F435849

General Info

Members Datasets Scaffolds Average Seq Length
405 230 392 209

Family's Representative Sequence

Representative Sequence 3300003761|Ga0055535_1002349|Ga0055535_10023494
Length 204
Sequence MLKLEVYLINIMAQTSSITTLFIDIGGVLLTNGWDRAARKLAASTFSLDPVEFEERHHLTFDTYEEGKLTMDEYLNRIVFFMFSRTEPYNEMIEMICQLKEKYGLKIAIVNNEGRELNQYRITTFGINKFVDFFISSCFVHFRKPDADIFRIALDIAFVKPKEVLYIEDRAMFVSVAEGLGINGLLHVDYASTKEKLASYGLIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2914759650 Rhizosphaericola mali Isolate Rhizosphere
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
12 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
13 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
161 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
162 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
217 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 0.25
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0
Rhizoplane 0.25
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2331142 2162886007 Bacteria 920
2 JGI24740J21852_10009658 3300001979 Bacteria 3763
3 JGI24739J22299_10010942 3300001989 Unclassified 3355
4 JGI25154J39366_1000014 3300002738 Bacteria 265287
5 JGI25159J45721_1016808 3300002987 Bacteria 1544
6 JGI25153J46596_10012293 3300003215 Bacteria 3707
7 JGI25153J46596_10028917 3300003215 Unclassified 1912
8 rootH1_10041388 3300003316 Bacteria 5229
9 rootH2_10044532 3300003320 Bacteria 2753
10 rootH2_10063065 3300003320 Unclassified 1599
11 rootH2_10244250 3300003320 Unclassified 1394
12 rootH1_10022911 3300003323 Bacteria 25134
13 rootH1_10055761 3300003323 Bacteria 1956
14 rootH1_10086867 3300003323 Bacteria 5072
15 JGI25160J50197_1000469 3300003354 Bacteria 24764
16 JGI25160J50197_1006316 3300003354 Bacteria 4813
17 JGI25160J50197_1019274 3300003354 Bacteria 2097
18 Ga0055535_1002349 3300003761 Bacteria 6834
19 Ga0055528_1001321 3300003790 Bacteria 15499
20 Ga0055530_10001156 3300003791 Bacteria 20457
21 Ga0055531_10000255 3300003794 Bacteria 56959
22 Ga0065165_1000036 3300005262 Bacteria 212900
23 Ga0065165_1021086 3300005262 Bacteria 2272
24 Ga0065704_10073064 3300005289 Bacteria 7620
25 Ga0070690_100201936 3300005330 Bacteria 1384
26 Ga0070666_10015874 3300005335 Bacteria 4811
27 Ga0070680_100001790 3300005336 Bacteria 15774
28 Ga0070682_100001196 3300005337 Bacteria 14792
29 Ga0068868_100210447 3300005338 Bacteria 1625
30 Ga0070691_10102783 3300005341 Bacteria 1421
31 Ga0070661_100546407 3300005344 Bacteria 932
32 Ga0070669_100036318 3300005353 Bacteria 3570
33 Ga0070671_100083116 3300005355 Bacteria 2677
34 Ga0070667_100418329 3300005367 Bacteria 1221
35 Ga0070678_100012467 3300005456 Bacteria 5286
36 Ga0070662_100149881 3300005457 Bacteria 1815
37 Ga0070681_10003107 3300005458 Bacteria 15431
38 Ga0070698_100592096 3300005471 Bacteria 1049
39 Ga0070699_100691980 3300005518 Bacteria 931
40 Ga0070679_100006573 3300005530 Bacteria 10831
41 Ga0070684_100213272 3300005535 Bacteria 1760
42 Ga0068853_100069869 3300005539 Bacteria 3056
43 Ga0068853_100158724 3300005539 Bacteria 2039
44 Ga0068853_100596544 3300005539 Bacteria 1049
45 Ga0068855_100006424 3300005563 Bacteria 14312
46 Ga0068855_100009610 3300005563 Bacteria 11670
47 Ga0068855_100545995 3300005563 Bacteria 1255
48 Ga0068857_100039909 3300005577 Bacteria 4160
49 Ga0068857_100237386 3300005577 Bacteria 1668
50 Ga0068856_100000682 3300005614 Bacteria 36865
51 Ga0068856_100121651 3300005614 Bacteria 2612
52 Ga0070702_100168041 3300005615 Bacteria 1424
53 Ga0068852_100263789 3300005616 Bacteria 1655
54 Ga0068852_100487936 3300005616 Bacteria 1225
55 Ga0068859_100011386 3300005617 Bacteria 8945
56 Ga0068864_100318323 3300005618 Bacteria 1461
57 Ga0068866_10253229 3300005718 Bacteria 1078
58 Ga0068861_100328742 3300005719 Unclassified 1334
59 Ga0068870_10125252 3300005840 Bacteria 1485
60 Ga0068863_100180800 3300005841 Bacteria 2024
61 Ga0068863_100518570 3300005841 Bacteria 1175
62 Ga0068858_100316179 3300005842 Unclassified 1492
63 Ga0068860_100001417 3300005843 Bacteria 25958
64 Ga0068860_100114235 3300005843 Bacteria 2582
65 Ga0068862_100138054 3300005844 Unclassified 2162
66 Ga0068862_100635519 3300005844 Bacteria 1028
67 Ga0068862_100715612 3300005844 Bacteria 971
68 Ga0070715_10099626 3300006163 Unclassified 1353
69 Ga0097621_100081065 3300006237 Bacteria 2700
70 Ga0097621_100488352 3300006237 Bacteria 1114
71 Ga0068871_100083261 3300006358 Bacteria 2653
72 Ga0075433_10065601 3300006852 Bacteria 3184
73 Ga0075433_10764069 3300006852 Unclassified 845
74 Ga0075434_100123707 3300006871 Unclassified 2603
75 Ga0068865_101009579 3300006881 Unclassified 729
76 Ga0097620_100011386 3300006931 Bacteria 8945
77 Ga0105240_10000741 3300009093 Bacteria 59621
78 Ga0105240_10015004 3300009093 Bacteria 10551
79 Ga0105240_10279157 3300009093 Bacteria 1920
80 Ga0105247_10003669 3300009101 Bacteria 9972
81 Ga0105247_10428403 3300009101 Bacteria 949
82 Ga0105243_10385573 3300009148 Bacteria 1297
83 Ga0105243_11322897 3300009148 Unclassified 738
84 Ga0105241_10000232 3300009174 Bacteria 42050
85 Ga0105241_10512690 3300009174 Bacteria 1071
86 Ga0105237_10019971 3300009545 Bacteria 6917
87 Ga0105238_10485661 3300009551 Bacteria 1235
88 Ga0105249_10020007 3300009553 Bacteria 5977
89 Ga0105249_10065299 3300009553 Bacteria 3348
90 Ga0105249_10123377 3300009553 Bacteria 2464
91 Ga0105249_11221663 3300009553 Bacteria 823
92 Ga0105239_10002966 3300010375 Bacteria 21156
93 Ga0105246_10270011 3300011119 Bacteria 1359
94 Ga0157371_10002786 3300013102 Bacteria 16402
95 Ga0157371_10038479 3300013102 Unclassified 3422
96 Ga0157370_10000989 3300013104 Bacteria 35947
97 Ga0157370_10011361 3300013104 Bacteria 9324
98 Ga0157370_10134602 3300013104 Bacteria 2304
