F435440

General Info

Members Datasets Scaffolds Average Seq Length
403 198 806 137

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0728400|Ga0395899_0728400_152_592
Length 146
Sequence MGVRGSSAMSRSLVHTCIRVRDPEASQRFYSALGFEPRGRLNFSSAYNIYMGLPGAGDQLELTVNVGRDEPYDLGEGYNHIALTVDDLDATLATLASALGVEPERPPYRPGDRDDLPRIAFVADPDGYRIELIDGGRFDTPQDPAS

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 10.92
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0728400 3300037312 Bacteria 619
2 JGI25406J46586_10012889 3300003203 Bacteria 3610
3 JGI25407J50210_10073509 3300003373 Bacteria 852
4 Ga0070676_10107845 3300005328 Bacteria 1730
5 Ga0070683_100042194 3300005329 Bacteria 4200
6 Ga0070683_100075359 3300005329 Bacteria 3152
7 Ga0070683_100549784 3300005329 Bacteria 1104
8 Ga0070683_100559921 3300005329 Bacteria 1093
9 Ga0070683_100867624 3300005329 Bacteria 866
10 Ga0070683_101101851 3300005329 Bacteria 763
11 Ga0070683_102074566 3300005329 Bacteria 546
12 Ga0070670_101956483 3300005331 Bacteria 540
13 Ga0068869_100178472 3300005334 Bacteria 1664
14 Ga0068869_101270508 3300005334 Bacteria 649
15 Ga0070682_100002413 3300005337 Bacteria 10348
16 Ga0070682_100322039 3300005337 Bacteria 1142
17 Ga0068868_100156992 3300005338 Bacteria 1877
18 Ga0070660_100196962 3300005339 Bacteria 1633
19 Ga0070660_100471409 3300005339 Bacteria 1043
20 Ga0070660_100891409 3300005339 Bacteria 750
21 Ga0070660_101592989 3300005339 Bacteria 556
22 Ga0070689_101121246 3300005340 Bacteria 704
23 Ga0070691_10082899 3300005341 Bacteria 1572
24 Ga0070691_10548238 3300005341 Bacteria 675
25 Ga0070687_100951883 3300005343 Bacteria 619
26 Ga0070687_101079938 3300005343 Bacteria 586
27 Ga0070661_100245806 3300005344 Bacteria 1379
28 Ga0070692_10093753 3300005345 Bacteria 1635
29 Ga0070668_100086537 3300005347 Bacteria 2464
30 Ga0070668_100134278 3300005347 Bacteria 1989
31 Ga0070669_100178261 3300005353 Bacteria 1661
32 Ga0070669_100222961 3300005353 Bacteria 1491
33 Ga0070669_101071665 3300005353 Bacteria 693
34 Ga0070675_100051187 3300005354 Bacteria 3393
35 Ga0070675_100701786 3300005354 Bacteria 921
36 Ga0070671_100076920 3300005355 Bacteria 2789
37 Ga0070671_100546818 3300005355 Bacteria 998
38 Ga0070674_100184772 3300005356 Bacteria 1599
39 Ga0070673_100728227 3300005364 Bacteria 912
40 Ga0070688_100308498 3300005365 Bacteria 1146
41 Ga0070659_100074207 3300005366 Bacteria 2709
42 Ga0070659_100191823 3300005366 Bacteria 1680
43 Ga0070659_100246109 3300005366 Bacteria 1481
44 Ga0070709_10295676 3300005434 Bacteria 1181
45 Ga0070714_100805644 3300005435 Bacteria 910
46 Ga0070713_100861869 3300005436 Bacteria 870
47 Ga0070701_10178274 3300005438 Bacteria 1242
48 Ga0070700_100011939 3300005441 Bacteria 4826
49 Ga0070700_100073873 3300005441 Bacteria 2183
50 Ga0070700_100146276 3300005441 Bacteria 1611
51 Ga0070663_100007848 3300005455 Bacteria 6525
52 Ga0070663_100191426 3300005455 Bacteria 1592
53 Ga0070663_100473641 3300005455 Bacteria 1036
54 Ga0070663_100962833 3300005455 Bacteria 740
55 Ga0070663_101180280 3300005455 Bacteria 672
56 Ga0070662_100041279 3300005457 Bacteria 3290
57 Ga0070662_100041307 3300005457 Bacteria 3289
