F435534

General Info

Members Datasets Scaffolds Average Seq Length
403 222 807 135

Family's Representative Sequence

Representative Sequence 3300049851|Ga0501212_006617|Ga0501212_006617_203_607
Length 134
Sequence MKKIFKIILPALLLSFVWSACKKDFPVDEDGLLITSRAECYVSSFELLGTDYVTVRTKAAVIDTAQTIKVEVQYGTDLKNLYPQFSLITDAKLDPKITGRVDFSDLANPKVYTVVSGNRQVRKPYTIYITVQPK

Samples

Sample ID Description Type Environment
1 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
168 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
169 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
170 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
183 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
188 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
189 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
190 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
191 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
192 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
193 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
196 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
197 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
221 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
222 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.2
Nodule 0
Rhizoplane 0
Rhizosphere 86.35
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501212_006617 3300049851 Bacteria 1567
2 JGI25154J39366_1000028 3300002738 Bacteria 195818
3 JGI25157J39369_1016804 3300002741 Bacteria 893
4 rootH2_10184389 3300003320 Bacteria 6118
5 rootL2_10064889 3300003322 Bacteria 1572
6 rootL2_10108230 3300003322 Bacteria 2800
7 rootH1_10017056 3300003316 Bacteria 1229
8 rootH1_10017056 3300003323 Bacteria 40617
9 rootH1_10125492 3300003323 Bacteria 9374
10 Ga0070658_10135189 3300005327 Bacteria 2056
11 Ga0070658_10523623 3300005327 Unclassified 1025
12 Ga0070658_10524469 3300005327 Bacteria 1024
13 Ga0070658_10717981 3300005327 Bacteria 868
14 Ga0070683_100303774 3300005329 Bacteria 1518
15 Ga0070670_100014918 3300005331 Bacteria 6667
16 Ga0070670_100280688 3300005331 Bacteria 1454
17 Ga0070677_10040413 3300005333 Bacteria 1835
18 Ga0068869_100186565 3300005334 Bacteria 1628
19 Ga0070680_100000275 3300005336 Bacteria 34229
20 Ga0070680_100574411 3300005336 Bacteria 967
21 Ga0070682_100052080 3300005337 Bacteria 2561
22 Ga0068868_100017355 3300005338 Bacteria 5361
23 Ga0068868_100152829 3300005338 Bacteria 1902
24 Ga0068868_101260179 3300005338 Bacteria 685
25 Ga0070660_100023585 3300005339 Bacteria 4559
26 Ga0070660_100134857 3300005339 Bacteria 1978
27 Ga0070660_101221847 3300005339 Viruses 637
28 Ga0070691_10010096 3300005341 Bacteria 4303
29 Ga0070687_100649934 3300005343 Bacteria 731
30 Ga0070668_100052122 3300005347 Unclassified 3154
31 Ga0070675_100981030 3300005354 Bacteria 775
32 Ga0070671_100124972 3300005355 Bacteria 2166
33 Ga0070671_100212719 3300005355 Bacteria 1640
34 Ga0070671_100255268 3300005355 Unclassified 1490
35 Ga0070674_100020692 3300005356 Bacteria 4210
36 Ga0070674_100147159 3300005356 Bacteria 1774
37 Ga0070674_101627404 3300005356 Bacteria 583
38 Ga0070673_100044861 3300005364 Unclassified 3425
39 Ga0070673_100073150 3300005364 Bacteria 2758
40 Ga0070673_100967336 3300005364 Bacteria 791
41 Ga0070673_101129653 3300005364 Unclassified 733
42 Ga0070688_101042495 3300005365 Bacteria 651
43 Ga0070667_100002488 3300005367 Bacteria 16073
44 Ga0070667_100010101 3300005367 Bacteria 7809
45 Ga0070700_100625897 3300005441 Bacteria 847
46 Ga0070663_100920464 3300005455 Unclassified 756
47 Ga0070678_100844497 3300005456 Bacteria 834
48 Ga0070681_10080924 3300005458 Bacteria 3204
49 Ga0070681_10092709 3300005458 Bacteria 2969
50 Ga0068867_100051680 3300005459 Bacteria 3032
51 Ga0068867_100344965 3300005459 Bacteria 1241
52 Ga0068867_101605022 3300005459 Bacteria 608
53 Ga0070685_10029207 3300005466 Bacteria 3061
54 Ga0070685_10197891 3300005466 Viruses 1304
