F435616

General Info

Members Datasets Scaffolds Average Seq Length
404 151 808 348

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100052377|Ga0070698_1000523772
Length 400
Sequence MSLRLLYLIMIRVFGWLVLLGRSESSKEAEIMVLRHEVAVLRRQVSRPRPDWADRAVLAALARLLPGVLRAHRLVTPGTLLSWHKRLVTRRWTYPKRPGRPRTSPDIRDLVLRMARENPAWGYRRVHGELCRLGHQISEATVRRILRARRFRPAPRNVDTSWRTFLRTQADGLLACDFFHVDTIFLRRLYVLFVMEVTSRHVHILGVTAHPDGPRTAQQARNLLMDFGSRIGSFRFLIRDRDAKFTSVFDAVFASEGVTVVWIPPRTPRANCYAERWVRTARAECTDRMLIYGERHLRSILGEYVGHYNRHRPHQSLQQRPPDQDDRVSPPLDLPVQRRKVLGGVINEYYRAALVDGMNPRSDAMRLVLKRYKPTWSGWSAPRPWRRRLSPTPQRLSWSS

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 2508501039 Frankia saprophytica CN3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.5
Rhizoplane 1.49
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100052377 3300005471 Bacteria 4152
2 Ga0070658_10009062 3300005327 Bacteria 8005
3 Ga0070683_100386679 3300005329 Bacteria 1333
4 Ga0070680_100182695 3300005336 Bacteria 1767
5 Ga0070709_10000234 3300005434 Bacteria 35989
6 Ga0070714_100030311 3300005435 Bacteria 4501
7 Ga0070714_100049726 3300005435 Bacteria 3569
8 Ga0070714_100285171 3300005435 Bacteria 1535
9 Ga0070714_100356020 3300005435 Unclassified 1375
10 Ga0070714_100383333 3300005435 Bacteria 1326
11 Ga0070714_100441929 3300005435 Bacteria 1234
12 Ga0070713_100043341 3300005436 Bacteria 3678
13 Ga0070713_100112335 3300005436 Bacteria 2377
14 Ga0070713_100123965 3300005436 Bacteria 2270
15 Ga0070713_100424644 3300005436 Bacteria 1245
16 Ga0070710_10000111 3300005437 Bacteria 38298
17 Ga0070710_10054024 3300005437 Bacteria 2265
18 Ga0070711_100000718 3300005439 Bacteria 17329
19 Ga0070663_100114351 3300005455 Bacteria 2032
20 Ga0070663_100219654 3300005455 Bacteria 1491
21 Ga0070681_10003558 3300005458 Bacteria 14610
22 Ga0070706_100143949 3300005467 Bacteria 2226
23 Ga0070706_100254784 3300005467 Bacteria 1638
24 Ga0070707_100000282 3300005468 Bacteria 50053
25 Ga0070707_100035993 3300005468 Bacteria 4723
26 Ga0070698_100000508 3300005471 Bacteria 41400
27 Ga0070698_100071483 3300005471 Bacteria 3479
28 Ga0070679_100103339 3300005530 Bacteria 2835
29 Ga0070679_100298779 3300005530 Bacteria 1561
30 Ga0068855_100131209 3300005563 Bacteria 2861
31 Ga0068856_100326166 3300005614 Bacteria 1553
32 Ga0068856_100442391 3300005614 Bacteria 1320
33 Ga0068856_100445170 3300005614 Bacteria 1316
34 Ga0068864_100152338 3300005618 Bacteria 2095
35 Ga0068863_100205082 3300005841 Bacteria 1897
36 Ga0070717_10000610 3300006028 Bacteria 22955
37 Ga0070717_10002904 3300006028 Bacteria 12175
38 Ga0070717_10244901 3300006028 Bacteria 1582
39 Ga0070717_10315306 3300006028 Bacteria 1392
40 Ga0070715_10072519 3300006163 Bacteria 1542
41 Ga0070716_100000116 3300006173 Bacteria 31406
42 Ga0070716_100050479 3300006173 Bacteria 2361
43 Ga0070716_100066069 3300006173 Bacteria 2108
44 Ga0070716_100137650 3300006173 Unclassified 1553
45 Ga0068871_100094726 3300006358 Bacteria 2492
46 Ga0075434_100109738 3300006871 Bacteria 2769
47 Ga0075435_100015300 3300007076 Bacteria 5765
48 Ga0075435_100094406 3300007076 Bacteria 2472
49 Ga0099795_10026941 3300007788 Bacteria 1941
50 Ga0105245_10151754 3300009098 Bacteria 2191
51 Ga0114129_10072851 3300009147 Bacteria 4787
52 Ga0105241_10003093 3300009174 Bacteria 12398
53 Ga0105237_10204300 3300009545 Bacteria 1976
54 Ga0105238_10205014 3300009551 Bacteria 1948
55 Ga0105239_10219476 3300010375 Bacteria 2132
56 Ga0157374_10348252 3300013296 Bacteria 1472
57 Ga0157376_10123330 3300014969 Bacteria 2300
58 Ga0213875_10002921 3300021388 Bacteria 9975
59 Ga0213875_10009098 3300021388 Bacteria 5047
60 Ga0207710_10023513 3300025900 Bacteria 2649
61 Ga0207699_10000663 3300025906 Bacteria 16537
62 Ga0207705_10043694 3300025909 Bacteria 3220
63 Ga0207654_10005843 3300025911 Bacteria 6204
64 Ga0207707_10170809 3300025912 Bacteria 1900
