084_0101786 3300054114 Bacteria 2412
404 Ga0501082_0006845 3300060353 Bacteria 9856
405 Ga0501082_0010821 3300060353 Bacteria 7855
406 Ga0070670_100001433
407 MRS1b_contig_6635214
408 JGI25406J46586_10000701
409 JGI25406J46586_10004848
410 JGI25406J46586_10027343
411 Ga0065714_10078145
412 Ga0065704_10084663
413 Ga0065712_10000375
414 Ga0065712_10006902
415 Ga0065715_10000319
416 Ga0065715_10001450
417 Ga0065715_10171088
418 Ga0065707_10009483
419 Ga0065707_10114792
420 Ga0065707_10117658
421 Ga0070676_10011129
422 Ga0070676_10108258
423 Ga0070683_100063512
424 Ga0070670_100060217
425 Ga0070670_100391328
426 Ga0070670_100554806
427 Ga0070677_10000843
428 Ga0070677_10051186
429 Ga0068869_100026379
430 Ga0068869_100099569
431 Ga0070666_10002720
432 Ga0068868_100477513
433 Ga0070689_100035095
434 Ga0070689_100058506
435 Ga0070661_100013533
436 Ga0070692_10000087
437 Ga0070668_100304805
438 Ga0070669_100289601
439 Ga0070675_100039970
440 Ga0070675_100079977
441 Ga0070675_100227246
442 Ga0070671_100008027
443 Ga0070674_100000192
444 Ga0070674_100104130
445 Ga0070674_100310588
446 Ga0070674_100369816
447 Ga0070673_100006411
448 Ga0070673_100027254
449 Ga0070673_100034412
450 Ga0070673_100194493
451 Ga0070688_100013169
452 Ga0070667_100013748
453 Ga0070667_100099993
454 Ga0070705_100004014
455 Ga0070705_100020385
456 Ga0070700_100043878
457 Ga0070700_100167787
458 Ga0070694_100001263
459 Ga0070694_100001421
460 Ga0070694_100002505
461 Ga0070708_100235796
462 Ga0070663_100423316
463 Ga0070678_100127992
464 Ga0070678_100246460
465 Ga0070662_100025846
466 Ga0070681_10078581
467 Ga0068867_100072093
468 Ga0070685_10001382
469 Ga0070685_10041081
470 Ga0070706_100078007
471 Ga0070706_100130016
472 Ga0070707_100060306
473 Ga0070707_100228695
474 Ga0070707_100259620
475 Ga0070698_100006494
476 Ga0070698_100024963
477 Ga0070699_100005528
478 Ga0070699_100011804
479 Ga0070684_100061250
480 Ga0070697_100210635
481 Ga0070672_100019473
482 Ga0070672_100039953
483 Ga0070672_100062025
484 Ga0070672_100149792
485 Ga0070686_100013152
486 Ga0070686_100017209
487 Ga0070686_100085887
488 Ga0070686_100328961
489 Ga0070686_100338579
490 Ga0070695_100000155
491 Ga0070695_100012116
492 Ga0070695_100139586
493 Ga0070696_100000499
494 Ga0070696_100018420
495 Ga0070696_100020527
496 Ga0070665_100127266
497 Ga0070665_100542356
498 Ga0070704_100001916
499 Ga0070704_100021875
500 Ga0070704_100022977
501 Ga0070704_100062787
502 Ga0070704_100122239
503 Ga0070664_100010026
504 Ga0070664_100033709
505 Ga0068857_100034333
506 Ga0068857_100161724
507 Ga0070702_100121131
508 Ga0070702_100133334
509 Ga0068852_100354186
510 Ga0068859_100013649
511 Ga0068859_100021732
512 Ga0068859_100137800
513 Ga0068864_100006351
514 Ga0068864_100018848
515 Ga0068864_100022739
516 Ga0068864_100031978
517 Ga0068861_100016529
518 Ga0068870_10014057
519 Ga0068870_10029164
520 Ga0068870_10154392
521 Ga0068870_10201163
522 Ga0068863_100012665
523 Ga0068863_100060573
524 Ga0068858_100048179
525 Ga0068860_100010476
526 Ga0068862_100007446
527 Ga0068862_100053872
528 Ga0068862_100067718
529 Ga0081539_10000093
530 Ga0081539_10001136
531 Ga0081539_10009894
532 Ga0070717_10610844
533 Ga0097621_100054679
534 Ga0097621_100432357
535 Ga0068871_100025290
536 Ga0068871_100237891
537 Ga0068871_100247724
538 Ga0075428_100000607
539 Ga0075428_100001280
540 Ga0075428_100011749
541 Ga0075428_100108950
542 Ga0075428_100575325
543 Ga0075430_100001572
544 Ga0075430_100004185
545 Ga0075430_100068393
546 Ga0075430_100073792
547 Ga0075431_100002665
548 Ga0075431_100011953
549 Ga0075431_100123227
550 Ga0075433_10020715
551 Ga0075433_10022945
552 Ga0075433_10031706
553 Ga0075433_10069749
554 Ga0075434_100000553
555 Ga0075434_100002820
556 Ga0075434_100007812
557 Ga0075434_100195249
558 Ga0075434_100345764
559 Ga0075429_100000181
560 Ga0075429_100067113
561 Ga0075429_100351808
562 Ga0097620_100013648
563 Ga0097620_100021731
564 Ga0097620_100137803
565 Ga0075435_100229558
566 Ga0111539_10000324
567 Ga0111539_10001197
568 Ga0111539_10003864
569 Ga0111539_10049988
570 Ga0111539_10063595
571 Ga0111539_10080919
572 Ga0111539_10122736
573 Ga0105245_10236264
574 Ga0114129_10002976
575 Ga0114129_10016230
576 Ga0114129_10027426
577 Ga0114129_10057341
578 Ga0114129_10252072
579 Ga0105243_10038268
580 Ga0105242_10150347
581 Ga0105248_10101435
582 Ga0105248_10263823
583 Ga0105249_10000918
584 Ga0105249_10197116
585 Ga0105249_10419299
586 Ga0105246_10009021
587 Ga0157378_10032310
588 Ga0157378_10046818
589 Ga0157375_10255871
590 Ga0157375_10317935
591 Ga0163163_10011235
592 Ga0163163_10036276
593 Ga0157380_10008748
594 Ga0157380_10009758
595 Ga0157377_10003692
596 Ga0157377_10020487
597 Ga0163161_10021667
598 Ga0163161_10057022
599 Ga0207697_10001216
600 Ga0207697_10016986
601 Ga0207682_10000256
602 Ga0207688_10007265
603 Ga0207688_10020554