55 Ga0070679_100003231 3300005530 Bacteria 14889
56 Ga0070679_100008714 3300005530 Bacteria 9562
57 Ga0070679_101225752 3300005530 Bacteria 695
58 Ga0068853_100019494 3300005539 Bacteria 5624
59 Ga0068853_100171125 3300005539 Bacteria 1965
60 Ga0068853_100395973 3300005539 Bacteria 1292
61 Ga0070672_100183443 3300005543 Bacteria 1745
62 Ga0070672_100310655 3300005543 Unclassified 1338
63 Ga0070672_100502759 3300005543 Unclassified 1049
64 Ga0070672_100550381 3300005543 Bacteria 1002
65 Ga0070686_100025381 3300005544 Bacteria 3566
66 Ga0070693_100005844 3300005547 Bacteria 5943
67 Ga0070665_100000018 3300005548 Bacteria 434118
68 Ga0068855_100364439 3300005563 Bacteria 1590
69 Ga0068855_100499056 3300005563 Bacteria 1323
70 Ga0068857_100018198 3300005577 Bacteria 6161
71 Ga0068854_100005078 3300005578 Bacteria 8290
72 Ga0068854_100721393 3300005578 Bacteria 862
73 Ga0068854_100981366 3300005578 Bacteria 747
74 Ga0068854_101970916 3300005578 Bacteria 538
75 Ga0068854_102136228 3300005578 Bacteria 517
76 Ga0068856_100152484 3300005614 Bacteria 2320
77 Ga0068856_100262193 3300005614 Unclassified 1743
78 Ga0070702_100068873 3300005615 Bacteria 2083
79 Ga0068852_100000712 3300005616 Bacteria 21743
80 Ga0068852_100005026 3300005616 Bacteria 9402
81 Ga0068852_100045682 3300005616 Bacteria 3727
82 Ga0068852_100221854 3300005616 Unclassified 1798
83 Ga0068852_100792530 3300005616 Bacteria 961
84 Ga0068852_102043556 3300005616 Bacteria 595
85 Ga0068859_100000101 3300005617 Bacteria 79768
86 Ga0068859_100037644 3300005617 Bacteria 4855
87 Ga0068864_100305155 3300005618 Unclassified 1491
88 Ga0068861_100293064 3300005719 Bacteria 1406
89 Ga0068861_101598022 3300005719 Bacteria 642
90 Ga0068851_10017383 3300005834 Unclassified 3453
91 Ga0068870_10111459 3300005840 Bacteria 1563
92 Ga0068863_100011085 3300005841 Bacteria 8740
93 Ga0068863_100104808 3300005841 Bacteria 2690
94 Ga0068863_100427451 3300005841 Bacteria 1298
95 Ga0068858_100164604 3300005842 Bacteria 2090
96 Ga0068858_100533084 3300005842 Bacteria 1136
97 Ga0068860_100000218 3300005843 Bacteria 90001
98 Ga0068860_100002885 3300005843 Bacteria 17828
99 Ga0068860_100018012 3300005843 Bacteria 6879
100 Ga0068860_100038727 3300005843 Bacteria 4561
101 Ga0075366_10400145 3300006195 Unclassified 845
102 Ga0097621_100044677 3300006237 Bacteria 3575
103 Ga0068871_100227801 3300006358 Bacteria 1617
104 Ga0068871_100415476 3300006358 Bacteria 1200
105 Ga0075429_100311386 3300006880 Bacteria 1378
106 Ga0097620_100000101 3300006931 Bacteria 79768
107 Ga0097620_100037645 3300006931 Bacteria 4855
108 Ga0105240_10001009 3300009093 Bacteria 50206
109 Ga0105240_10001179 3300009093 Bacteria 45780
110 Ga0105240_10002263 3300009093 Bacteria 31206
111 Ga0105240_10007094 3300009093 Bacteria 16333
112 Ga0105240_10101766 3300009093 Bacteria 3493
113 Ga0105240_11335759 3300009093 Bacteria 755
114 Ga0111539_10031715 3300009094 Bacteria 6420
115 Ga0111539_10463008 3300009094 Bacteria 1476
116 Ga0105245_10017586 3300009098 Bacteria 6241
117 Ga0105243_10190211 3300009148 Bacteria 1792
118 Ga0105241_10000692 3300009174 Bacteria 25426
119 Ga0105241_10001500 3300009174 Bacteria 17906
120 Ga0105241_10004803 3300009174 Bacteria 9953
121 Ga0105241_10067717 3300009174 Bacteria 2764
122 Ga0105242_10080097 3300009176 Bacteria 2729
123 Ga0105242_10335177 3300009176 Bacteria 1392
124 Ga0105248_10310644 3300009177 Bacteria 1775
125 Ga0105237_10009787 3300009545 Bacteria 10249
126 Ga0105237_10173741 3300009545 Unclassified 2155
127 Ga0105237_10451551 3300009545 Bacteria 1291
128 Ga0105237_10458480 3300009545 Unclassified 1281
129 Ga0105238_10002208 3300009551 Bacteria 19629
130 Ga0105238_10182932 3300009551 Bacteria 2072
131 Ga0105249_10172311 3300009553 Unclassified 2100
132 Ga0105249_10309530 3300009553 Bacteria 1587
133 Ga0105239_10091208 3300010375 Bacteria 3362
134 Ga0105239_10288198 3300010375 Bacteria 1849
135 Ga0105239_10326978 3300010375 Viruses 1729
136 Ga0105239_10653203 3300010375 Bacteria 1201