99 Ga0157370_10178432 3300013104 Bacteria 1974
100 Ga0157370_10336821 3300013104 Bacteria 1391
101 Ga0157369_10177054 3300013105 Unclassified 2245
102 Ga0157374_10079420 3300013296 Bacteria 3109
103 Ga0157374_10578376 3300013296 Bacteria 1132
104 Ga0163162_10001381 3300013306 Bacteria 22593
105 Ga0163162_10242169 3300013306 Bacteria 1935
106 Ga0157372_10764673 3300013307 Unclassified 1123
107 Ga0157372_11645821 3300013307 Bacteria 739
108 Ga0157375_10025841 3300013308 Bacteria 5463
109 Ga0163163_10072214 3300014325 Bacteria 3440
110 Ga0157379_10287957 3300014968 Bacteria 1496
111 Ga0157379_10338274 3300014968 Bacteria 1376
112 Ga0157376_10019851 3300014969 Bacteria 5188
113 Ga0182005_1000115 3300015265 Bacteria 57790
114 Ga0163161_10049111 3300017792 Bacteria 3048
115 Ga0209436_104776 3300025208 Bacteria 3270
116 Ga0209258_100160 3300025242 Bacteria 154101
117 Ga0207425_1022637 3300025245 Bacteria 1321
118 Ga0209646_1000002 3300025246 Bacteria 1425781
119 Ga0209026_1001201 3300025250 Bacteria 11996
120 Ga0209148_1000153 3300025254 Bacteria 147028
121 Ga0209129_1034708 3300025258 Bacteria 824
122 Ga0209673_1000483 3300025273 Bacteria 66457
123 Ga0209130_1002792 3300025284 Bacteria 8180
124 Ga0209758_1004413 3300025297 Bacteria 11731
125 Ga0209758_1009863 3300025297 Bacteria 5833
126 Ga0209050_1000160 3300025298 Bacteria 157000
127 Ga0207426_1000322 3300025302 Bacteria 91914
128 Ga0207426_1001341 3300025302 Bacteria 20920
129 Ga0207426_1003689 3300025302 Bacteria 8034
130 Ga0209257_1000071 3300025304 Bacteria 335832
131 Ga0207710_10009133 3300025900 Bacteria 4173
132 Ga0207710_10221046 3300025900 Bacteria 940
133 Ga0207680_10173606 3300025903 Bacteria 1453
134 Ga0207643_10169494 3300025908 Bacteria 1317
135 Ga0207654_10000387 3300025911 Bacteria 25661
136 Ga0207654_10499980 3300025911 Bacteria 858
137 Ga0207707_10000247 3300025912 Bacteria 59237
138 Ga0207695_10146757 3300025913 Bacteria 2302
139 Ga0207695_10298022 3300025913 Bacteria 1504
140 Ga0207695_10492567 3300025913 Unclassified 1108
141 Ga0207671_10108993 3300025914 Bacteria 2105
142 Ga0207660_10001032 3300025917 Bacteria 18430
143 Ga0207649_10487991 3300025920 Unclassified 935
144 Ga0207652_10001102 3300025921 Bacteria 24374
145 Ga0207650_10563260 3300025925 Bacteria 956
146 Ga0207706_10009705 3300025933 Bacteria 8834
147 Ga0207661_10505316 3300025944 Unclassified 1105
148 Ga0207667_10009142 3300025949 Bacteria 11702
149 Ga0207667_10062499 3300025949 Bacteria 3893
150 Ga0207712_10105099 3300025961 Bacteria 2107
151 Ga0207640_10189588 3300025981 Bacteria 1549
152 Ga0207639_10015070 3300026041 Bacteria 5444
153 Ga0207639_10104654 3300026041 Bacteria 2295
154 Ga0207639_10444030 3300026041 Bacteria 1177
155 Ga0207639_10516390 3300026041 Unclassified 1093
156 Ga0207702_10000681 3300026078 Bacteria 36846
157 Ga0207702_10015867 3300026078 Bacteria 6237
158 Ga0207641_10146307 3300026088 Bacteria 2137
159 Ga0207648_10194235 3300026089 Bacteria 1799
160 Ga0207676_10072892 3300026095 Bacteria 2762
161 Ga0207674_10031888 3300026116 Bacteria 5531
162 Ga0207674_10080986 3300026116 Bacteria 3249
163 Ga0207674_10125497 3300026116 Bacteria 2533
164 Ga0207675_100154744 3300026118 Bacteria 2184
165 Ga0207683_10014974 3300026121 Bacteria 6601
166 Ga0207698_10433321 3300026142 Bacteria 1265
167 Ga0207698_10656983 3300026142 Bacteria 1039
168 Ga0268265_11041970 3300028380 Bacteria 810
169 Ga0268264_10059707 3300028381 Bacteria 3196
170 Ga0268264_11371678 3300028381 Bacteria 717
171 Ga0265337_1000308 3300028556 Bacteria 25957
172 Ga0265326_10000901 3300028558 Bacteria 10783
173 Ga0265319_1000131 3300028563 Bacteria 55815
174 Ga0265319_1000836 3300028563 Bacteria 19628
175 Ga0265334_10001305 3300028573 Bacteria 12041
176 Ga0265334_10020277 3300028573 Bacteria 2724
177 Ga0265318_10002816 3300028577 Bacteria 9087
178 Ga0265318_10038796 3300028577 Bacteria 1819
179 Ga0265323_10006997 3300028653 Bacteria 4714
180 Ga0265323_10009397 3300028653 Bacteria 3998
181 Ga0265323_10020149 3300028653 Bacteria 2571
182 Ga0265322_10003090 3300028654 Bacteria 5068
183 Ga0265322_10005589 3300028654 Bacteria 3717
184 Ga0265322_10120914 3300028654 Bacteria 746
185 Ga0265336_10000253 3300028666 Bacteria 37997
186 Ga0265338_10000618 3300028800 Bacteria 62009
187 Ga0265338_10010288 3300028800 Bacteria 11000
188 Ga0265324_10002355 3300029957 Bacteria 9754
189 Ga0265324_10005993 3300029957 Bacteria 5148
190 Ga0265324_10044386 3300029957 Bacteria 1532
191 Ga0265330_10012346 3300031235 Bacteria 3996
192 Ga0265332_10000457 3300031238 Bacteria 28508
193 Ga0265332_10172299 3300031238 Bacteria 903
194 Ga0265328_10000837 3300031239 Bacteria 14264
195 Ga0265328_10015960 3300031239 Bacteria 2932
196 Ga0265320_10000453 3300031240 Bacteria 32182
197 Ga0265320_10002020 3300031240 Bacteria 14322
198 Ga0265320_10026884 3300031240 Bacteria 3006
199 Ga0265325_10012849 3300031241 Bacteria 4777
200 Ga0265329_10002390 3300031242 Bacteria 8519
201 Ga0265329_10063007 3300031242 Bacteria 1173
202 Ga0265340_10000898 3300031247 Bacteria 16865
203 Ga0265340_10002522 3300031247 Bacteria 10398
204 Ga0265340_10006137 3300031247 Bacteria 6626
205 Ga0265339_10002163 3300031249 Bacteria 14277
206 Ga0265339_10013554 3300031249 Bacteria 4937
207 Ga0265331_10002271 3300031250 Bacteria 13131
208 Ga0265331_10049664 3300031250 Bacteria 2014
209 Ga0265327_10052707 3300031251 Bacteria 2117
210 Ga0265316_10000055 3300031344 Bacteria 122834
211 Ga0265316_10000905 3300031344 Bacteria 32395
212 Ga0265316_10003134 3300031344 Bacteria 16835
213 Ga0265316_10004265 3300031344 Bacteria 14281
214 Ga0307509_10163267 3300031507 Bacteria 2121
215 Ga0265313_10003299 3300031595 Bacteria 13215
216 Ga0316575_10001700 3300031665 Bacteria 7208