604 Ga0207680_10116832
605 Ga0207645_10001189
606 Ga0207643_10009439
607 Ga0207643_10015276
608 Ga0207643_10058397
609 Ga0207662_10032685
610 Ga0207662_10087136
611 Ga0207657_10464841
612 Ga0207649_10018941
613 Ga0207646_10082472
614 Ga0207646_10182646
615 Ga0207646_10204946
616 Ga0207681_10171679
617 Ga0207681_10193131
618 Ga0207650_10285500
619 Ga0207659_10011871
620 Ga0207659_10048884
621 Ga0207659_10080868
622 Ga0207659_10267060
623 Ga0207659_10428355
624 Ga0207687_10377230
625 Ga0207644_10004067
626 Ga0207706_10000390
627 Ga0207706_10129896
628 Ga0207706_10535756
629 Ga0207686_10138500
630 Ga0207670_10098065
631 Ga0207669_10001315
632 Ga0207669_10288328
633 Ga0207704_10403785
634 Ga0207691_10003570
635 Ga0207691_10008721
636 Ga0207691_10011389
637 Ga0207691_10056446
638 Ga0207691_10135641
639 Ga0207711_10033184
640 Ga0207689_10015707
641 Ga0207689_10043869
642 Ga0207689_10456035
643 Ga0207661_10206666
644 Ga0207679_10006630
645 Ga0207679_10050412
646 Ga0207651_10013572
647 Ga0207651_10018299
648 Ga0207651_10034020
649 Ga0207712_10005085
650 Ga0207668_10339083
651 Ga0207640_10114782
652 Ga0207658_10076056
653 Ga0207678_10200737
654 Ga0207708_10009222
655 Ga0207708_10075136
656 Ga0207708_10075600
657 Ga0207708_10123178
658 Ga0207648_10027493
659 Ga0207648_10049813
660 Ga0207648_10197153
661 Ga0207648_10541489
662 Ga0207676_10035206
663 Ga0207674_10074662
664 Ga0207674_10256419
665 Ga0207674_10531290
666 Ga0207675_100011352
667 Ga0207675_100119205
668 Ga0207683_10001056
669 Ga0207683_10066263
670 Ga0207683_10076646
671 Ga0207683_10088414
672 Ga0268265_10008166
673 Ga0268265_10031877
674 Ga0268265_10046541
675 Ga0268265_10599069
676 Ga0307405_10061946
677 Ga0307411_10021505
678 Ga0373958_0022369
679 Ga0373932_0035712
680 Ga0373955_0133176
681 Ga0373935_0236068
682 Ga0450908_009879
683 Ga0439435_0015511
684 Ga0453683_0026774
685 Ga0451576_0006590
686 Ga0451576_0044131
687 Ga0495603_0088390
688 Ga0495629_0057321
689 Ga0495582_0156836
690 Ga0495584_0057969
691 Ga0495663_0028317
692 Ga0495598_0015356
693 Ga0495621_0004158
694 Ga0495621_0035034
695 Ga0495635_0027213
696 Ga0495659_0040166
697 Ga0495659_0117272
698 Ga0495658_0353367
699 Ga0495669_0021187
700 Ga0495636_0065495
701 Ga0495676_0020998
702 Ga0495677_0056415
703 Ga0495685_020804
704 Ga0496100_0358304
705 Ga0496101_0531037
706 Ga0496104_0044216
707 Ga0496108_0233833
708 Ga0496108_0519132
709 Ga0496109_0004075
710 Ga0496110_0072018
711 Ga0501031_0005681
712 Ga0501031_0041982
713 Ga0501032_0009519
714 Ga0501032_0025499
715 Ga0501033_0000468
716 Ga0501033_0012216
717 Ga0501033_0019271
718 Ga0501034_0007511
719 Ga0501034_0054494
720 Ga0501036_0003443
721 Ga0501036_0008878
722 Ga0501036_0032613
723 Ga0501037_0002140
724 Ga0501038_0005382
725 Ga0501038_0006096
726 Ga0501038_0034586
727 Ga0501039_0003770
728 Ga0501041_0043831
729 Ga0501042_0008787
730 Ga0501043_0010864
731 Ga0501043_0037405
732 Ga0501043_0048854
733 Ga0501046_0004454
734 Ga0501046_0019269
735 Ga0501046_0177555
736 Ga0501047_0009075
737 Ga0501047_0070390
738 Ga0501048_0002710
739 Ga0501048_0014280
740 Ga0501048_0018089
741 Ga0501067_0000350
742 Ga0501068_0001746
743 Ga0501068_0040053
744 Ga0501069_0001158
745 Ga0501069_0011560
746 Ga0501069_0020568
747 Ga0501070_0007306
748 Ga0501070_0024467
749 Ga0501071_0036522
750 Ga0501071_0077537
751 Ga0501072_0031998
752 Ga0501073_0004471
753 Ga0501073_0014209
754 Ga0501073_0064652
755 Ga0501074_0002277
756 Ga0501074_0008235
757 Ga0501074_0063127
758 Ga0501075_0115244
759 Ga0501076_0087340
760 Ga0501079_0007827
761 Ga0501079_0008910
762 Ga0501079_0013088
763 Ga0501080_0005023
764 Ga0501080_0019306
765 Ga0501080_0050189
766 Ga0501083_0013506
767 Ga0501083_0017269
768 Ga0501035_0010139
769 Ga0501035_0016240
770 Ga0501035_0038683
771 Ga0501044_0012129
772 Ga0501044_0165657
773 Ga0501045_0048871
774 Ga0501045_0052800
775 nmdc:mga05p37_61461_c1
776 nmdc:mga05p37_7663_c1
777 nmdc:mga09592_17655_c1
778 nmdc:mga09592_392447_c1
779 nmdc:mga09592_9218_c1
780 nmdc:mga0qj67_169030_c1
781 nmdc:mga0qj67_402_c1
782 nmdc:mga0qj67_66376_c1
783 nmdc:mga0qj67_937_c1
784 nmdc:mga06r32_21926_c1
785 nmdc:mga06r32_27812_c1
786 nmdc:mga06r32_3800_c1
787 nmdc:mga06r32_55180_c1
788 nmdc:mga06r32_90819_c1
789 nmdc:mga08y16_46813_c1
790 nmdc:mga08y16_610436_c1
791 nmdc:mga0n895_123465_c1
792 nmdc:mga0n895_14275_c1
793 nmdc:mga0n895_368946_c1
794 nmdc:mga0n895_3887_c1
795 nmdc:mga0n895_4653_c1
796 nmdc:mga0n895_522408_c1
797 nmdc:mga0rr50_114490_c1
798 nmdc:mga0rr50_203944_c1
799 nmdc:mga0rr50_24440_c1
800 nmdc:mga0rr50_310125_c1
801 nmdc:mga0a205_21905_c1
802 nmdc:mga0a205_39916_c1
803 nmdc:mga0a205_52311_c1
804 Ga0495601_0021083
805 Ga0495595_0029562
806 Ga0501084_0003177
807 Ga0501084_0064879
808 Ga0501084_0101786
809 Ga0501082_0006845
810 Ga0501082_0010821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02274