65 Ga0207693_10030747 3300025915 Bacteria 4242
66 Ga0207693_10036388 3300025915 Bacteria 3880
67 Ga0207693_10280634 3300025915 Bacteria 1305
68 Ga0207663_10007422 3300025916 Bacteria 5683
69 Ga0207660_10224882 3300025917 Bacteria 1474
70 Ga0207652_10015522 3300025921 Bacteria 6195
71 Ga0207646_10000056 3300025922 Bacteria 158385
72 Ga0207687_10026207 3300025927 Bacteria 3902
73 Ga0207700_10004529 3300025928 Bacteria 8210
74 Ga0207700_10024053 3300025928 Bacteria 4211
75 Ga0207700_10204343 3300025928 Bacteria 1666
76 Ga0207664_10000481 3300025929 Bacteria 28363
77 Ga0207664_10014879 3300025929 Bacteria 5633
78 Ga0207664_10016334 3300025929 Bacteria 5414
79 Ga0207664_10354801 3300025929 Bacteria 1298
80 Ga0207665_10000641 3300025939 Bacteria 23585
81 Ga0207665_10092968 3300025939 Bacteria 2093
82 Ga0207665_10094807 3300025939 Bacteria 2073
83 Ga0207665_10254318 3300025939 Unclassified 1299
84 Ga0207661_10221318 3300025944 Bacteria 1673
85 Ga0207677_10096541 3300026023 Bacteria 2163
86 Ga0207678_10134979 3300026067 Bacteria 2106
87 Ga0207678_10306230 3300026067 Bacteria 1366
88 Ga0207702_10112709 3300026078 Bacteria 2421
89 Ga0207702_10326922 3300026078 Bacteria 1462
90 Ga0207676_10018684 3300026095 Bacteria 5045
91 Ga0207683_10205252 3300026121 Bacteria 1792
92 Ga0207698_10206958 3300026142 Bacteria 1762
93 Ga0307405_10118599 3300031731 Bacteria 1806
94 Ga0307410_10238644 3300031852 Bacteria 1407
95 Ga0307406_10095042 3300031901 Bacteria 2016
96 Ga0307407_10241565 3300031903 Bacteria 1232
97 Ga0307412_10050292 3300031911 Bacteria 2750
98 Ga0307409_100297155 3300031995 Bacteria 1500
99 Ga0307416_100051215 3300032002 Bacteria 3296
100 Ga0307414_10198986 3300032004 Bacteria 1628
101 Ga0307411_10297797 3300032005 Bacteria 1292
102 Ga0307415_100083982 3300032126 Bacteria 2283
103 Ga0373926_0000945 3300035083 Bacteria 8407
104 Ga0373926_0004089 3300035083 Bacteria 4766
105 Ga0373934_0000536 3300035086 Bacteria 13407
106 Ga0373934_0001218 3300035086 Bacteria 9338
107 Ga0373934_0038976 3300035086 Bacteria 1872
108 Ga0373944_0000715 3300035089 Bacteria 8031
109 Ga0373923_0000014 3300035111 Bacteria 33694
110 Ga0373923_0000624 3300035111 Bacteria 8854
111 Ga0373923_0055192 3300035111 Bacteria 1674
112 Ga0373923_0090326 3300035111 Bacteria 1339
113 Ga0373936_0000165 3300035113 Bacteria 22025
114 Ga0373936_0001378 3300035113 Bacteria 8822
115 Ga0373945_0001104 3300035116 Bacteria 8138
116 Ga0373945_0011944 3300035116 Bacteria 2878
117 Ga0373953_0065071 3300035117 Bacteria 1496
118 Ga0373954_0004988 3300035118 Bacteria 5734
119 Ga0373956_0001400 3300035119 Bacteria 9974
120 Ga0373956_0059227 3300035119 Bacteria 1732
121 Ga0373956_0065561 3300035119 Bacteria 1650
122 Ga0373956_0098447 3300035119 Bacteria 1354
123 Ga0373957_0002350 3300035120 Bacteria 5376
124 Ga0373957_0031076 3300035120 Bacteria 1960
125 Ga0373957_0051858 3300035120 Bacteria 1570
126 Ga0373943_0000363 3300035170 Bacteria 19278
127 Ga0373943_0012563 3300035170 Bacteria 3816
128 Ga0373943_0124030 3300035170 Unclassified 1375
129 Ga0373943_0153554 3300035170 Unclassified 1249
130 Ga0373946_0000122 3300035171 Bacteria 22794
131 Ga0373946_0002994 3300035171 Bacteria 5984
132 Ga0373946_0017561 3300035171 Bacteria 2739
133 Ga0373955_0000626 3300035172 Bacteria 15145
134 Ga0373955_0001567 3300035172 Bacteria 9764
135 Ga0373955_0003031 3300035172 Bacteria 7356
136 Ga0373955_0090359 3300035172 Bacteria 1744
137 Ga0373924_0001378 3300035410 Bacteria 7856
138 Ga0373924_0007129 3300035410 Bacteria 4029
139 Ga0373924_0070368 3300035410 Bacteria 1475
140 Ga0373935_0000896 3300035692 Bacteria 16108
141 Ga0373935_0002792 3300035692 Bacteria 10047
142 Ga0373935_0053461 3300035692 Bacteria 2569
143 Ga0373935_0103279 3300035692 Bacteria 1882
144 Ga0373935_0202124 3300035692 Bacteria 1373