217 Ga0316575_10003567 3300031665 Bacteria 5382
218 Ga0316575_10014761 3300031665 Unclassified 2938
219 Ga0316575_10178313 3300031665 Bacteria 882
220 Ga0316579_10000943 3300031691 Bacteria 10140
221 Ga0316579_10001771 3300031691 Bacteria 7943
222 Ga0316579_10002292 3300031691 Bacteria 7220
223 Ga0316579_10009321 3300031691 Bacteria 4124
224 Ga0316579_10026550 3300031691 Unclassified 2624
225 Ga0316579_10035586 3300031691 Bacteria 2296
226 Ga0316579_10124577 3300031691 Bacteria 1239
227 Ga0316579_10174110 3300031691 Bacteria 1040
228 Ga0265314_10006535 3300031711 Bacteria 10288
229 Ga0265314_10116382 3300031711 Bacteria 1690
230 Ga0265342_10001618 3300031712 Bacteria 20784
231 Ga0265342_10011735 3300031712 Bacteria 5977
232 Ga0316576_10067359 3300031727 Bacteria 2636
233 Ga0316576_10083816 3300031727 Bacteria 2369
234 Ga0316576_10084424 3300031727 Bacteria 2360
235 Ga0316576_10091778 3300031727 Bacteria 2263
236 Ga0316576_10252627 3300031727 Bacteria 1323
237 Ga0316576_10278160 3300031727 Unclassified 1254
238 Ga0316578_10000448 3300031728 Bacteria 13673
239 Ga0316578_10013570 3300031728 Bacteria 4325
240 Ga0316578_10020923 3300031728 Bacteria 3624
241 Ga0316578_10023141 3300031728 Bacteria 3475
242 Ga0316578_10060761 3300031728 Bacteria 2225
243 Ga0316578_10132334 3300031728 Bacteria 1501
244 Ga0316578_10512290 3300031728 Unclassified 706
245 Ga0316577_10000254 3300031733 Bacteria 18853
246 Ga0316577_10000303 3300031733 Bacteria 17922
247 Ga0316577_10000701 3300031733 Bacteria 14192
248 Ga0316577_10001616 3300031733 Bacteria 10751
249 Ga0316577_10003284 3300031733 Bacteria 8152
250 Ga0316577_10003516 3300031733 Bacteria 7924
251 Ga0316577_10004020 3300031733 Bacteria 7530
252 Ga0316577_10008670 3300031733 Bacteria 5454
253 Ga0316577_10022462 3300031733 Bacteria 3503
254 Ga0316577_10036158 3300031733 Unclassified 2761
255 Ga0316577_10132365 3300031733 Bacteria 1403
256 Ga0316583_10000810 3300032133 Bacteria 9886
257 Ga0316583_10009713 3300032133 Bacteria 3467
258 Ga0316583_10049118 3300032133 Bacteria 1485
259 Ga0316585_10008989 3300032137 Bacteria 2903
260 Ga0316585_10043245 3300032137 Bacteria 1438
261 Ga0316580_10004176 3300032139 Bacteria 4167
262 Ga0316580_10147078 3300032139 Bacteria 723
263 Ga0316592_1000534 3300033524 Bacteria 5372
264 Ga0373961_0188748 3300035241 Bacteria 721
265 Ga0316574_0001960 3300035398 Bacteria 10098
266 Ga0316574_0008450 3300035398 Bacteria 5718
267 Ga0316574_0028308 3300035398 Bacteria 3379
268 Ga0316574_0057937 3300035398 Bacteria 2426
269 Ga0316574_0160286 3300035398 Bacteria 1449
270 Ga0316574_0193317 3300035398 Bacteria 1308
271 Ga0316574_0292853 3300035398 Unclassified 1036
272 Ga0316574_0384259 3300035398 Unclassified 885
273 Ga0373927_0054043 3300035695 Bacteria 2598
274 Ga0373947_0267732 3300035725 Bacteria 1134
275 Ga0373937_0051477 3300036401 Bacteria 3775
276 Ga0316582_0000037 3300036647 Bacteria 31129
277 Ga0316582_0000375 3300036647 Bacteria 16078
278 Ga0316582_0000402 3300036647 Bacteria 15778
279 Ga0316582_0002928 3300036647 Bacteria 8209
280 Ga0316582_0003841 3300036647 Bacteria 7468
281 Ga0316582_0006194 3300036647 Bacteria 6251
282 Ga0316582_0008238 3300036647 Bacteria 5590
283 Ga0316582_0008904 3300036647 Bacteria 5418
284 Ga0316582_0123998 3300036647 Unclassified 1731
285 Ga0316582_0134524 3300036647 Unclassified 1663
286 Ga0316582_0156932 3300036647 Bacteria 1540
287 Ga0316582_0161414 3300036647 Bacteria 1518
288 Ga0316582_0171953 3300036647 Bacteria 1471
289 Ga0316582_0182019 3300036647 Bacteria 1430
290 Ga0316582_0317375 3300036647 Unclassified 1071
291 Ga0316582_0378970 3300036647 Bacteria 974
292 Ga0316584_0000340 3300036712 Bacteria 23993
293 Ga0316584_0000543 3300036712 Bacteria 20235
294 Ga0316584_0002815 3300036712 Bacteria 11151
295 Ga0316584_0036987 3300036712 Bacteria 3623
296 Ga0316584_0052899 3300036712 Bacteria 3037
297 Ga0316584_0062635 3300036712 Bacteria 2785
298 Ga0316584_0079732 3300036712 Unclassified 2453
299 Ga0316581_0000092 3300037588 Bacteria 11766
300 Ga0451577_0174981 3300042876 Unclassified 1934
301 Ga0451577_0191306 3300042876 Bacteria 1846
302 Ga0451577_0404810 3300042876 Bacteria 1239
303 Ga0466969_0000745 3300044656 Bacteria 17612
304 Ga0466972_0000159 3300044658 Bacteria 54274
305 Ga0453683_0000288 3300044673 Bacteria 65205
306 Ga0453683_0002053 3300044673 Bacteria 16122
307 Ga0453683_0018325 3300044673 Bacteria 4495
308 Ga0453683_0076915 3300044673 Bacteria 2090
309 Ga0466966_0000186 3300044684 Bacteria 41305
310 Ga0453684_0000781 3300044712 Bacteria 109749
311 Ga0453684_0000930 3300044712 Bacteria 96857
312 Ga0453684_0018956 3300044712 Bacteria 10516
313 Ga0453684_0027477 3300044712 Bacteria 8162
314 Ga0453684_0081054 3300044712 Unclassified 4049
315 Ga0453684_0132991 3300044712 Unclassified 2983
316 Ga0453684_0155929 3300044712 Bacteria 2708
317 Ga0453684_0243819 3300044712 Unclassified 2067
318 Ga0453684_0244197 3300044712 Bacteria 2066
319 Ga0453684_0703323 3300044712 Unclassified 1098
320 Ga0453684_0786015 3300044712 Unclassified 1028
321 Ga0453684_0816458 3300044712 Bacteria 1005
322 Ga0453684_0883655 3300044712 Bacteria 958
323 Ga0453684_1047127 3300044712 Bacteria 865
324 Ga0453684_1290722 3300044712 Bacteria 762
325 Ga0466968_0071066 3300044735 Bacteria 1516
326 Ga0466968_0123320 3300044735 Bacteria 1174
327 Ga0466970_0000562 3300044765 Bacteria 18148
328 Ga0466970_0359592 3300044765 Unclassified 827
329 Ga0466959_0000025 3300045049 Bacteria 120128
330 Ga0451576_0000736 3300045051 Bacteria 65519
331 Ga0451576_0694191 3300045051 Bacteria 1069
332 Ga0495627_009731 3300046453 Unclassified 3525
333 Ga0495627_018599 3300046453 Bacteria 2340
334 Ga0495580_0686197 3300046472 Unclassified 671