ADI

Arginine deiminase

223

306

0.91

PF02274

ADI

Arginine deiminase

91

226

0.87

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

53

305

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.886 6 287
6juy-assembly1.cif.gz_B crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8854 8 287
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8849 8 287
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.8763 7 281
6juz-assembly1.cif.gz_A crystal structure of n-terminal domain of argz(n71s) covalently bond to a reaction intermediate 0.8761 10 286
ID Description Score Start End Superfamily
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9069 36 280 3.75.10.10
af_A0A1D6JTA1_151_233_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8941 240 265 3.40.50.1100
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8844 8 284 3.75.10.10
af_Q6NKY5_75_177_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8802 240 265 3.40.50.1100
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8781 8 284 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A2E0PKF6-F1-model_v4 Amidinotransferase 0.9945 6 287 GO:0016990
GO:0019546
AF-A0A1Q7Z7V1-F1-model_v4 Amidinotransferase 0.9932 12 248 GO:0016990
GO:0019546
AF-A0A382ZF63-F1-model_v4 Amidinotransferase 0.9926 31 287 GO:0016990
GO:0019546
AF-A0A388NYZ8-F1-model_v4 Arginine deiminase 0.9917 187 287 GO:0006527
GO:0016990
AF-A0A5C7MN02-F1-model_v4 Amidinotransferase 0.9912 3 155 GO:0016990
GO:0019546

Map