145 Ga0373935_0232417 3300035692 Unclassified 1284
146 Ga0373927_0006177 3300035695 Bacteria 8185
147 Ga0373927_0006439 3300035695 Bacteria 8001
148 Ga0373927_0136328 3300035695 Unclassified 1604
149 Ga0373933_0003528 3300035724 Bacteria 8708
150 Ga0373933_0009359 3300035724 Bacteria 5351
151 Ga0373933_0010571 3300035724 Bacteria 5061
152 Ga0373933_0026198 3300035724 Bacteria 3347
153 Ga0373933_0029603 3300035724 Bacteria 3168
154 Ga0373933_0154115 3300035724 Bacteria 1456
155 Ga0373933_0376927 3300035724 Bacteria 924
156 Ga0373947_0000838 3300035725 Bacteria 18563
157 Ga0373947_0010925 3300035725 Bacteria 5212
158 Ga0373947_0065990 3300035725 Bacteria 2208
159 Ga0373947_0130937 3300035725 Bacteria 1601
160 Ga0373947_0135464 3300035725 Unclassified 1575
161 Ga0373937_0002453 3300036401 Bacteria 15415
162 Ga0373937_0025243 3300036401 Bacteria 5365
163 Ga0373937_0031572 3300036401 Bacteria 4801
164 Ga0373937_0057590 3300036401 Bacteria 3570
165 Ga0373937_0195409 3300036401 Bacteria 1901
166 Ga0373937_0430677 3300036401 Bacteria 1252
167 Ga0373925_0001607 3300037068 Bacteria 19080
168 Ga0373925_0012612 3300037068 Bacteria 6122
169 Ga0373925_0031627 3300037068 Bacteria 3890
170 Ga0373925_0133902 3300037068 Bacteria 1935
171 Ga0373925_0185722 3300037068 Bacteria 1648
172 Ga0373925_0187192 3300037068 Bacteria 1641
173 Ga0373925_0271025 3300037068 Unclassified 1365
174 Ga0373925_0282703 3300037068 Bacteria 1336
175 Ga0436364_0064112 3300037853 Bacteria 12863
176 Ga0436364_0425504 3300037853 Bacteria 1498
177 Ga0436364_0959062 3300037853 Bacteria 29131
178 Ga0436364_1444373 3300037853 Unclassified 2338
179 Ga0439448_0062179 3300042005 Bacteria 1235
180 Ga0466967_0011347 3300045976 Bacteria 6742
181 Ga0495592_0000894 3300046454 Bacteria 20667
182 Ga0495592_0002257 3300046454 Bacteria 13596
183 Ga0495592_0007947 3300046454 Bacteria 7956
184 Ga0495592_0116669 3300046454 Bacteria 1883
185 Ga0495603_0000228 3300046455 Bacteria 29372
186 Ga0495629_0000640 3300046459 Bacteria 28323
187 Ga0495629_0005361 3300046459 Bacteria 9574
188 Ga0495629_0019984 3300046459 Bacteria 4779
189 Ga0495629_0212685 3300046459 Bacteria 1335
190 Ga0495629_0217291 3300046459 Bacteria 1319
191 Ga0495641_0000117 3300046461 Bacteria 56759
192 Ga0495641_0005836 3300046461 Bacteria 8156
193 Ga0495641_0052491 3300046461 Bacteria 1858
194 Ga0495651_0001964 3300046462 Bacteria 15909
195 Ga0495651_0007640 3300046462 Bacteria 8263
196 Ga0495651_0017100 3300046462 Bacteria 5620
197 Ga0495651_0057118 3300046462 Bacteria 2996
198 Ga0495651_0094984 3300046462 Bacteria 2230
199 Ga0495651_0188627 3300046462 Bacteria 1453
200 Ga0495653_0002731 3300046463 Bacteria 14063
201 Ga0495653_0005074 3300046463 Bacteria 10686
202 Ga0495653_0005452 3300046463 Bacteria 10366
203 Ga0495653_0071686 3300046463 Bacteria 2589
204 Ga0495653_0101048 3300046463 Unclassified 2090
205 Ga0495653_0110284 3300046463 Bacteria 1978
206 Ga0495580_0030115 3300046472 Bacteria 3932
207 Ga0495580_0093676 3300046472 Bacteria 2090
208 Ga0495580_0209527 3300046472 Unclassified 1341
209 Ga0495582_0000091 3300046473 Bacteria 46826
210 Ga0495582_0005287 3300046473 Bacteria 7214
211 Ga0495639_0001025 3300046475 Bacteria 12620
212 Ga0495639_0003614 3300046475 Bacteria 6673
213 Ga0495662_0000119 3300046476 Bacteria 29427
214 Ga0495662_0001202 3300046476 Bacteria 12780
215 Ga0495662_0046635 3300046476 Bacteria 2093
216 Ga0495662_0057443 3300046476 Bacteria 1879
217 Ga0495662_0127122 3300046476 Bacteria 1252
218 Ga0495664_0000097 3300046477 Bacteria 43107
219 Ga0495664_0010470 3300046477 Bacteria 5205
220 Ga0495664_0014423 3300046477 Bacteria 4480
221 Ga0495664_0085238 3300046477 Unclassified 1897
222 Ga0495664_0098740 3300046477 Bacteria 1758
223 Ga0495594_0006413 3300046499 Bacteria 6050
224 Ga0495594_0090005 3300046499 Bacteria 1719
225 Ga0495608_0000814 3300046511 Bacteria 21801