335 Ga0495643_0015515 3300046522 Bacteria 4500
336 Ga0495587_0158276 3300046536 Bacteria 1290
337 Ga0495633_0000103 3300046558 Bacteria 114769
338 Ga0495672_0032596 3300047320 Bacteria 3239
339 Ga0496114_0223225 3300048917 Unclassified 1654
340 Ga0496121_0000011 3300048924 Bacteria 792193
341 Ga0501032_0119145 3300049569 Bacteria 1745
342 Ga0501034_0056816 3300049571 Bacteria 3936
343 Ga0501037_0143007 3300049573 Bacteria 1711
344 Ga0501038_0042113 3300049574 Bacteria 3978
345 Ga0501039_0059514 3300049575 Bacteria 2959
346 Ga0501043_0018628 3300049579 Bacteria 5448
347 Ga0501046_0005073 3300049580 Bacteria 11809
348 Ga0501047_0006477 3300049581 Bacteria 11017
349 Ga0501047_0040231 3300049581 Bacteria 4521
350 Ga0501048_0023308 3300049582 Bacteria 4526
351 Ga0501067_0006941 3300049583 Bacteria 6284
352 Ga0501067_0224833 3300049583 Unclassified 1045
353 Ga0501068_0026274 3300049584 Bacteria 3429
354 Ga0501068_0233217 3300049584 Bacteria 1171
355 Ga0501069_0128963 3300049585 Bacteria 1447
356 Ga0501070_0008015 3300049586 Bacteria 8945
357 Ga0501071_0328988 3300049587 Bacteria 1161
358 Ga0501073_0164908 3300049589 Bacteria 1534
359 Ga0501074_0016146 3300049590 Bacteria 5426
360 Ga0501074_0203086 3300049590 Bacteria 1412
361 Ga0501076_0200910 3300049592 Bacteria 1628
362 Ga0501080_0077291 3300049742 Bacteria 3095
363 Ga0501080_0106575 3300049742 Bacteria 2597
364 Ga0501081_0956146 3300049743 Bacteria 647
365 Ga0501083_0019944 3300049744 Unclassified 4666
366 Ga0501083_0039929 3300049744 Bacteria 3186
367 Ga0501241_000513 3300049758 Bacteria 8366
368 Ga0501035_0003473 3300049822 Bacteria 15083
369 Ga0501044_0111783 3300049823 Bacteria 2739
370 nmdc:mga0n895_145520_c1 3300050512 Bacteria 2399
371 nmdc:mga0n895_92803_c1 3300050512 Unclassified 3022
372 nmdc:mga0a205_509671_c1 3300050515 Bacteria 1060
373 Ga0500644_0000567 3300053088 Bacteria 14501
374 Ga0500583_0000017 3300053092 Bacteria 141647
375 Ga0500569_001611 3300053109 Bacteria 4283
376 Ga0500607_017620 3300053121 Bacteria 4072
377 Ga0500658_0002777 3300053134 Bacteria 6727
378 Ga0500559_0017951 3300053136 Bacteria 2991
379 Ga0500568_0018591 3300053139 Bacteria 3037
380 Ga0500577_0000506 3300053142 Bacteria 10029
381 Ga0500590_063169 3300053148 Bacteria 1857
382 Ga0500616_0003814 3300053153 Bacteria 11181
383 Ga0500616_0109268 3300053153 Bacteria 1338
384 Ga0500622_0001437 3300053156 Bacteria 19111
385 Ga0500634_0068778 3300053161 Bacteria 1859
386 Ga0500639_012641 3300053163 Bacteria 4433
387 Ga0501084_0016212 3300054114 Bacteria 6187
388 Ga0501084_0133026 3300054114 Bacteria 2094
389 Ga0501084_0326158 3300054114 Bacteria 1297
390 Ga0501082_0051299 3300060353 Bacteria 3556
391 Ga0501082_0064979 3300060353 Bacteria 3142
392 Ga0530510_0944284 3300061734 Unclassified 659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053121 Ga0500607_017620 Ga0500607_017620_2381_3001 179
2 3300003761 Ga0055535_1002349 Ga0055535_10023494 193
3 3300025242 Ga0209258_100160 Ga0209258_10016043 193
4 3300025254 Ga0209148_1000153 Ga0209148_100015383 193
5 3300036647 Ga0316582_0002928 Ga0316582_0002928_7289_7882 196
6 3300044712 Ga0453684_0883655 Ga0453684_0883655_350_943 196
7 3300009093 Ga0105240_10015004 Ga0105240_100150044 197
8 3300025913 Ga0207695_10146757 Ga0207695_101467573 197
9 iso_pu_bacteria 2818991444 2819589101 197
10 iso_pu_bacteria 2914759650 2914762052 199
11 3300013104 Ga0157370_10336821 Ga0157370_103368212 201
12 iso_pu_bacteria 2818991460 2819679931 202
13 iso_pu_bacteria 2884791551 2884794486 202
14 iso_pu_bacteria 2929177148 2929179963 202
15 iso_pu_bacteria 2929239360 2929242144 202
16 iso_pu_bacteria 2929921140 2929923700 202
17 iso_pu_bacteria 2945977869 2945982384 202
18 iso_pu_bacteria 2946013367 2946018228 202
19 iso_pu_bacteria 8003151029 8003153727 202
20 3300013307 Ga0157372_11645821 Ga0157372_116458211 203
21 iso_pu_bacteria 2818991442 2819576521 203
22 iso_pu_bacteria 2821136567 2821143257 203
23 iso_pu_bacteria 2904467357 2904470152 203
24 3300005844 Ga0068862_100715612 Ga0068862_1007156121 204
25 3300006237 Ga0097621_100488352 Ga0097621_1004883522 204
26 3300031727 Ga0316576_10278160 Ga0316576_102781601 204
27 3300044673 Ga0453683_0000288 Ga0453683_0000288_23011_23628 204
28 3300044673 Ga0453683_0002053 Ga0453683_0002053_1539_2156 204
29 3300046453 Ga0495627_009731 Ga0495627_009731_51_665 204
30 3300046453 Ga0495627_018599 Ga0495627_018599_836_1450 204
31 3300046558 Ga0495633_0000103 Ga0495633_0000103_102661_103275 204
32 3300003320 rootH2_10244250 rootH2_102442503 205
33 3300005330 Ga0070690_100201936 Ga0070690_1002019361 205
34 3300005335 Ga0070666_10015874 Ga0070666_100158745 205
35 3300005338 Ga0068868_100210447 Ga0068868_1002104472 205
36 3300005344 Ga0070661_100546407 Ga0070661_1005464071 205
37 3300005353 Ga0070669_100036318 Ga0070669_1000363183 205
38 3300005355 Ga0070671_100083116 Ga0070671_1000831161 205
39 3300005367 Ga0070667_100418329 Ga0070667_1004183292 205
40 3300005456 Ga0070678_100012467 Ga0070678_1000124672 205
41 3300005457 Ga0070662_100149881 Ga0070662_1001498812 205
42 3300005471 Ga0070698_100592096 Ga0070698_1005920961 205
43 3300005535 Ga0070684_100213272 Ga0070684_1002132722 205
44 3300005539 Ga0068853_100596544 Ga0068853_1005965442 205
45 3300005615 Ga0070702_100168041 Ga0070702_1001680411 205
46 3300005616 Ga0068852_100263789 Ga0068852_1002637891 205
47 3300005617 Ga0068859_100011386 Ga0068859_1000113863 205
48 3300005618 Ga0068864_100318323 Ga0068864_1003183232 205
49 3300005718 Ga0068866_10253229 Ga0068866_102532291 205
50 3300005719 Ga0068861_100328742 Ga0068861_1003287422 205
51 3300005840 Ga0068870_10125252 Ga0068870_101252522 205
52 3300005841 Ga0068863_100180800 Ga0068863_1001808004 205