137 Ga0105246_10051665 3300011119 Bacteria 2824
138 Ga0157373_10521079 3300013100 Bacteria 860
139 Ga0157373_11276451 3300013100 Bacteria 555
140 Ga0157371_10082048 3300013102 Bacteria 2283
141 Ga0157371_10290505 3300013102 Bacteria 1182
142 Ga0157371_10521671 3300013102 Bacteria 879
143 Ga0157371_10862579 3300013102 Bacteria 685
144 Ga0157370_10000493 3300013104 Bacteria 49035
145 Ga0157370_10246281 3300013104 Bacteria 1653
146 Ga0157370_10563000 3300013104 Unclassified 1044
147 Ga0157370_10577582 3300013104 Bacteria 1030
148 Ga0157370_10904266 3300013104 Bacteria 801
149 Ga0157370_10938969 3300013104 Bacteria 784
150 Ga0157370_11008411 3300013104 Unclassified 753
151 Ga0157374_11431979 3300013296 Bacteria 714
152 Ga0157378_10027010 3300013297 Bacteria 5064
153 Ga0157378_10051549 3300013297 Bacteria 3662
154 Ga0157378_10478194 3300013297 Bacteria 1241
155 Ga0157378_10582447 3300013297 Unclassified 1128
156 Ga0163162_10002042 3300013306 Bacteria 18986
157 Ga0163162_12590271 3300013306 Bacteria 583
158 Ga0157372_10005891 3300013307 Bacteria 13049
159 Ga0157372_10108050 3300013307 Unclassified 3184
160 Ga0157372_10115992 3300013307 Unclassified 3071
161 Ga0157372_10388367 3300013307 Bacteria 1626
162 Ga0157375_10175300 3300013308 Bacteria 2293
163 Ga0157375_10433823 3300013308 Unclassified 1480
164 Ga0157380_10002467 3300014326 Bacteria 12463
165 Ga0157380_10011355 3300014326 Bacteria 6436
166 Ga0157377_10290014 3300014745 Bacteria 1076
167 Ga0157379_10102485 3300014968 Unclassified 2569
168 Ga0157376_10020385 3300014969 Bacteria 5127
169 Ga0157376_10133667 3300014969 Bacteria 2217
170 Ga0157376_10767756 3300014969 Bacteria 974
171 Ga0209258_107770 3300025242 Bacteria 1566
172 Ga0209646_1000006 3300025246 Bacteria 694084
173 Ga0209646_1004228 3300025246 Bacteria 2646
174 Ga0209026_1001171 3300025250 Bacteria 12182
175 Ga0207682_10136370 3300025893 Bacteria 1098
176 Ga0207710_10166359 3300025900 Unclassified 1076
177 Ga0207688_10586321 3300025901 Bacteria 702
178 Ga0207680_10000047 3300025903 Bacteria 61723
179 Ga0207647_10103369 3300025904 Unclassified 1689
180 Ga0207647_10261721 3300025904 Bacteria 990
181 Ga0207645_10136393 3300025907 Bacteria 1598
182 Ga0207643_10223509 3300025908 Bacteria 1153
183 Ga0207705_10007045 3300025909 Bacteria 8294
184 Ga0207705_10154050 3300025909 Bacteria 1723
185 Ga0207705_10570156 3300025909 Bacteria 880
186 Ga0207654_10015384 3300025911 Bacteria 3971
187 Ga0207654_10033859 3300025911 Bacteria 2835
188 Ga0207707_10000272 3300025912 Bacteria 55753
189 Ga0207707_10089828 3300025912 Bacteria 2685
190 Ga0207707_10175686 3300025912 Bacteria 1871
191 Ga0207695_10000361 3300025913 Bacteria 104230
192 Ga0207695_10000431 3300025913 Bacteria 91965
193 Ga0207695_10022314 3300025913 Bacteria 7191
194 Ga0207695_10034070 3300025913 Bacteria 5545
195 Ga0207695_10157492 3300025913 Unclassified 2205
196 Ga0207671_10000609 3300025914 Bacteria 47411
197 Ga0207671_10001196 3300025914 Bacteria 30816
198 Ga0207671_10001996 3300025914 Bacteria 22483
199 Ga0207671_10051350 3300025914 Bacteria 3055
200 Ga0207671_10171742 3300025914 Unclassified 1684
201 Ga0207660_10003199 3300025917 Bacteria 10709
202 Ga0207660_10055045 3300025917 Bacteria 2841
203 Ga0207662_10585928 3300025918 Bacteria 775
204 Ga0207657_10021515 3300025919 Bacteria 6066
205 Ga0207657_10531227 3300025919 Viruses 920
206 Ga0207652_10002352 3300025921 Bacteria 15994
207 Ga0207652_10394259 3300025921 Bacteria 1249
208 Ga0207694_10007500 3300025924 Bacteria 8269
209 Ga0207694_10058697 3300025924 Unclassified 2993
210 Ga0207650_10185871 3300025925 Bacteria 1658
211 Ga0207650_10437328 3300025925 Bacteria 1087
212 Ga0207650_10599622 3300025925 Bacteria 926
213 Ga0207687_10173248 3300025927 Viruses 1666
214 Ga0207687_10922103 3300025927 Unclassified 748
215 Ga0207644_10216732 3300025931 Bacteria 1515
216 Ga0207690_10102172 3300025932 Bacteria 2049
217 Ga0207690_10959328 3300025932 Viruses 711