226 Ga0495608_0008728 3300046511 Bacteria 7091
227 Ga0495608_0015111 3300046511 Bacteria 5356
228 Ga0495608_0023787 3300046511 Bacteria 4193
229 Ga0495608_0072635 3300046511 Bacteria 2244
230 Ga0495608_0075835 3300046511 Bacteria 2191
231 Ga0495618_0000244 3300046514 Bacteria 39553
232 Ga0495618_0002225 3300046514 Bacteria 12632
233 Ga0495618_0016851 3300046514 Bacteria 4476
234 Ga0495618_0069177 3300046514 Bacteria 2244
235 Ga0495628_0001237 3300046516 Bacteria 23387
236 Ga0495628_0009892 3300046516 Bacteria 8119
237 Ga0495628_0052420 3300046516 Bacteria 3222
238 Ga0495628_0071483 3300046516 Bacteria 2704
239 Ga0495628_0100487 3300046516 Unclassified 2233
240 Ga0495628_0104806 3300046516 Bacteria 2179
241 Ga0495628_0133972 3300046516 Bacteria 1894
242 Ga0495630_0002444 3300046517 Bacteria 12853
243 Ga0495630_0006340 3300046517 Bacteria 8406
244 Ga0495630_0146739 3300046517 Bacteria 1794
245 Ga0495630_0230640 3300046517 Bacteria 1414
246 Ga0495666_0000683 3300046526 Bacteria 15400
247 Ga0495652_0001943 3300046529 Bacteria 21964
248 Ga0495652_0025696 3300046529 Bacteria 5205
249 Ga0495652_0092519 3300046529 Bacteria 2470
250 Ga0495652_0161586 3300046529 Bacteria 1738
251 Ga0495652_0300699 3300046529 Bacteria 1166
252 Ga0495665_0000110 3300046531 Bacteria 38824
253 Ga0495665_0003252 3300046531 Bacteria 8793
254 Ga0495665_0025858 3300046531 Bacteria 3152
255 Ga0495665_0029515 3300046531 Bacteria 2938
256 Ga0495640_0000956 3300046533 Bacteria 22329
257 Ga0495640_0004601 3300046533 Bacteria 11006
258 Ga0495640_0041970 3300046533 Bacteria 3194
259 Ga0495640_0097985 3300046533 Bacteria 1927
260 Ga0495640_0175588 3300046533 Bacteria 1367
261 Ga0495640_0238730 3300046533 Unclassified 1141
262 Ga0495586_0004157 3300046535 Bacteria 7758
263 Ga0495586_0007079 3300046535 Bacteria 5979
264 Ga0495587_0001293 3300046536 Bacteria 16623
265 Ga0495587_0004842 3300046536 Bacteria 8833
266 Ga0495587_0012575 3300046536 Bacteria 5323
267 Ga0495587_0016445 3300046536 Bacteria 4601
268 Ga0495587_0019502 3300046536 Bacteria 4195
269 Ga0495587_0080665 3300046536 Bacteria 1885
270 Ga0495645_0000692 3300046543 Bacteria 23167
271 Ga0495645_0023763 3300046543 Bacteria 4442
272 Ga0495645_0025411 3300046543 Bacteria 4297
273 Ga0495645_0031870 3300046543 Bacteria 3843
274 Ga0495645_0208662 3300046543 Bacteria 1320
275 Ga0495645_0231546 3300046543 Unclassified 1237
276 Ga0495622_0122169 3300046557 Bacteria 1189
277 Ga0495667_0000331 3300046559 Bacteria 29909
278 Ga0495667_0002011 3300046559 Bacteria 13460
279 Ga0495667_0014273 3300046559 Bacteria 5365
280 Ga0495667_0042957 3300046559 Bacteria 2996
281 Ga0495667_0064318 3300046559 Bacteria 2399
282 Ga0495634_0000184 3300046642 Bacteria 57996
283 Ga0495634_0037912 3300046642 Bacteria 3290
284 Ga0495634_0057381 3300046642 Bacteria 2599
285 Ga0495634_0085717 3300046642 Bacteria 2052
286 Ga0495634_0106646 3300046642 Bacteria 1805
287 Ga0495635_0005567 3300046663 Bacteria 8766
288 Ga0495635_0014435 3300046663 Bacteria 5525
289 Ga0495635_0054310 3300046663 Bacteria 2759
290 Ga0495635_0108282 3300046663 Bacteria 1898
291 Ga0495635_0116619 3300046663 Bacteria 1822
292 Ga0495635_0175572 3300046663 Unclassified 1456
293 Ga0495635_0262745 3300046663 Bacteria 1162
294 Ga0495588_0003876 3300046674 Bacteria 6553
295 Ga0495657_0000457 3300046675 Bacteria 38156
296 Ga0495657_0014580 3300046675 Bacteria 5767
297 Ga0495657_0070971 3300046675 Bacteria 2275
298 Ga0495657_0084218 3300046675 Bacteria 2051
299 Ga0495599_0000166 3300046678 Bacteria 43534
300 Ga0495599_0004694 3300046678 Bacteria 8108
301 Ga0495599_0009473 3300046678 Bacteria 5953
302 Ga0495599_0021468 3300046678 Bacteria 4029
303 Ga0495599_0053569 3300046678 Bacteria 2527
304 Ga0495599_0142832 3300046678 Bacteria 1484
305 Ga0495623_0015031 3300046679 Bacteria 5003
306 Ga0495623_0019577 3300046679 Bacteria 4374