53 3300005841 Ga0068863_100518570 Ga0068863_1005185702 205
54 3300005842 Ga0068858_100316179 Ga0068858_1003161792 205
55 3300005843 Ga0068860_100001417 Ga0068860_10000141728 205
56 3300005843 Ga0068860_100114235 Ga0068860_1001142354 205
57 3300005844 Ga0068862_100138054 Ga0068862_1001380543 205
58 3300006237 Ga0097621_100081065 Ga0097621_1000810652 205
59 3300006358 Ga0068871_100083261 Ga0068871_1000832612 205
60 3300006852 Ga0075433_10065601 Ga0075433_100656012 205
61 3300006852 Ga0075433_10764069 Ga0075433_107640691 205
62 3300006871 Ga0075434_100123707 Ga0075434_1001237072 205
63 3300006881 Ga0068865_101009579 Ga0068865_1010095791 205
64 3300006931 Ga0097620_100011386 Ga0097620_1000113863 205
65 3300009101 Ga0105247_10428403 Ga0105247_104284031 205
66 3300009553 Ga0105249_10020007 Ga0105249_100200076 205
67 3300009553 Ga0105249_10065299 Ga0105249_100652992 205
68 3300009553 Ga0105249_10123377 Ga0105249_101233773 205
69 3300010375 Ga0105239_10002966 Ga0105239_100029665 205
70 3300011119 Ga0105246_10270011 Ga0105246_102700112 205
71 3300013296 Ga0157374_10079420 Ga0157374_100794202 205
72 3300013296 Ga0157374_10578376 Ga0157374_105783761 205
73 3300013306 Ga0163162_10001381 Ga0163162_1000138116 205
74 3300013306 Ga0163162_10242169 Ga0163162_102421692 205
75 3300013308 Ga0157375_10025841 Ga0157375_100258412 205
76 3300014325 Ga0163163_10072214 Ga0163163_100722144 205
77 3300014968 Ga0157379_10287957 Ga0157379_102879572 205
78 3300014968 Ga0157379_10338274 Ga0157379_103382741 205
79 3300014969 Ga0157376_10019851 Ga0157376_100198515 205
80 3300017792 Ga0163161_10049111 Ga0163161_100491112 205
81 3300025900 Ga0207710_10221046 Ga0207710_102210461 205
82 3300025903 Ga0207680_10173606 Ga0207680_101736061 205
83 3300025908 Ga0207643_10169494 Ga0207643_101694942 205
84 3300025920 Ga0207649_10487991 Ga0207649_104879911 205
85 3300025925 Ga0207650_10563260 Ga0207650_105632601 205
86 3300025933 Ga0207706_10009705 Ga0207706_100097053 205
87 3300025944 Ga0207661_10505316 Ga0207661_105053161 205
88 3300025961 Ga0207712_10105099 Ga0207712_101050992 205
89 3300026041 Ga0207639_10444030 Ga0207639_104440302 205
90 3300026088 Ga0207641_10146307 Ga0207641_101463071 205
91 3300026089 Ga0207648_10194235 Ga0207648_101942352 205
92 3300026095 Ga0207676_10072892 Ga0207676_100728924 205
93 3300026116 Ga0207674_10080986 Ga0207674_100809863 205
94 3300026118 Ga0207675_100154744 Ga0207675_1001547442 205
95 3300026121 Ga0207683_10014974 Ga0207683_100149743 205
96 3300026142 Ga0207698_10433321 Ga0207698_104333212 205
97 3300026142 Ga0207698_10656983 Ga0207698_106569831 205
98 3300028381 Ga0268264_10059707 Ga0268264_100597075 205
99 3300028381 Ga0268264_11371678 Ga0268264_113716781 205
100 3300031665 Ga0316575_10001700 Ga0316575_100017003 205
101 3300031691 Ga0316579_10002292 Ga0316579_100022924 205
102 3300031728 Ga0316578_10512290 Ga0316578_105122901 205
103 3300031733 Ga0316577_10000701 Ga0316577_1000070115 205
104 3300031733 Ga0316577_10132365 Ga0316577_101323652 205
105 3300032133 Ga0316583_10009713 Ga0316583_100097132 205
106 3300032137 Ga0316585_10043245 Ga0316585_100432452 205
107 3300035398 Ga0316574_0292853 Ga0316574_0292853_179_811 205
108 3300036647 Ga0316582_0000037 Ga0316582_0000037_6079_6696 205
109 3300036647 Ga0316582_0134524 Ga0316582_0134524_421_1038 205
110 3300036647 Ga0316582_0182019 Ga0316582_0182019_619_1242 205
111 3300036712 Ga0316584_0036987 Ga0316584_0036987_478_1095 205
112 3300042876 Ga0451577_0191306 Ga0451577_0191306_735_1352 205
113 3300044712 Ga0453684_0018956 Ga0453684_0018956_5197_5814 205
114 3300044712 Ga0453684_0081054 Ga0453684_0081054_3082_3699 205
115 3300044712 Ga0453684_0244197 Ga0453684_0244197_916_1536 205
116 3300044712 Ga0453684_0703323 Ga0453684_0703323_59_679 205
117 3300044712 Ga0453684_0816458 Ga0453684_0816458_114_761 205
118 3300044712 Ga0453684_1290722 Ga0453684_1290722_71_718 205
119 3300046472 Ga0495580_0686197 Ga0495580_0686197_43_660 205
120 3300046522 Ga0495643_0015515 Ga0495643_0015515_2252_2869 205
121 3300048917 Ga0496114_0223225 Ga0496114_0223225_712_1329 205
122 3300049569 Ga0501032_0119145 Ga0501032_0119145_91_708 205
123 3300049573 Ga0501037_0143007 Ga0501037_0143007_495_1112 205
124 3300049574 Ga0501038_0042113 Ga0501038_0042113_62_679 205
125 3300049575 Ga0501039_0059514 Ga0501039_0059514_25_642 205
126 3300049579 Ga0501043_0018628 Ga0501043_0018628_3626_4243 205
127 3300049580 Ga0501046_0005073 Ga0501046_0005073_8663_9280 205
128 3300049581 Ga0501047_0040231 Ga0501047_0040231_1858_2475 205
129 3300049582 Ga0501048_0023308 Ga0501048_0023308_2773_3390 205
130 3300049583 Ga0501067_0224833 Ga0501067_0224833_171_788 205
131 3300049584 Ga0501068_0026274 Ga0501068_0026274_1262_1879 205
132 3300049586 Ga0501070_0008015 Ga0501070_0008015_3633_4250 205
133 3300049590 Ga0501074_0016146 Ga0501074_0016146_3455_4072 205
134 3300049742 Ga0501080_0077291 Ga0501080_0077291_1191_1808 205
135 3300049743 Ga0501081_0956146 Ga0501081_0956146_11_631 205
136 3300049744 Ga0501083_0019944 Ga0501083_0019944_1091_1708 205
137 3300049822 Ga0501035_0003473 Ga0501035_0003473_2621_3238 205
138 3300050512 nmdc:mga0n895_145520_c1 nmdc:mga0n895_145520_c1_1452_2072 205
139 3300050512 nmdc:mga0n895_92803_c1 nmdc:mga0n895_92803_c1_2349_2966 205
140 3300050515 nmdc:mga0a205_509671_c1 nmdc:mga0a205_509671_c1_307_927 205
141 3300053153 Ga0500616_0003814 Ga0500616_0003814_1857_2474 205
142 3300054114 Ga0501084_0133026 Ga0501084_0133026_835_1452 205
143 3300060353 Ga0501082_0051299 Ga0501082_0051299_977_1594 205
144 3300061734 Ga0530510_0944284 Ga0530510_0944284_22_642 205
145 3300001979 JGI24740J21852_10009658 JGI24740J21852_100096584 206
146 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014105 206