58 Ga0070662_101959280 3300005457 Bacteria 506
59 Ga0068867_100352423 3300005459 Bacteria 1229
60 Ga0068867_101166072 3300005459 Bacteria 706
61 Ga0070685_11220039 3300005466 Bacteria 572
62 Ga0070684_100004339 3300005535 Bacteria 10778
63 Ga0070684_100236981 3300005535 Bacteria 1667
64 Ga0070684_101382333 3300005535 Bacteria 663
65 Ga0070684_101735808 3300005535 Bacteria 589
66 Ga0070686_100213647 3300005544 Bacteria 1390
67 Ga0070693_100036334 3300005547 Bacteria 2738
68 Ga0070665_100008022 3300005548 Bacteria 10695
69 Ga0070665_100647141 3300005548 Bacteria 1070
70 Ga0070704_100147003 3300005549 Bacteria 1848
71 Ga0070704_101556277 3300005549 Bacteria 609
72 Ga0068855_100284986 3300005563 Bacteria 1833
73 Ga0070664_100387460 3300005564 Bacteria 1277
74 Ga0070664_102023566 3300005564 Bacteria 547
75 Ga0068857_100650119 3300005577 Bacteria 999
76 Ga0068857_100888507 3300005577 Bacteria 854
77 Ga0068854_100029127 3300005578 Bacteria 3821
78 Ga0068854_100217206 3300005578 Bacteria 1511
79 Ga0068854_100635105 3300005578 Bacteria 915
80 Ga0068854_100859493 3300005578 Bacteria 795
81 Ga0068856_100383720 3300005614 Bacteria 1424
82 Ga0068856_100525548 3300005614 Bacteria 1204
83 Ga0070702_100005959 3300005615 Bacteria 5732
84 Ga0068852_100078904 3300005616 Bacteria 2914
85 Ga0068859_100084911 3300005617 Bacteria 3211
86 Ga0068859_100644044 3300005617 Bacteria 1152
87 Ga0068864_100048348 3300005618 Bacteria 3656
88 Ga0068864_102553049 3300005618 Bacteria 517
89 Ga0068866_10382350 3300005718 Bacteria 903
90 Ga0068861_100078415 3300005719 Bacteria 2579
91 Ga0068861_100151647 3300005719 Bacteria 1902
92 Ga0068861_100408230 3300005719 Bacteria 1207
93 Ga0068861_100536197 3300005719 Bacteria 1064
94 Ga0068870_10174415 3300005840 Bacteria 1286
95 Ga0068870_10239928 3300005840 Bacteria 1119
96 Ga0068870_10509713 3300005840 Bacteria 803
97 Ga0068863_100342353 3300005841 Bacteria 1455
98 Ga0068858_100210358 3300005842 Bacteria 1840
99 Ga0068858_100288921 3300005842 Bacteria 1563
100 Ga0068860_100071530 3300005843 Bacteria 3296
101 Ga0068860_102529494 3300005843 Bacteria 533
102 Ga0068862_100582704 3300005844 Bacteria 1072
103 Ga0068862_101881338 3300005844 Bacteria 608
104 Ga0081538_10008845 3300005981 Bacteria 8475
105 Ga0081538_10013845 3300005981 Bacteria 6362
106 Ga0081538_10032297 3300005981 Bacteria 3511
107 Ga0081540_1002225 3300005983 Bacteria 15996
108 Ga0081540_1027445 3300005983 Bacteria 3225
109 Ga0081539_10034989 3300005985 Bacteria 3027
110 Ga0070717_10026711 3300006028 Bacteria 4608
111 Ga0070717_10098098 3300006028 Bacteria 2483
112 Ga0075432_10216910 3300006058 Unclassified 764
113 Ga0075432_10499130 3300006058 Bacteria 542
114 Ga0070712_100006571 3300006175 Bacteria 7219
115 Ga0068871_101042056 3300006358 Bacteria 763
116 Ga0075428_100792369 3300006844 Bacteria 1007
117 Ga0075431_100190860 3300006847 Unclassified 2099
118 Ga0075433_10288750 3300006852 Bacteria 1453
119 Ga0068865_100148467 3300006881 Bacteria 1776
120 Ga0068865_100199460 3300006881 Bacteria 1553
121 Ga0068865_100385015 3300006881 Bacteria 1145
122 Ga0068865_100846722 3300006881 Bacteria 792