307 Ga0495623_0086575 3300046679 Bacteria 1931
308 Ga0495646_0000373 3300046680 Bacteria 23296
309 Ga0495646_0006662 3300046680 Bacteria 7323
310 Ga0495646_0089445 3300046680 Bacteria 1781
311 Ga0495647_0040173 3300046681 Bacteria 1777
312 Ga0495647_0110164 3300046681 Bacteria 1148
313 Ga0495658_0002246 3300046683 Bacteria 9767
314 Ga0495658_0003084 3300046683 Bacteria 8335
315 Ga0495658_0049802 3300046683 Bacteria 2367
316 Ga0495613_0000930 3300046689 Bacteria 22456
317 Ga0495613_0005293 3300046689 Bacteria 9693
318 Ga0495613_0040484 3300046689 Bacteria 3452
319 Ga0495613_0136842 3300046689 Bacteria 1752
320 Ga0495624_0000952 3300046690 Bacteria 22806
321 Ga0495624_0006101 3300046690 Bacteria 8584
322 Ga0495624_0109343 3300046690 Bacteria 1700
323 Ga0495624_0124635 3300046690 Bacteria 1581
324 Ga0495624_0190596 3300046690 Bacteria 1247
325 Ga0495600_0000064 3300046809 Bacteria 61002
326 Ga0495600_0008181 3300046809 Bacteria 6419
327 Ga0495600_0029169 3300046809 Bacteria 3571
328 Ga0495600_0065983 3300046809 Bacteria 2366
329 Ga0495600_0083522 3300046809 Bacteria 2084
330 Ga0495600_0183606 3300046809 Bacteria 1347
331 Ga0495581_0000204 3300047315 Bacteria 27748
332 Ga0495581_0003963 3300047315 Bacteria 8528
333 Ga0495581_0127154 3300047315 Bacteria 1484
334 Ga0495581_0133795 3300047315 Bacteria 1445
335 Ga0495604_0000740 3300047317 Bacteria 27419
336 Ga0495604_0005726 3300047317 Bacteria 9854
337 Ga0495604_0056300 3300047317 Bacteria 3027
338 Ga0495604_0220643 3300047317 Bacteria 1305
339 Ga0495674_0000738 3300047319 Bacteria 30914
340 Ga0495674_0000931 3300047319 Bacteria 27987
341 Ga0495674_0015529 3300047319 Bacteria 7115
342 Ga0495674_0018574 3300047319 Bacteria 6472
343 Ga0495674_0028432 3300047319 Bacteria 5096
344 Ga0495674_0051476 3300047319 Bacteria 3630
345 Ga0495674_0076047 3300047319 Bacteria 2888
346 Ga0495674_0188429 3300047319 Bacteria 1715
347 Ga0495674_0189993 3300047319 Bacteria 1707
348 Ga0495674_0203591 3300047319 Bacteria 1641
349 Ga0495676_0000713 3300047321 Bacteria 27674
350 Ga0495676_0012209 3300047321 Bacteria 7745
351 Ga0495680_0005222 3300047322 Bacteria 12259
352 Ga0495680_0021922 3300047322 Bacteria 5338
353 Ga0495680_0026329 3300047322 Bacteria 4797
354 Ga0495680_0034443 3300047322 Bacteria 4088
355 Ga0495680_0071092 3300047322 Bacteria 2651
356 Ga0495680_0103313 3300047322 Bacteria 2121
357 Ga0495675_0017046 3300047444 Bacteria 4598
358 Ga0495675_0051239 3300047444 Bacteria 2622
359 Ga0495684_0002287 3300047471 Bacteria 15333
360 Ga0495684_0005585 3300047471 Bacteria 9794
361 Ga0495684_0021068 3300047471 Bacteria 5021
362 Ga0495684_0044346 3300047471 Bacteria 3404
363 Ga0495684_0142940 3300047471 Bacteria 1793
364 Ga0495684_0226278 3300047471 Unclassified 1369
365 Ga0495593_0001488 3300047673 Bacteria 13782
366 Ga0495593_0003424 3300047673 Bacteria 9493
367 Ga0495593_0063452 3300047673 Unclassified 1929
368 Ga0495593_0073954 3300047673 Bacteria 1767
369 Ga0495602_0024642 3300048088 Bacteria 5835
370 Ga0495602_0036178 3300048088 Bacteria 4597
371 Ga0495602_0046450 3300048088 Bacteria 3922
372 Ga0495602_0053061 3300048088 Bacteria 3593
373 Ga0495602_0056509 3300048088 Bacteria 3450
374 Ga0495602_0121912 3300048088 Bacteria 2096
375 Ga0495614_0004333 3300048089 Bacteria 6396
376 Ga0495614_0041908 3300048089 Bacteria 1963
377 Ga0495614_0099030 3300048089 Bacteria 1273
378 Ga0496102_0144408 3300048905 Bacteria 2232
379 Ga0496104_0130458 3300048907 Bacteria 2414
380 Ga0496105_0138656 3300048908 Bacteria 2003
381 Ga0496108_0157808 3300048911 Bacteria 1959
382 Ga0496110_0042362 3300048913 Bacteria 3973
383 Ga0496115_0136353 3300048918 Bacteria 2024
384 nmdc:mga05p37_36516_c1 3300050507 Bacteria 6028
385 nmdc:mga0n895_13267_c1 3300050512 Bacteria 7427
386 nmdc:mga0rr50_24453_c1 3300050513 Bacteria 4183