218 Ga0207686_10266483 3300025934 Bacteria 1258
219 Ga0207686_10668035 3300025934 Bacteria 823
220 Ga0207669_10012095 3300025937 Bacteria 4230
221 Ga0207669_10119389 3300025937 Bacteria 1786
222 Ga0207691_10130128 3300025940 Bacteria 2224
223 Ga0207691_10186901 3300025940 Bacteria 1808
224 Ga0207691_10193755 3300025940 Bacteria 1772
225 Ga0207691_10525404 3300025940 Unclassified 1004
226 Ga0207691_10908213 3300025940 Unclassified 737
227 Ga0207711_10586485 3300025941 Bacteria 1040
228 Ga0207689_10020884 3300025942 Bacteria 5505
229 Ga0207661_10294598 3300025944 Bacteria 1453
230 Ga0207667_10014695 3300025949 Bacteria 8911
231 Ga0207667_10037163 3300025949 Bacteria 5207
232 Ga0207667_10070304 3300025949 Unclassified 3643
233 Ga0207667_10162212 3300025949 Bacteria 2299
234 Ga0207651_10100978 3300025960 Bacteria 2140
235 Ga0207651_10568669 3300025960 Bacteria 988
236 Ga0207651_10696871 3300025960 Bacteria 894
237 Ga0207712_10061601 3300025961 Unclassified 2664
238 Ga0207668_10048381 3300025972 Bacteria 2918
239 Ga0207640_10073496 3300025981 Unclassified 2311
240 Ga0207640_10987375 3300025981 Bacteria 740
241 Ga0207640_11057649 3300025981 Bacteria 716
242 Ga0207658_10005267 3300025986 Bacteria 8897
243 Ga0207658_10106157 3300025986 Viruses 2210
244 Ga0207658_11729713 3300025986 Unclassified 571
245 Ga0207677_10015155 3300026023 Unclassified 4524
246 Ga0207677_10121459 3300026023 Bacteria 1966
247 Ga0207703_10015264 3300026035 Bacteria 5993
248 Ga0207703_10657420 3300026035 Bacteria 995
249 Ga0207639_10021033 3300026041 Bacteria 4680
250 Ga0207639_10129591 3300026041 Bacteria 2086
251 Ga0207639_10619826 3300026041 Unclassified 999
252 Ga0207678_10651231 3300026067 Unclassified 925
253 Ga0207708_10373749 3300026075 Bacteria 1174
254 Ga0207702_10166456 3300026078 Bacteria 2017
255 Ga0207702_10481909 3300026078 Bacteria 1207
256 Ga0207641_10000053 3300026088 Bacteria 173468
257 Ga0207641_10070134 3300026088 Bacteria 3011
258 Ga0207641_11758110 3300026088 Unclassified 622
259 Ga0207648_10411880 3300026089 Bacteria 1226
260 Ga0207648_10736318 3300026089 Bacteria 915
261 Ga0207648_10769997 3300026089 Bacteria 895
262 Ga0207676_10286281 3300026095 Unclassified 1498
263 Ga0207674_10019016 3300026116 Bacteria 7444
264 Ga0207674_10094985 3300026116 Bacteria 2968
265 Ga0207674_10343007 3300026116 Bacteria 1444
266 Ga0207675_100194913 3300026118 Bacteria 1944
267 Ga0207683_10459131 3300026121 Bacteria 1175
268 Ga0207683_10675986 3300026121 Bacteria 957
269 Ga0207698_10009854 3300026142 Bacteria 6107
270 Ga0207698_10029677 3300026142 Bacteria 3920
271 Ga0207698_10122928 3300026142 Bacteria 2201
272 Ga0207698_10568504 3300026142 Unclassified 1114
273 Ga0207698_10874902 3300026142 Bacteria 905
274 Ga0207698_11299083 3300026142 Bacteria 742
275 Ga0207428_10873885 3300027907 Bacteria 636
276 Ga0268266_10000026 3300028379 Bacteria 434485
277 Ga0268266_12323410 3300028379 Bacteria 507
278 Ga0268264_10000015 3300028381 Bacteria 508501
279 Ga0268264_10000019 3300028381 Bacteria 488112
280 Ga0268264_10004646 3300028381 Bacteria 11667
281 Ga0268264_10032244 3300028381 Bacteria 4298
282 Ga0268264_10653757 3300028381 Bacteria 1040
283 Ga0307517_10004039 3300028786 Bacteria 22689
284 Ga0307515_10000003 3300028794 Bacteria 891317
285 Ga0307515_10000251 3300028794 Bacteria 132970
286 Ga0307513_10232347 3300031456 Bacteria 1656
287 Ga0307514_10181457 3300031649 Unclassified 1356
288 Ga0307516_10291644 3300031730 Bacteria 1310
289 Ga0307411_10888125 3300032005 Unclassified 791
290 Ga0373952_0218074 3300035092 Bacteria 565
291 Ga0373927_0087226 3300035695 Bacteria 2026
292 Ga0373937_0308665 3300036401 Bacteria 1496
293 Ga0451849_0089901 3300041505 Bacteria 723
294 Ga0451849_1026127 3300041505 Unclassified 887
295 Ga0451853_3533553 3300041512 Bacteria 669
296 Ga0439431_0000693 3300041997 Bacteria 7251
297 Ga0439455_0208963 3300042012 Bacteria 566
298 Ga0439457_001482 3300042014 Bacteria 7039