147 3300002987 JGI25159J45721_1016808 JGI25159J45721_10168083 206
148 3300003215 JGI25153J46596_10012293 JGI25153J46596_100122933 206
149 3300003320 rootH2_10044532 rootH2_100445324 206
150 3300003323 rootH1_10022911 rootH1_1002291115 206
151 3300003354 JGI25160J50197_1006316 JGI25160J50197_10063165 206
152 3300003354 JGI25160J50197_1019274 JGI25160J50197_10192743 206
153 3300005262 Ga0065165_1021086 Ga0065165_10210862 206
154 3300005336 Ga0070680_100001790 Ga0070680_10000179014 206
155 3300005337 Ga0070682_100001196 Ga0070682_1000011963 206
156 3300005341 Ga0070691_10102783 Ga0070691_101027832 206
157 3300005458 Ga0070681_10003107 Ga0070681_1000310714 206
158 3300005530 Ga0070679_100006573 Ga0070679_1000065739 206
159 3300005539 Ga0068853_100069869 Ga0068853_1000698693 206
160 3300005539 Ga0068853_100158724 Ga0068853_1001587242 206
161 3300005563 Ga0068855_100009610 Ga0068855_1000096106 206
162 3300005563 Ga0068855_100545995 Ga0068855_1005459952 206
163 3300005577 Ga0068857_100039909 Ga0068857_1000399092 206
164 3300005577 Ga0068857_100237386 Ga0068857_1002373863 206
165 3300005614 Ga0068856_100121651 Ga0068856_1001216513 206
166 3300005616 Ga0068852_100487936 Ga0068852_1004879362 206
167 3300006163 Ga0070715_10099626 Ga0070715_100996262 206
168 3300009093 Ga0105240_10000741 Ga0105240_100007417 206
169 3300009093 Ga0105240_10279157 Ga0105240_102791572 206
170 3300009101 Ga0105247_10003669 Ga0105247_100036695 206
171 3300009174 Ga0105241_10000232 Ga0105241_100002329 206
172 3300009174 Ga0105241_10512690 Ga0105241_105126902 206
173 3300009545 Ga0105237_10019971 Ga0105237_100199717 206
174 3300009551 Ga0105238_10485661 Ga0105238_104856612 206
175 3300013104 Ga0157370_10000989 Ga0157370_1000098934 206
176 3300013104 Ga0157370_10134602 Ga0157370_101346022 206
177 3300013104 Ga0157370_10178432 Ga0157370_101784323 206
178 3300013105 Ga0157369_10177054 Ga0157369_101770542 206
179 3300013307 Ga0157372_10764673 Ga0157372_107646732 206
180 3300025208 Ga0209436_104776 Ga0209436_1047763 206
181 3300025245 Ga0207425_1022637 Ga0207425_10226372 206
182 3300025246 Ga0209646_1000002 Ga0209646_10000021021 206
183 3300025250 Ga0209026_1001201 Ga0209026_100120115 206
184 3300025258 Ga0209129_1034708 Ga0209129_10347082 206
185 3300025284 Ga0209130_1002792 Ga0209130_10027924 206
186 3300025297 Ga0209758_1009863 Ga0209758_10098632 206
187 3300025302 Ga0207426_1000322 Ga0207426_100032210 206
188 3300025302 Ga0207426_1001341 Ga0207426_10013414 206
189 3300025900 Ga0207710_10009133 Ga0207710_100091332 206
190 3300025911 Ga0207654_10000387 Ga0207654_100003879 206
191 3300025911 Ga0207654_10499980 Ga0207654_104999801 206
192 3300025912 Ga0207707_10000247 Ga0207707_1000024757 206
193 3300025913 Ga0207695_10298022 Ga0207695_102980222 206
194 3300025913 Ga0207695_10492567 Ga0207695_104925672 206
195 3300025914 Ga0207671_10108993 Ga0207671_101089932 206
196 3300025917 Ga0207660_10001032 Ga0207660_1000103220 206
197 3300025921 Ga0207652_10001102 Ga0207652_1000110222 206
198 3300025949 Ga0207667_10009142 Ga0207667_100091426 206
199 3300025949 Ga0207667_10062499 Ga0207667_100624992 206
200 3300025981 Ga0207640_10189588 Ga0207640_101895881 206
201 3300026041 Ga0207639_10015070 Ga0207639_100150705 206
202 3300026041 Ga0207639_10104654 Ga0207639_101046541 206
203 3300026041 Ga0207639_10516390 Ga0207639_105163901 206
204 3300026078 Ga0207702_10015867 Ga0207702_100158672 206
205 3300026116 Ga0207674_10031888 Ga0207674_100318883 206
206 3300026116 Ga0207674_10125497 Ga0207674_101254972 206
207 3300031344 Ga0265316_10000905 Ga0265316_100009054 206
208 3300031507 Ga0307509_10163267 Ga0307509_101632672 206
209 3300031665 Ga0316575_10003567 Ga0316575_100035676 206
210 3300031665 Ga0316575_10014761 Ga0316575_100147614 206
211 3300031665 Ga0316575_10178313 Ga0316575_101783131 206
212 3300031691 Ga0316579_10000943 Ga0316579_100009432 206
213 3300031691 Ga0316579_10009321 Ga0316579_100093215 206
214 3300031691 Ga0316579_10026550 Ga0316579_100265502 206
215 3300031691 Ga0316579_10035586 Ga0316579_100355862 206
216 3300031691 Ga0316579_10174110 Ga0316579_101741101 206
217 3300031727 Ga0316576_10083816 Ga0316576_100838162 206
218 3300031727 Ga0316576_10084424 Ga0316576_100844242 206
219 3300031727 Ga0316576_10091778 Ga0316576_100917783 206
220 3300031727 Ga0316576_10252627 Ga0316576_102526272 206
221 3300031728 Ga0316578_10000448 Ga0316578_100004485 206
222 3300031728 Ga0316578_10013570 Ga0316578_100135702 206
223 3300031728 Ga0316578_10023141 Ga0316578_100231414 206
224 3300031728 Ga0316578_10060761 Ga0316578_100607612 206
225 3300031733 Ga0316577_10000254 Ga0316577_1000025412 206
226 3300031733 Ga0316577_10004020 Ga0316577_100040206 206
227 3300031733 Ga0316577_10008670 Ga0316577_100086703 206
228 3300031733 Ga0316577_10022462 Ga0316577_100224622 206
229 3300032133 Ga0316583_10000810 Ga0316583_100008102 206
230 3300032133 Ga0316583_10049118 Ga0316583_100491182 206
231 3300032137 Ga0316585_10008989 Ga0316585_100089891 206
232 3300032139 Ga0316580_10004176 Ga0316580_100041765 206
233 3300032139 Ga0316580_10147078 Ga0316580_101470781 206
234 3300033524 Ga0316592_1000534 Ga0316592_10005342 206
235 3300035398 Ga0316574_0001960 Ga0316574_0001960_526_1149 206
236 3300035398 Ga0316574_0008450 Ga0316574_0008450_2723_3346 206
237 3300035398 Ga0316574_0028308 Ga0316574_0028308_841_1461 206
238 3300035398 Ga0316574_0057937 Ga0316574_0057937_1587_2216 206
239 3300035398 Ga0316574_0160286 Ga0316574_0160286_447_1070 206
240 3300035398 Ga0316574_0384259 Ga0316574_0384259_139_759 206
241 3300035695 Ga0373927_0054043 Ga0373927_0054043_1943_2563 206
242 3300036401 Ga0373937_0051477 Ga0373937_0051477_2586_3212 206
243 3300036647 Ga0316582_0000402 Ga0316582_0000402_3360_3983 206