387 nmdc:mga0a205_11236_c1 3300050515 Bacteria 8240
388 Ga0495601_0001020 3300053077 Bacteria 15308
389 Ga0495601_0002769 3300053077 Bacteria 9952
390 Ga0495601_0056489 3300053077 Bacteria 2486
391 Ga0495601_0107051 3300053077 Bacteria 1808
392 Ga0495601_0206844 3300053077 Unclassified 1282
393 Ga0495612_0000248 3300053078 Bacteria 22309
394 Ga0495612_0014904 3300053078 Bacteria 3118
395 Ga0495595_0013942 3300053084 Bacteria 3403
396 Ga0495595_0033184 3300053084 Bacteria 2328
397 Ga0495619_0003371 3300053085 Bacteria 10332
398 Ga0495619_0005243 3300053085 Bacteria 8214
399 Ga0495619_0146838 3300053085 Bacteria 1626
400 Ga0495619_0262700 3300053085 Bacteria 1196
401 Ga0495619_0373185 3300053085 Bacteria 986
402 Ga0466962_0019576 3300061719 Bacteria 3254
403 2508672978 2508501039 Bacteria 9978592
404 2508675318 2508501039 Bacteria 9978592
405 Ga0070698_100052377
406 Ga0070658_10009062
407 Ga0070683_100386679
408 Ga0070680_100182695
409 Ga0070709_10000234
410 Ga0070714_100030311
411 Ga0070714_100049726
412 Ga0070714_100285171
413 Ga0070714_100356020
414 Ga0070714_100383333
415 Ga0070714_100441929
416 Ga0070713_100043341
417 Ga0070713_100112335
418 Ga0070713_100123965
419 Ga0070713_100424644
420 Ga0070710_10000111
421 Ga0070710_10054024
422 Ga0070711_100000718
423 Ga0070663_100114351
424 Ga0070663_100219654
425 Ga0070681_10003558
426 Ga0070706_100143949
427 Ga0070706_100254784
428 Ga0070707_100000282
429 Ga0070707_100035993
430 Ga0070698_100000508
431 Ga0070698_100071483
432 Ga0070679_100103339
433 Ga0070679_100298779
434 Ga0068855_100131209
435 Ga0068856_100326166
436 Ga0068856_100442391
437 Ga0068856_100445170
438 Ga0068864_100152338
439 Ga0068863_100205082
440 Ga0070717_10000610
441 Ga0070717_10002904
442 Ga0070717_10244901
443 Ga0070717_10315306
444 Ga0070715_10072519
445 Ga0070716_100000116
446 Ga0070716_100050479
447 Ga0070716_100066069
448 Ga0070716_100137650
449 Ga0068871_100094726
450 Ga0075434_100109738
451 Ga0075435_100015300
452 Ga0075435_100094406
453 Ga0099795_10026941
454 Ga0105245_10151754
455 Ga0114129_10072851
456 Ga0105241_10003093
457 Ga0105237_10204300
458 Ga0105238_10205014
459 Ga0105239_10219476
460 Ga0157374_10348252
461 Ga0157376_10123330
462 Ga0213875_10002921
463 Ga0213875_10009098
464 Ga0207710_10023513
465 Ga0207699_10000663
466 Ga0207705_10043694
467 Ga0207654_10005843
468 Ga0207707_10170809
469 Ga0207693_10030747
470 Ga0207693_10036388
471 Ga0207693_10280634
472 Ga0207663_10007422
473 Ga0207660_10224882
474 Ga0207652_10015522
475 Ga0207646_10000056
476 Ga0207687_10026207
477 Ga0207700_10004529
478 Ga0207700_10024053
479 Ga0207700_10204343
480 Ga0207664_10000481
481 Ga0207664_10014879
482 Ga0207664_10016334
483 Ga0207664_10354801
484 Ga0207665_10000641
485 Ga0207665_10092968
486 Ga0207665_10094807
487 Ga0207665_10254318
488 Ga0207661_10221318
489 Ga0207677_10096541
490 Ga0207678_10134979
491 Ga0207678_10306230
492 Ga0207702_10112709
493 Ga0207702_10326922
494 Ga0207676_10018684
495 Ga0207683_10205252
496 Ga0207698_10206958
497 Ga0307405_10118599
498 Ga0307410_10238644
499 Ga0307406_10095042
500 Ga0307407_10241565
501 Ga0307412_10050292
502 Ga0307409_100297155
503 Ga0307416_100051215
504 Ga0307414_10198986
505 Ga0307411_10297797
506 Ga0307415_100083982
507 Ga0373926_0000945
508 Ga0373926_0004089
509 Ga0373934_0000536
510 Ga0373934_0001218
511 Ga0373934_0038976
512 Ga0373944_0000715
513 Ga0373923_0000014
514 Ga0373923_0000624
515 Ga0373923_0055192
516 Ga0373923_0090326
517 Ga0373936_0000165
518 Ga0373936_0001378
519 Ga0373945_0001104
520 Ga0373945_0011944
521 Ga0373953_0065071
522 Ga0373954_0004988
523 Ga0373956_0001400
524 Ga0373956_0059227
525 Ga0373956_0065561
526 Ga0373956_0098447
527 Ga0373957_0002350
528 Ga0373957_0031076
529 Ga0373957_0051858
530 Ga0373943_0000363
531 Ga0373943_0012563
532 Ga0373943_0124030
533 Ga0373943_0153554
534 Ga0373946_0000122