299 Ga0451577_0004432 3300042876 Bacteria 14820
300 Ga0451577_0053811 3300042876 Bacteria 3593
301 Ga0451577_0372808 3300042876 Bacteria 1295
302 Ga0451577_0949046 3300042876 Bacteria 773
303 Ga0466969_0367250 3300044656 Unclassified 652
304 Ga0453683_0000015 3300044673 Bacteria 346024
305 Ga0453683_0307560 3300044673 Bacteria 1014
306 Ga0466965_0061497 3300044683 Bacteria 1877
307 Ga0466964_0188206 3300044706 Bacteria 983
308 Ga0453684_0011489 3300044712 Bacteria 14829
309 Ga0453684_0167751 3300044712 Bacteria 2590
310 Ga0453684_0265667 3300044712 Bacteria 1963
311 Ga0453684_1381822 3300044712 Bacteria 731
312 Ga0466970_0001684 3300044765 Bacteria 10621
313 Ga0466970_0058357 3300044765 Bacteria 2066
314 Ga0466959_0000106 3300045049 Bacteria 53641
315 Ga0451576_0001195 3300045051 Bacteria 46437
316 Ga0451576_0107784 3300045051 Bacteria 2899
317 Ga0451576_0119411 3300045051 Bacteria 2745
318 Ga0451576_0460201 3300045051 Bacteria 1336
319 Ga0495662_0362224 3300046476 Bacteria 712
320 Ga0495648_0000386 3300046524 Bacteria 48405
321 Ga0495633_0183849 3300046558 Bacteria 962
322 Ga0495611_0000224 3300046648 Bacteria 39649
323 Ga0495611_0014124 3300046648 Bacteria 3408
324 Ga0495625_0177059 3300046660 Bacteria 1421
325 Ga0495674_0148999 3300047319 Bacteria 1963
326 Ga0495686_0031689 3300047472 Unclassified 3426
327 Ga0495686_0451551 3300047472 Bacteria 683
328 Ga0496117_0002012 3300048920 Bacteria 26932
329 Ga0496118_0218862 3300048921 Bacteria 1110
330 Ga0496122_0081325 3300048925 Bacteria 2255
331 Ga0496123_0047590 3300048926 Bacteria 2895
332 Ga0496124_0640818 3300048927 Bacteria 684
333 Ga0501290_011965 3300049513 Bacteria 1122
334 Ga0501291_071056 3300049514 Bacteria 674
335 Ga0501292_040543 3300049515 Bacteria 803
336 Ga0501297_007523 3300049520 Bacteria 1185
337 Ga0501298_000083 3300049521 Bacteria 10611
338 Ga0501299_008013 3300049522 Bacteria 1707
339 Ga0501034_0061143 3300049571 Bacteria 3783
340 Ga0501036_0438815 3300049572 Bacteria 1088
341 Ga0501038_1281742 3300049574 Bacteria 530
342 Ga0501043_0977327 3300049579 Bacteria 604
343 Ga0501047_0028700 3300049581 Bacteria 5366
344 Ga0501047_0342575 3300049581 Bacteria 1332
345 Ga0501201_000199 3300049651 Bacteria 5282
346 Ga0501202_000586 3300049652 Bacteria 5314
347 Ga0501206_005358 3300049653 Unclassified 1650
348 Ga0501217_000401 3300049661 Bacteria 6983
349 Ga0501222_000991 3300049662 Bacteria 4054
350 Ga0501223_004596 3300049663 Bacteria 2939
351 Ga0501224_001408 3300049664 Bacteria 3186
352 Ga0501227_060699 3300049665 Bacteria 969
353 Ga0501233_000833 3300049668 Bacteria 5182
354 Ga0501233_028169 3300049668 Unclassified 1253
355 Ga0501243_001270 3300049675 Bacteria 3596
356 Ga0501252_000806 3300049682 Bacteria 2634
357 Ga0501252_017221 3300049682 Bacteria 916
358 Ga0501255_003356 3300049684 Bacteria 1478
359 Ga0501256_001630 3300049685 Bacteria 1688
360 Ga0501257_133964 3300049686 Bacteria 672
361 Ga0501259_000615 3300049688 Bacteria 5713
362 Ga0501261_000776 3300049690 Bacteria 3980
363 Ga0501225_0003032 3300049705 Bacteria 5131
364 Ga0501225_0041062 3300049705 Unclassified 1275
365 Ga0501245_000586 3300049708 Unclassified 4454
366 Ga0501265_105960 3300049762 Unclassified 519
367 Ga0501271_004421 3300049768 Bacteria 1331
368 Ga0501035_0102948 3300049822 Bacteria 2505
369 Ga0501044_0111735 3300049823 Bacteria 2740
370 Ga0501044_0154368 3300049823 Bacteria 2276
371 Ga0501044_0369474 3300049823 Bacteria 1351
372 nmdc:mga0k408_3869_c1 3300050493 Bacteria 7935
373 nmdc:mga0k408_424665_c1 3300050493 Unclassified 790
374 nmdc:mga08y16_121481_c1 3300050511 Unclassified 2718
375 nmdc:mga08y16_324130_c1 3300050511 Bacteria 1585
376 Ga0500578_0214648 3300053086 Bacteria 1172
377 Ga0500646_0052203 3300053090 Bacteria 1183
378 Ga0500646_0120227 3300053090 Bacteria 844
379 Ga0500646_0301194 3300053090 Bacteria 575
380 Ga0500583_0072529 3300053092 Bacteria 1649
381 Ga0500583_0604444 3300053092 Unclassified 504
382 Ga0500554_054499 3300053102 Bacteria 1268