123 Ga0075436_100227798 3300006914 Bacteria 1324
124 Ga0097620_100084910 3300006931 Bacteria 3211
125 Ga0097620_100644039 3300006931 Bacteria 1152
126 Ga0111539_10523770 3300009094 Bacteria 1381
127 Ga0105245_10007024 3300009098 Bacteria 9880
128 Ga0105245_10041901 3300009098 Bacteria 4083
129 Ga0105245_10368480 3300009098 Bacteria 1427
130 Ga0105245_10738328 3300009098 Bacteria 1020
131 Ga0105245_10901463 3300009098 Bacteria 926
132 Ga0105247_10137932 3300009101 Bacteria 1596
133 Ga0114129_11480520 3300009147 Bacteria 835
134 Ga0114129_11633435 3300009147 Bacteria 788
135 Ga0105243_10295495 3300009148 Bacteria 1466
136 Ga0105243_10322084 3300009148 Bacteria 1409
137 Ga0105243_10472669 3300009148 Bacteria 1181
138 Ga0105243_10567537 3300009148 Bacteria 1087
139 Ga0105243_10672918 3300009148 Bacteria 1006
140 Ga0105242_10422250 3300009176 Bacteria 1250
141 Ga0105242_10468636 3300009176 Bacteria 1191
142 Ga0105248_10016268 3300009177 Bacteria 8188
143 Ga0105248_10221766 3300009177 Bacteria 2128
144 Ga0105248_11176896 3300009177 Bacteria 867
145 Ga0105237_10396284 3300009545 Bacteria 1385
146 Ga0105237_10830197 3300009545 Bacteria 931
147 Ga0105238_10858612 3300009551 Bacteria 925
148 Ga0105238_12193597 3300009551 Bacteria 587
149 Ga0105249_10196726 3300009553 Bacteria 1970
150 Ga0105249_10269829 3300009553 Bacteria 1695
151 Ga0105249_10922964 3300009553 Bacteria 940
152 Ga0105249_11110321 3300009553 Bacteria 861
153 Ga0105239_10020705 3300010375 Bacteria 7256
154 Ga0105239_10672027 3300010375 Bacteria 1183
155 Ga0105239_11035123 3300010375 Bacteria 944
156 Ga0105239_12195581 3300010375 Bacteria 642
157 Ga0105246_10061412 3300011119 Bacteria 2615
158 Ga0105246_11320655 3300011119 Bacteria 669
159 Ga0105246_11601735 3300011119 Bacteria 615
160 Ga0157369_10133563 3300013105 Bacteria 2629
161 Ga0157374_10001031 3300013296 Bacteria 24196
162 Ga0157374_11626820 3300013296 Bacteria 670
163 Ga0157378_10368109 3300013297 Bacteria 1408
164 Ga0157378_10394737 3300013297 Bacteria 1362
165 Ga0163162_10125693 3300013306 Bacteria 2670
166 Ga0163162_12777018 3300013306 Bacteria 564
167 Ga0157372_10039938 3300013307 Bacteria 5181
168 Ga0157372_10528695 3300013307 Bacteria 1375
169 Ga0157375_11449675 3300013308 Bacteria 809
170 Ga0163163_10230670 3300014325 Bacteria 1900
171 Ga0163163_10357510 3300014325 Bacteria 1517
172 Ga0157380_10071880 3300014326 Bacteria 2800
173 Ga0157380_11744428 3300014326 Bacteria 681
174 Ga0182008_10137522 3300014497 Bacteria 1221
175 Ga0157377_10001906 3300014745 Bacteria 9128
176 Ga0157377_10511269 3300014745 Bacteria 841
177 Ga0157376_10527510 3300014969 Bacteria 1165
178 Ga0213874_10024128 3300021377 Bacteria 1702
179 Ga0213875_10020301 3300021388 Bacteria 3187
180 Ga0207656_10263983 3300025321 Bacteria 846
181 Ga0207642_10026784 3300025899 Bacteria 2351
182 Ga0207642_10092351 3300025899 Bacteria 1498
183 Ga0207642_10375231 3300025899 Bacteria 845
184 Ga0207688_10000219 3300025901 Bacteria 25690
185 Ga0207688_10012555 3300025901 Bacteria 4609
186 Ga0207688_10015767 3300025901 Bacteria 4098
187 Ga0207705_10162428 3300025909 Bacteria 1679