535 Ga0373946_0002994
536 Ga0373946_0017561
537 Ga0373955_0000626
538 Ga0373955_0001567
539 Ga0373955_0003031
540 Ga0373955_0090359
541 Ga0373924_0001378
542 Ga0373924_0007129
543 Ga0373924_0070368
544 Ga0373935_0000896
545 Ga0373935_0002792
546 Ga0373935_0053461
547 Ga0373935_0103279
548 Ga0373935_0202124
549 Ga0373935_0232417
550 Ga0373927_0006177
551 Ga0373927_0006439
552 Ga0373927_0136328
553 Ga0373933_0003528
554 Ga0373933_0009359
555 Ga0373933_0010571
556 Ga0373933_0026198
557 Ga0373933_0029603
558 Ga0373933_0154115
559 Ga0373933_0376927
560 Ga0373947_0000838
561 Ga0373947_0010925
562 Ga0373947_0065990
563 Ga0373947_0130937
564 Ga0373947_0135464
565 Ga0373937_0002453
566 Ga0373937_0025243
567 Ga0373937_0031572
568 Ga0373937_0057590
569 Ga0373937_0195409
570 Ga0373937_0430677
571 Ga0373925_0001607
572 Ga0373925_0012612
573 Ga0373925_0031627
574 Ga0373925_0133902
575 Ga0373925_0185722
576 Ga0373925_0187192
577 Ga0373925_0271025
578 Ga0373925_0282703
579 Ga0436364_0064112
580 Ga0436364_0425504
581 Ga0436364_0959062
582 Ga0436364_1444373
583 Ga0439448_0062179
584 Ga0466967_0011347
585 Ga0495592_0000894
586 Ga0495592_0002257
587 Ga0495592_0007947
588 Ga0495592_0116669
589 Ga0495603_0000228
590 Ga0495629_0000640
591 Ga0495629_0005361
592 Ga0495629_0019984
593 Ga0495629_0212685
594 Ga0495629_0217291
595 Ga0495641_0000117
596 Ga0495641_0005836
597 Ga0495641_0052491
598 Ga0495651_0001964
599 Ga0495651_0007640
600 Ga0495651_0017100
601 Ga0495651_0057118
602 Ga0495651_0094984
603 Ga0495651_0188627
604 Ga0495653_0002731
605 Ga0495653_0005074
606 Ga0495653_0005452
607 Ga0495653_0071686
608 Ga0495653_0101048
609 Ga0495653_0110284
610 Ga0495580_0030115
611 Ga0495580_0093676
612 Ga0495580_0209527
613 Ga0495582_0000091
614 Ga0495582_0005287
615 Ga0495639_0001025
616 Ga0495639_0003614
617 Ga0495662_0000119
618 Ga0495662_0001202
619 Ga0495662_0046635
620 Ga0495662_0057443
621 Ga0495662_0127122
622 Ga0495664_0000097
623 Ga0495664_0010470
624 Ga0495664_0014423
625 Ga0495664_0085238
626 Ga0495664_0098740
627 Ga0495594_0006413
628 Ga0495594_0090005
629 Ga0495608_0000814
630 Ga0495608_0008728
631 Ga0495608_0015111
632 Ga0495608_0023787
633 Ga0495608_0072635
634 Ga0495608_0075835
635 Ga0495618_0000244
636 Ga0495618_0002225
637 Ga0495618_0016851
638 Ga0495618_0069177
639 Ga0495628_0001237
640 Ga0495628_0009892
641 Ga0495628_0052420
642 Ga0495628_0071483
643 Ga0495628_0100487
644 Ga0495628_0104806
645 Ga0495628_0133972
646 Ga0495630_0002444
647 Ga0495630_0006340
648 Ga0495630_0146739
649 Ga0495630_0230640
650 Ga0495666_0000683
651 Ga0495652_0001943
652 Ga0495652_0025696
653 Ga0495652_0092519
654 Ga0495652_0161586
655 Ga0495652_0300699
656 Ga0495665_0000110
657 Ga0495665_0003252
658 Ga0495665_0025858
659 Ga0495665_0029515
660 Ga0495640_0000956
661 Ga0495640_0004601
662 Ga0495640_0041970
663 Ga0495640_0097985
664 Ga0495640_0175588
665 Ga0495640_0238730
666 Ga0495586_0004157
667 Ga0495586_0007079
668 Ga0495587_0001293
669 Ga0495587_0004842
670 Ga0495587_0012575
671 Ga0495587_0016445
672 Ga0495587_0019502
673 Ga0495587_0080665
674 Ga0495645_0000692
675 Ga0495645_0023763
676 Ga0495645_0025411
677 Ga0495645_0031870
678 Ga0495645_0208662
679 Ga0495645_0231546
680 Ga0495622_0122169
681 Ga0495667_0000331
682 Ga0495667_0002011
683 Ga0495667_0014273
684 Ga0495667_0042957
685 Ga0495667_0064318
686 Ga0495634_0000184
687 Ga0495634_0037912
688 Ga0495634_0057381
689 Ga0495634_0085717
690 Ga0495634_0106646
691 Ga0495635_0005567
692 Ga0495635_0014435
693 Ga0495635_0054310
694 Ga0495635_0108282
695 Ga0495635_0116619
696 Ga0495635_0175572
697 Ga0495635_0262745
698 Ga0495588_0003876
699 Ga0495657_0000457
700 Ga0495657_0014580
701 Ga0495657_0070971
702 Ga0495657_0084218
703 Ga0495599_0000166
704 Ga0495599_0004694
705 Ga0495599_0009473
706 Ga0495599_0021468
707 Ga0495599_0053569
708 Ga0495599_0142832