383 Ga0500556_0238344 3300053104 Bacteria 717
384 Ga0500569_058780 3300053109 Bacteria 1181
385 Ga0500642_0229581 3300053130 Bacteria 858
386 Ga0500652_015532 3300053131 Bacteria 2750
387 Ga0500658_0007308 3300053134 Bacteria 4080
388 Ga0500559_0096542 3300053136 Bacteria 1358
389 Ga0500577_0001741 3300053142 Bacteria 5563
390 Ga0500577_0153771 3300053142 Bacteria 977
391 Ga0500588_0026283 3300053146 Unclassified 1627
392 Ga0500588_0043073 3300053146 Bacteria 1371
393 Ga0500604_0025730 3300053151 Bacteria 1693
394 Ga0500616_0011032 3300053153 Bacteria 5376
395 Ga0500616_0125129 3300053153 Bacteria 1222
396 Ga0500622_0000479 3300053156 Bacteria 37484
397 Ga0500622_0008068 3300053156 Bacteria 5924
398 Ga0500622_0412000 3300053156 Bacteria 546
399 Ga0500636_0306427 3300053177 Bacteria 779
400 Ga0500645_102459 3300053730 Bacteria 807
401 Ga0590075_077466 3300059424 Bacteria 860
402 2896088950 2896085136 Bacteria 6129793
403 2896320564 2896317667 Bacteria 4606601
404 2929924910 2929921140 Bacteria 8649150
405 Ga0501212_006617
406 JGI25154J39366_1000028
407 JGI25157J39369_1016804
408 rootH2_10184389
409 rootL2_10064889
410 rootL2_10108230
411 rootH1_10017056
412 rootH1_10125492
413 Ga0070658_10135189
414 Ga0070658_10523623
415 Ga0070658_10524469
416 Ga0070658_10717981
417 Ga0070683_100303774
418 Ga0070670_100014918
419 Ga0070670_100280688
420 Ga0070677_10040413
421 Ga0068869_100186565
422 Ga0070680_100000275
423 Ga0070680_100574411
424 Ga0070682_100052080
425 Ga0068868_100017355
426 Ga0068868_100152829
427 Ga0068868_101260179
428 Ga0070660_100023585
429 Ga0070660_100134857
430 Ga0070660_101221847
431 Ga0070691_10010096
432 Ga0070687_100649934
433 Ga0070668_100052122
434 Ga0070675_100981030
435 Ga0070671_100124972
436 Ga0070671_100212719
437 Ga0070671_100255268
438 Ga0070674_100020692
439 Ga0070674_100147159
440 Ga0070674_101627404
441 Ga0070673_100044861
442 Ga0070673_100073150
443 Ga0070673_100967336
444 Ga0070673_101129653
445 Ga0070688_101042495
446 Ga0070667_100002488
447 Ga0070667_100010101
448 Ga0070700_100625897
449 Ga0070663_100920464
450 Ga0070678_100844497
451 Ga0070681_10080924
452 Ga0070681_10092709
453 Ga0068867_100051680
454 Ga0068867_100344965
455 Ga0068867_101605022
456 Ga0070685_10029207
457 Ga0070685_10197891
458 Ga0070679_100003231
459 Ga0070679_100008714
460 Ga0070679_101225752
461 Ga0068853_100019494
462 Ga0068853_100171125
463 Ga0068853_100395973
464 Ga0070672_100183443
465 Ga0070672_100310655
466 Ga0070672_100502759
467 Ga0070672_100550381
468 Ga0070686_100025381
469 Ga0070693_100005844
470 Ga0070665_100000018
471 Ga0068855_100364439
472 Ga0068855_100499056
473 Ga0068857_100018198
474 Ga0068854_100005078
475 Ga0068854_100721393
476 Ga0068854_100981366
477 Ga0068854_101970916
478 Ga0068854_102136228
479 Ga0068856_100152484
480 Ga0068856_100262193
481 Ga0070702_100068873
482 Ga0068852_100000712
483 Ga0068852_100005026
484 Ga0068852_100045682
485 Ga0068852_100221854
486 Ga0068852_100792530
487 Ga0068852_102043556
488 Ga0068859_100000101
489 Ga0068859_100037644
490 Ga0068864_100305155
491 Ga0068861_100293064
492 Ga0068861_101598022
493 Ga0068851_10017383
494 Ga0068870_10111459
495 Ga0068863_100011085
496 Ga0068863_100104808
497 Ga0068863_100427451
498 Ga0068858_100164604
499 Ga0068858_100533084
500 Ga0068860_100000218
501 Ga0068860_100002885
502 Ga0068860_100018012
503 Ga0068860_100038727
504 Ga0075366_10400145
505 Ga0097621_100044677
506 Ga0068871_100227801
507 Ga0068871_100415476
508 Ga0075429_100311386
509 Ga0097620_100000101
510 Ga0097620_100037645
511 Ga0105240_10001009
512 Ga0105240_10001179
513 Ga0105240_10002263
514 Ga0105240_10007094
515 Ga0105240_10101766
516 Ga0105240_11335759
517 Ga0111539_10031715
518 Ga0111539_10463008
519 Ga0105245_10017586
520 Ga0105243_10190211
521 Ga0105241_10000692
522 Ga0105241_10001500
523 Ga0105241_10004803
524 Ga0105241_10067717
525 Ga0105242_10080097
526 Ga0105242_10335177
527 Ga0105248_10310644
528 Ga0105237_10009787