244 3300036647 Ga0316582_0156932 Ga0316582_0156932_10_630 206
245 3300036647 Ga0316582_0161414 Ga0316582_0161414_494_1117 206
246 3300036647 Ga0316582_0317375 Ga0316582_0317375_174_803 206
247 3300036712 Ga0316584_0000543 Ga0316584_0000543_3337_3960 206
248 3300036712 Ga0316584_0052899 Ga0316584_0052899_1932_2555 206
249 3300036712 Ga0316584_0062635 Ga0316584_0062635_582_1205 206
250 3300044656 Ga0466969_0000745 Ga0466969_0000745_6398_7018 206
251 3300044684 Ga0466966_0000186 Ga0466966_0000186_25003_25623 206
252 3300044735 Ga0466968_0123320 Ga0466968_0123320_153_773 206
253 3300044765 Ga0466970_0359592 Ga0466970_0359592_166_786 206
254 3300045049 Ga0466959_0000025 Ga0466959_0000025_79300_79920 206
255 3300046536 Ga0495587_0158276 Ga0495587_0158276_57_680 206
256 3300047320 Ga0495672_0032596 Ga0495672_0032596_402_1025 206
257 3300049571 Ga0501034_0056816 Ga0501034_0056816_739_1365 206
258 3300049583 Ga0501067_0006941 Ga0501067_0006941_3593_4219 206
259 3300049584 Ga0501068_0233217 Ga0501068_0233217_129_755 206
260 3300049585 Ga0501069_0128963 Ga0501069_0128963_284_910 206
261 3300049587 Ga0501071_0328988 Ga0501071_0328988_437_1063 206
262 3300049589 Ga0501073_0164908 Ga0501073_0164908_874_1500 206
263 3300049590 Ga0501074_0203086 Ga0501074_0203086_268_894 206
264 3300049592 Ga0501076_0200910 Ga0501076_0200910_388_1014 206
265 3300049742 Ga0501080_0106575 Ga0501080_0106575_258_884 206
266 3300049744 Ga0501083_0039929 Ga0501083_0039929_921_1547 206
267 3300049823 Ga0501044_0111783 Ga0501044_0111783_1947_2573 206
268 3300053088 Ga0500644_0000567 Ga0500644_0000567_4185_4838 206
269 3300053092 Ga0500583_0000017 Ga0500583_0000017_48203_48823 206
270 3300053109 Ga0500569_001611 Ga0500569_001611_134_754 206
271 3300053134 Ga0500658_0002777 Ga0500658_0002777_1911_2531 206
272 3300053136 Ga0500559_0017951 Ga0500559_0017951_495_1148 206
273 3300053139 Ga0500568_0018591 Ga0500568_0018591_1283_1903 206
274 3300053142 Ga0500577_0000506 Ga0500577_0000506_746_1366 206
275 3300053148 Ga0500590_063169 Ga0500590_063169_914_1567 206
276 3300053153 Ga0500616_0109268 Ga0500616_0109268_469_1089 206
277 3300053161 Ga0500634_0068778 Ga0500634_0068778_834_1487 206
278 3300053163 Ga0500639_012641 Ga0500639_012641_3763_4383 206
279 3300054114 Ga0501084_0016212 Ga0501084_0016212_1095_1721 206
280 3300060353 Ga0501082_0064979 Ga0501082_0064979_496_1122 206
281 2162886007 SwRhRL2b_contig_2331142 SwRhRL2b_0921.00000020 207
282 3300001989 JGI24739J22299_10010942 JGI24739J22299_100109422 207
283 3300003215 JGI25153J46596_10028917 JGI25153J46596_100289172 207
284 3300003316 rootH1_10041388 rootH1_100413885 207
285 3300003320 rootH2_10063065 rootH2_100630652 207
286 3300003323 rootH1_10055761 rootH1_100557612 207
287 3300003323 rootH1_10086867 rootH1_100868672 207
288 3300003354 JGI25160J50197_1000469 JGI25160J50197_10004692 207
289 3300003790 Ga0055528_1001321 Ga0055528_10013214 207
290 3300003791 Ga0055530_10001156 Ga0055530_100011562 207
291 3300003794 Ga0055531_10000255 Ga0055531_1000025526 207
292 3300005262 Ga0065165_1000036 Ga0065165_1000036118 207
293 3300005289 Ga0065704_10073064 Ga0065704_100730641 207
294 3300005518 Ga0070699_100691980 Ga0070699_1006919801 207
295 3300005563 Ga0068855_100006424 Ga0068855_10000642414 207
296 3300005614 Ga0068856_100000682 Ga0068856_10000068213 207
297 3300005844 Ga0068862_100635519 Ga0068862_1006355192 207
298 3300009148 Ga0105243_10385573 Ga0105243_103855731 207
299 3300009148 Ga0105243_11322897 Ga0105243_113228971 207
300 3300009553 Ga0105249_11221663 Ga0105249_112216631 207
301 3300013102 Ga0157371_10002786 Ga0157371_1000278612 207
302 3300013102 Ga0157371_10038479 Ga0157371_100384792 207
303 3300013104 Ga0157370_10011361 Ga0157370_100113613 207
304 3300015265 Ga0182005_1000115 Ga0182005_100011551 207
305 3300025273 Ga0209673_1000483 Ga0209673_100048321 207
306 3300025297 Ga0209758_1004413 Ga0209758_10044138 207
307 3300025298 Ga0209050_1000160 Ga0209050_1000160109 207
308 3300025302 Ga0207426_1003689 Ga0207426_10036893 207
309 3300025304 Ga0209257_1000071 Ga0209257_100007126 207
310 3300026078 Ga0207702_10000681 Ga0207702_1000068113 207
311 3300028380 Ga0268265_11041970 Ga0268265_110419701 207
312 3300028556 Ga0265337_1000308 Ga0265337_100030814 207
313 3300028558 Ga0265326_10000901 Ga0265326_100009016 207
314 3300028563 Ga0265319_1000131 Ga0265319_100013146 207
315 3300028563 Ga0265319_1000836 Ga0265319_10008364 207
316 3300028573 Ga0265334_10001305 Ga0265334_100013055 207
317 3300028573 Ga0265334_10020277 Ga0265334_100202772 207
318 3300028577 Ga0265318_10002816 Ga0265318_100028164 207
319 3300028577 Ga0265318_10038796 Ga0265318_100387962 207
320 3300028653 Ga0265323_10006997 Ga0265323_100069973 207
321 3300028653 Ga0265323_10009397 Ga0265323_100093972 207
322 3300028653 Ga0265323_10020149 Ga0265323_100201492 207
323 3300028654 Ga0265322_10003090 Ga0265322_100030902 207
324 3300028654 Ga0265322_10005589 Ga0265322_100055892 207
325 3300028654 Ga0265322_10120914 Ga0265322_101209141 207
326 3300028666 Ga0265336_10000253 Ga0265336_1000025319 207
327 3300028800 Ga0265338_10000618 Ga0265338_1000061844 207
328 3300028800 Ga0265338_10010288 Ga0265338_100102886 207
329 3300029957 Ga0265324_10002355 Ga0265324_100023555 207
330 3300029957 Ga0265324_10005993 Ga0265324_100059932 207
331 3300029957 Ga0265324_10044386 Ga0265324_100443862 207
332 3300031235 Ga0265330_10012346 Ga0265330_100123464 207
333 3300031238 Ga0265332_10000457 Ga0265332_100004577 207
334 3300031238 Ga0265332_10172299 Ga0265332_101722992 207
335 3300031239 Ga0265328_10000837 Ga0265328_1000083710 207
336 3300031239 Ga0265328_10015960 Ga0265328_100159602 207
337 3300031240 Ga0265320_10000453 Ga0265320_100004537 207