709 Ga0495623_0015031
710 Ga0495623_0019577
711 Ga0495623_0086575
712 Ga0495646_0000373
713 Ga0495646_0006662
714 Ga0495646_0089445
715 Ga0495647_0040173
716 Ga0495647_0110164
717 Ga0495658_0002246
718 Ga0495658_0003084
719 Ga0495658_0049802
720 Ga0495613_0000930
721 Ga0495613_0005293
722 Ga0495613_0040484
723 Ga0495613_0136842
724 Ga0495624_0000952
725 Ga0495624_0006101
726 Ga0495624_0109343
727 Ga0495624_0124635
728 Ga0495624_0190596
729 Ga0495600_0000064
730 Ga0495600_0008181
731 Ga0495600_0029169
732 Ga0495600_0065983
733 Ga0495600_0083522
734 Ga0495600_0183606
735 Ga0495581_0000204
736 Ga0495581_0003963
737 Ga0495581_0127154
738 Ga0495581_0133795
739 Ga0495604_0000740
740 Ga0495604_0005726
741 Ga0495604_0056300
742 Ga0495604_0220643
743 Ga0495674_0000738
744 Ga0495674_0000931
745 Ga0495674_0015529
746 Ga0495674_0018574
747 Ga0495674_0028432
748 Ga0495674_0051476
749 Ga0495674_0076047
750 Ga0495674_0188429
751 Ga0495674_0189993
752 Ga0495674_0203591
753 Ga0495676_0000713
754 Ga0495676_0012209
755 Ga0495680_0005222
756 Ga0495680_0021922
757 Ga0495680_0026329
758 Ga0495680_0034443
759 Ga0495680_0071092
760 Ga0495680_0103313
761 Ga0495675_0017046
762 Ga0495675_0051239
763 Ga0495684_0002287
764 Ga0495684_0005585
765 Ga0495684_0021068
766 Ga0495684_0044346
767 Ga0495684_0142940
768 Ga0495684_0226278
769 Ga0495593_0001488
770 Ga0495593_0003424
771 Ga0495593_0063452
772 Ga0495593_0073954
773 Ga0495602_0024642
774 Ga0495602_0036178
775 Ga0495602_0046450
776 Ga0495602_0053061
777 Ga0495602_0056509
778 Ga0495602_0121912
779 Ga0495614_0004333
780 Ga0495614_0041908
781 Ga0495614_0099030
782 Ga0496102_0144408
783 Ga0496104_0130458
784 Ga0496105_0138656
785 Ga0496108_0157808
786 Ga0496110_0042362
787 Ga0496115_0136353
788 nmdc:mga05p37_36516_c1
789 nmdc:mga0n895_13267_c1
790 nmdc:mga0rr50_24453_c1
791 nmdc:mga0a205_11236_c1
792 Ga0495601_0001020
793 Ga0495601_0002769
794 Ga0495601_0056489
795 Ga0495601_0107051
796 Ga0495601_0206844
797 Ga0495612_0000248
798 Ga0495612_0014904
799 Ga0495595_0013942
800 Ga0495595_0033184
801 Ga0495619_0003371
802 Ga0495619_0005243
803 Ga0495619_0146838
804 Ga0495619_0262700
805 Ga0495619_0373185
806 Ga0466962_0019576
807 2508672978
808 2508675318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

256

322

0.98

PF13565

HTH_32

Homeodomain-like domain

79

146

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b4j-assembly1.cif.gz_B structural basis for the recognition between hiv-1 integrase and ledgf/p75 0.7825 171 284
8cse-assembly1.cif.gz_A-2 wbbb in complex with alpha-rha-(1-3)-beta-glcnac acceptor 0.7783 214 262
5t3a-assembly1.cif.gz_A-2 maedi-visna virus (mvv) integrase ccd-ctd (residues 60-275) 0.7743 172 284
1vsl-assembly1.cif.gz_A-2 asv integrase core domain d64n mutation with zinc cation 0.756 172 284
3kkr-assembly1.cif.gz_A crystal structure of catalytic core domain of biv integrase in crystal form i 0.7536 171 284
ID Description Score Start End Superfamily
2fokB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8489 108 149 1.10.10.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8353 171 322 3.30.420.10
af_Q4PSE7_54_319_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8248 174 202 2.120.10.80
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8176 171 322 3.30.420.10
af_P37007_135_295_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8151 171 322 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1G9PN29-F1-model_v4 Integrase core domain-containing protein 0.9318 179 306 GO:0003676
GO:0015074
AF-A0A2K8QV42-F1-model_v4 deleted 0.9236 175 300
AF-D7CDR8-F1-model_v4 Integrase 0.9156 191 309 GO:0003676
GO:0015074
AF-A0A1I6FGS3-F1-model_v4 Integrase catalytic domain-containing protein 0.9143 174 271 GO:0003676
GO:0015074
AF-A0A7W9KQ62-F1-model_v4 NADH dehydrogenase FAD-containing subunit 0.9109 181 263

Map