529 Ga0105237_10173741
530 Ga0105237_10451551
531 Ga0105237_10458480
532 Ga0105238_10002208
533 Ga0105238_10182932
534 Ga0105249_10172311
535 Ga0105249_10309530
536 Ga0105239_10091208
537 Ga0105239_10288198
538 Ga0105239_10326978
539 Ga0105239_10653203
540 Ga0105246_10051665
541 Ga0157373_10521079
542 Ga0157373_11276451
543 Ga0157371_10082048
544 Ga0157371_10290505
545 Ga0157371_10521671
546 Ga0157371_10862579
547 Ga0157370_10000493
548 Ga0157370_10246281
549 Ga0157370_10563000
550 Ga0157370_10577582
551 Ga0157370_10904266
552 Ga0157370_10938969
553 Ga0157370_11008411
554 Ga0157374_11431979
555 Ga0157378_10027010
556 Ga0157378_10051549
557 Ga0157378_10478194
558 Ga0157378_10582447
559 Ga0163162_10002042
560 Ga0163162_12590271
561 Ga0157372_10005891
562 Ga0157372_10108050
563 Ga0157372_10115992
564 Ga0157372_10388367
565 Ga0157375_10175300
566 Ga0157375_10433823
567 Ga0157380_10002467
568 Ga0157380_10011355
569 Ga0157377_10290014
570 Ga0157379_10102485
571 Ga0157376_10020385
572 Ga0157376_10133667
573 Ga0157376_10767756
574 Ga0209258_107770
575 Ga0209646_1000006
576 Ga0209646_1004228
577 Ga0209026_1001171
578 Ga0207682_10136370
579 Ga0207710_10166359
580 Ga0207688_10586321
581 Ga0207680_10000047
582 Ga0207647_10103369
583 Ga0207647_10261721
584 Ga0207645_10136393
585 Ga0207643_10223509
586 Ga0207705_10007045
587 Ga0207705_10154050
588 Ga0207705_10570156
589 Ga0207654_10015384
590 Ga0207654_10033859
591 Ga0207707_10000272
592 Ga0207707_10089828
593 Ga0207707_10175686
594 Ga0207695_10000361
595 Ga0207695_10000431
596 Ga0207695_10022314
597 Ga0207695_10034070
598 Ga0207695_10157492
599 Ga0207671_10000609
600 Ga0207671_10001196
601 Ga0207671_10001996
602 Ga0207671_10051350
603 Ga0207671_10171742
604 Ga0207660_10003199
605 Ga0207660_10055045
606 Ga0207662_10585928
607 Ga0207657_10021515
608 Ga0207657_10531227
609 Ga0207652_10002352
610 Ga0207652_10394259
611 Ga0207694_10007500
612 Ga0207694_10058697
613 Ga0207650_10185871
614 Ga0207650_10437328
615 Ga0207650_10599622
616 Ga0207687_10173248
617 Ga0207687_10922103
618 Ga0207644_10216732
619 Ga0207690_10102172
620 Ga0207690_10959328
621 Ga0207686_10266483
622 Ga0207686_10668035
623 Ga0207669_10012095
624 Ga0207669_10119389
625 Ga0207691_10130128
626 Ga0207691_10186901
627 Ga0207691_10193755
628 Ga0207691_10525404
629 Ga0207691_10908213
630 Ga0207711_10586485
631 Ga0207689_10020884
632 Ga0207661_10294598
633 Ga0207667_10014695
634 Ga0207667_10037163
635 Ga0207667_10070304
636 Ga0207667_10162212
637 Ga0207651_10100978
638 Ga0207651_10568669
639 Ga0207651_10696871
640 Ga0207712_10061601
641 Ga0207668_10048381
642 Ga0207640_10073496
643 Ga0207640_10987375
644 Ga0207640_11057649
645 Ga0207658_10005267
646 Ga0207658_10106157
647 Ga0207658_11729713
648 Ga0207677_10015155
649 Ga0207677_10121459
650 Ga0207703_10015264
651 Ga0207703_10657420
652 Ga0207639_10021033
653 Ga0207639_10129591
654 Ga0207639_10619826
655 Ga0207678_10651231
656 Ga0207708_10373749
657 Ga0207702_10166456
658 Ga0207702_10481909
659 Ga0207641_10000053
660 Ga0207641_10070134
661 Ga0207641_11758110
662 Ga0207648_10411880
663 Ga0207648_10736318
664 Ga0207648_10769997
665 Ga0207676_10286281
666 Ga0207674_10019016
667 Ga0207674_10094985
668 Ga0207674_10343007
669 Ga0207675_100194913
670 Ga0207683_10459131
671 Ga0207683_10675986
672 Ga0207698_10009854
673 Ga0207698_10029677
674 Ga0207698_10122928
675 Ga0207698_10568504
676 Ga0207698_10874902
677 Ga0207698_11299083
678 Ga0207428_10873885
679 Ga0268266_10000026
680 Ga0268266_12323410
681 Ga0268264_10000015
682 Ga0268264_10000019
683 Ga0268264_10004646
684 Ga0268264_10032244
685 Ga0268264_10653757
686 Ga0307517_10004039
687 Ga0307515_10000003
688 Ga0307515_10000251
689 Ga0307513_10232347
690 Ga0307514_10181457
691 Ga0307516_10291644
692 Ga0307411_10888125
693 Ga0373952_0218074
694 Ga0373927_0087226
695 Ga0373937_0308665
696 Ga0451849_0089901
697 Ga0451849_1026127
698 Ga0451853_3533553
699 Ga0439431_0000693
700 Ga0439455_0208963