338 3300031240 Ga0265320_10002020 Ga0265320_1000202011 207
339 3300031240 Ga0265320_10026884 Ga0265320_100268842 207
340 3300031241 Ga0265325_10012849 Ga0265325_100128492 207
341 3300031242 Ga0265329_10002390 Ga0265329_100023907 207
342 3300031242 Ga0265329_10063007 Ga0265329_100630072 207
343 3300031247 Ga0265340_10000898 Ga0265340_1000089813 207
344 3300031247 Ga0265340_10002522 Ga0265340_100025229 207
345 3300031247 Ga0265340_10006137 Ga0265340_100061374 207
346 3300031249 Ga0265339_10002163 Ga0265339_100021632 207
347 3300031249 Ga0265339_10013554 Ga0265339_100135543 207
348 3300031250 Ga0265331_10002271 Ga0265331_1000227113 207
349 3300031250 Ga0265331_10049664 Ga0265331_100496642 207
350 3300031251 Ga0265327_10052707 Ga0265327_100527072 207
351 3300031344 Ga0265316_10000055 Ga0265316_10000055102 207
352 3300031344 Ga0265316_10003134 Ga0265316_100031347 207
353 3300031344 Ga0265316_10004265 Ga0265316_1000426510 207
354 3300031595 Ga0265313_10003299 Ga0265313_100032997 207
355 3300031691 Ga0316579_10001771 Ga0316579_100017715 207
356 3300031691 Ga0316579_10124577 Ga0316579_101245772 207
357 3300031711 Ga0265314_10006535 Ga0265314_100065354 207
358 3300031711 Ga0265314_10116382 Ga0265314_101163822 207
359 3300031712 Ga0265342_10001618 Ga0265342_100016185 207
360 3300031712 Ga0265342_10011735 Ga0265342_100117352 207
361 3300031727 Ga0316576_10067359 Ga0316576_100673593 207
362 3300031728 Ga0316578_10020923 Ga0316578_100209234 207
363 3300031728 Ga0316578_10132334 Ga0316578_101323342 207
364 3300031733 Ga0316577_10000303 Ga0316577_1000030314 207
365 3300031733 Ga0316577_10001616 Ga0316577_100016164 207
366 3300031733 Ga0316577_10003284 Ga0316577_100032846 207
367 3300031733 Ga0316577_10003516 Ga0316577_100035168 207
368 3300031733 Ga0316577_10036158 Ga0316577_100361583 207
369 3300035241 Ga0373961_0188748 Ga0373961_0188748_35_706 207
370 3300035398 Ga0316574_0193317 Ga0316574_0193317_235_861 207
371 3300035725 Ga0373947_0267732 Ga0373947_0267732_280_942 207
372 3300036647 Ga0316582_0000375 Ga0316582_0000375_7122_7775 207
373 3300036647 Ga0316582_0003841 Ga0316582_0003841_1890_2516 207
374 3300036647 Ga0316582_0006194 Ga0316582_0006194_231_857 207
375 3300036647 Ga0316582_0008238 Ga0316582_0008238_1271_1897 207
376 3300036647 Ga0316582_0008904 Ga0316582_0008904_4154_4780 207
377 3300036647 Ga0316582_0123998 Ga0316582_0123998_401_1069 207
378 3300036647 Ga0316582_0171953 Ga0316582_0171953_177_824 207
379 3300036647 Ga0316582_0378970 Ga0316582_0378970_99_782 207
380 3300036712 Ga0316584_0000340 Ga0316584_0000340_19180_19806 207
381 3300036712 Ga0316584_0002815 Ga0316584_0002815_8837_9463 207
382 3300036712 Ga0316584_0079732 Ga0316584_0079732_402_1028 207
383 3300037588 Ga0316581_0000092 Ga0316581_0000092_675_1301 207
384 3300042876 Ga0451577_0174981 Ga0451577_0174981_758_1399 207
385 3300042876 Ga0451577_0404810 Ga0451577_0404810_26_685 207
386 3300044658 Ga0466972_0000159 Ga0466972_0000159_35820_36449 207
387 3300044673 Ga0453683_0018325 Ga0453683_0018325_2681_3319 207
388 3300044673 Ga0453683_0076915 Ga0453683_0076915_895_1521 207
389 3300044712 Ga0453684_0000781 Ga0453684_0000781_55483_56109 207
390 3300044712 Ga0453684_0000930 Ga0453684_0000930_27459_28103 207
391 3300044712 Ga0453684_0027477 Ga0453684_0027477_6654_7277 207
392 3300044712 Ga0453684_0132991 Ga0453684_0132991_206_832 207
393 3300044712 Ga0453684_0155929 Ga0453684_0155929_391_1035 207
394 3300044712 Ga0453684_0243819 Ga0453684_0243819_674_1315 207
395 3300044712 Ga0453684_0786015 Ga0453684_0786015_277_936 207
396 3300044712 Ga0453684_1047127 Ga0453684_1047127_54_680 207
397 3300044735 Ga0466968_0071066 Ga0466968_0071066_73_702 207
398 3300044765 Ga0466970_0000562 Ga0466970_0000562_12927_13556 207
399 3300045051 Ga0451576_0000736 Ga0451576_0000736_14473_15099 207
400 3300045051 Ga0451576_0694191 Ga0451576_0694191_22_681 207
401 3300048924 Ga0496121_0000011 Ga0496121_0000011_585155_585784 207
402 3300049581 Ga0501047_0006477 Ga0501047_0006477_5654_6286 207
403 3300049758 Ga0501241_000513 Ga0501241_000513_3512_4135 207
404 3300053156 Ga0500622_0001437 Ga0500622_0001437_3007_3630 207
405 3300054114 Ga0501084_0326158 Ga0501084_0326158_44_742 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

51

186

0.86

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

18

181

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9756 6 204
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9613 6 204
4f71-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate 0.8336 7 195
4f72-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.8319 7 195
4dfd-assembly2.cif.gz_B crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex 0.8214 5 195
ID Description Score Start End Superfamily
3cnhA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9863 22 83 1.10.150.240
3cnhA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9127 22 83 1.10.150.240
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9047 90 186 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9029 6 204 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.889 6 204 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A519TE61-F1-model_v4 HAD family phosphatase 0.9974 4 168
AF-A0A419E840-F1-model_v4 HAD family phosphatase 0.996 1 207
AF-A0A1E4FR59-F1-model_v4 Hydrolase 0.9932 7 206
AF-B3DUP2-F1-model_v4 HAD superfamily hydrolase 0.9917 1 206 GO:0016787
AF-Q1Q779-F1-model_v4 Fusion protein similar to hydrolase/phosphatase (N-terminal) and ribose-5-phosphate isomerase (C-terminal) (EC 5.3.1.6) (Ribose 5-phosphate isomerase B) 0.9916 6 207 GO:0004751
GO:0005975
GO:0016787

Feature Viewer

pLDDT pTM Quality
96.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map