701 Ga0439457_001482
702 Ga0451577_0004432
703 Ga0451577_0053811
704 Ga0451577_0372808
705 Ga0451577_0949046
706 Ga0466969_0367250
707 Ga0453683_0000015
708 Ga0453683_0307560
709 Ga0466965_0061497
710 Ga0466964_0188206
711 Ga0453684_0011489
712 Ga0453684_0167751
713 Ga0453684_0265667
714 Ga0453684_1381822
715 Ga0466970_0001684
716 Ga0466970_0058357
717 Ga0466959_0000106
718 Ga0451576_0001195
719 Ga0451576_0107784
720 Ga0451576_0119411
721 Ga0451576_0460201
722 Ga0495662_0362224
723 Ga0495648_0000386
724 Ga0495633_0183849
725 Ga0495611_0000224
726 Ga0495611_0014124
727 Ga0495625_0177059
728 Ga0495674_0148999
729 Ga0495686_0031689
730 Ga0495686_0451551
731 Ga0496117_0002012
732 Ga0496118_0218862
733 Ga0496122_0081325
734 Ga0496123_0047590
735 Ga0496124_0640818
736 Ga0501290_011965
737 Ga0501291_071056
738 Ga0501292_040543
739 Ga0501297_007523
740 Ga0501298_000083
741 Ga0501299_008013
742 Ga0501034_0061143
743 Ga0501036_0438815
744 Ga0501038_1281742
745 Ga0501043_0977327
746 Ga0501047_0028700
747 Ga0501047_0342575
748 Ga0501201_000199
749 Ga0501202_000586
750 Ga0501206_005358
751 Ga0501217_000401
752 Ga0501222_000991
753 Ga0501223_004596
754 Ga0501224_001408
755 Ga0501227_060699
756 Ga0501233_000833
757 Ga0501233_028169
758 Ga0501243_001270
759 Ga0501252_000806
760 Ga0501252_017221
761 Ga0501255_003356
762 Ga0501256_001630
763 Ga0501257_133964
764 Ga0501259_000615
765 Ga0501261_000776
766 Ga0501225_0003032
767 Ga0501225_0041062
768 Ga0501245_000586
769 Ga0501265_105960
770 Ga0501271_004421
771 Ga0501035_0102948
772 Ga0501044_0111735
773 Ga0501044_0154368
774 Ga0501044_0369474
775 nmdc:mga0k408_3869_c1
776 nmdc:mga0k408_424665_c1
777 nmdc:mga08y16_121481_c1
778 nmdc:mga08y16_324130_c1
779 Ga0500578_0214648
780 Ga0500646_0052203
781 Ga0500646_0120227
782 Ga0500646_0301194
783 Ga0500583_0072529
784 Ga0500583_0604444
785 Ga0500554_054499
786 Ga0500556_0238344
787 Ga0500569_058780
788 Ga0500642_0229581
789 Ga0500652_015532
790 Ga0500658_0007308
791 Ga0500559_0096542
792 Ga0500577_0001741
793 Ga0500577_0153771
794 Ga0500588_0026283
795 Ga0500588_0043073
796 Ga0500604_0025730
797 Ga0500616_0011032
798 Ga0500616_0125129
799 Ga0500622_0000479
800 Ga0500622_0008068
801 Ga0500622_0412000
802 Ga0500636_0306427
803 Ga0500645_102459
804 Ga0590075_077466
805 2896088950
806 2896320564
807 2929924910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hbz-assembly1.cif.gz_A crystal structure of a putative glycoside hydrolase (bt_2081) from bacteroides thetaiotaomicron vpi-5482 at 2.05 a resolution 0.8917 38 135
8aa2-assembly1.cif.gz_G inactive levan utilisation machinery (utilisome) in the presence of levan fructo-oligosaccharides dp 15-25 0.8491 39 134
8aa0-assembly1.cif.gz_T levan utilisation machinery (utilisome) with levan fructo-oligosaccharides dp 8-12 0.8353 40 135
4het-assembly1.cif.gz_A crystal structure of a putative glycoside hydrolase (bt3745) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution 0.7977 39 135
8aa0-assembly1.cif.gz_T levan utilisation machinery (utilisome) with levan fructo-oligosaccharides dp 8-12 0.7403 40 135
ID Description Score Start End Superfamily
3hbzA01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8957 38 133 2.60.40.2340
3hbzA01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8246 38 133 2.60.40.2340
af_A0A0R4IZ29_28_136_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7684 110 133 2.60.40.60
3p69B00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6783 34 134 2.60.40.4120
af_Q64612_1128_1413_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6767 112 135 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A1R4KQW4-F1-model_v4 Uncharacterized protein 1 27 135
AF-R9GVD7-F1-model_v4 Uncharacterized protein 0.9937 43 135
AF-A0A1R4KQW4-F1-model_v4 Uncharacterized protein 0.9913 27 135
AF-A0A1I0R355-F1-model_v4 DUF4625 domain-containing protein 0.9763 20 135
AF-A0A399CVQ9-F1-model_v4 Uncharacterized protein 0.9763 19 135

Map