188 Ga0207705_11438185 3300025909 Bacteria 523
189 Ga0207671_10979669 3300025914 Bacteria 667
190 Ga0207693_10035123 3300025915 Bacteria 3953
191 Ga0207693_10341594 3300025915 Bacteria 1172
192 Ga0207662_10304997 3300025918 Bacteria 1059
193 Ga0207662_11024241 3300025918 Bacteria 586
194 Ga0207657_10230657 3300025919 Bacteria 1481
195 Ga0207657_10311875 3300025919 Bacteria 1245
196 Ga0207657_10404007 3300025919 Bacteria 1074
197 Ga0207657_10521139 3300025919 Bacteria 930
198 Ga0207657_11201603 3300025919 Bacteria 576
199 Ga0207650_10243842 3300025925 Bacteria 1453
200 Ga0207659_10162792 3300025926 Bacteria 1753
201 Ga0207659_10727509 3300025926 Bacteria 850
202 Ga0207687_10050083 3300025927 Bacteria 2906
203 Ga0207687_10243110 3300025927 Bacteria 1427
204 Ga0207687_10293311 3300025927 Bacteria 1308
205 Ga0207687_11365060 3300025927 Bacteria 609
206 Ga0207644_11539582 3300025931 Bacteria 558
207 Ga0207690_10034888 3300025932 Bacteria 3244
208 Ga0207690_10319816 3300025932 Bacteria 1219
209 Ga0207690_10659104 3300025932 Bacteria 858
210 Ga0207690_11066163 3300025932 Bacteria 673
211 Ga0207706_10024118 3300025933 Bacteria 5455
212 Ga0207706_10042375 3300025933 Bacteria 4034
213 Ga0207706_10976054 3300025933 Bacteria 713
214 Ga0207686_10433308 3300025934 Bacteria 1008
215 Ga0207686_10433967 3300025934 Bacteria 1007
216 Ga0207709_10282171 3300025935 Bacteria 1227
217 Ga0207709_10873218 3300025935 Bacteria 730
218 Ga0207709_11027358 3300025935 Bacteria 675
219 Ga0207669_10028247 3300025937 Bacteria 3084
220 Ga0207669_10254418 3300025937 Bacteria 1310
221 Ga0207669_10432339 3300025937 Bacteria 1039
222 Ga0207669_10866412 3300025937 Bacteria 753
223 Ga0207704_10069833 3300025938 Bacteria 2222
224 Ga0207704_10179083 3300025938 Bacteria 1530
225 Ga0207704_10238637 3300025938 Bacteria 1357
226 Ga0207704_11455951 3300025938 Bacteria 587
227 Ga0207665_10104887 3300025939 Bacteria 1979
228 Ga0207691_10265681 3300025940 Bacteria 1478
229 Ga0207689_10102856 3300025942 Bacteria 2347
230 Ga0207689_10350654 3300025942 Bacteria 1227
231 Ga0207661_10078996 3300025944 Bacteria 2711
232 Ga0207661_10195521 3300025944 Bacteria 1776
233 Ga0207661_10488067 3300025944 Bacteria 1125
234 Ga0207661_10549316 3300025944 Bacteria 1058
235 Ga0207661_11618839 3300025944 Bacteria 592
236 Ga0207661_11783787 3300025944 Bacteria 561
237 Ga0207679_10155254 3300025945 Bacteria 1868
238 Ga0207679_10186858 3300025945 Bacteria 1719
239 Ga0207679_10193990 3300025945 Bacteria 1691
240 Ga0207679_10386885 3300025945 Bacteria 1227
241 Ga0207679_10923751 3300025945 Bacteria 799
242 Ga0207679_11801492 3300025945 Bacteria 559
243 Ga0207667_10244494 3300025949 Bacteria 1836
244 Ga0207651_10514057 3300025960 Bacteria 1037
245 Ga0207712_10363822 3300025961 Bacteria 1206
246 Ga0207668_10225969 3300025972 Bacteria 1506
247 Ga0207640_10262981 3300025981 Bacteria 1346
248 Ga0207640_10498139 3300025981 Bacteria 1014
249 Ga0207677_10018884 3300026023 Bacteria 4149
250 Ga0207677_10183106 3300026023 Bacteria 1649
251 Ga0207677_10330543 3300026023 Bacteria 1270
252 Ga0207677_11148722 3300026023 Bacteria 709
253 Ga0207703_10009211 3300026035 Bacteria 7766
254 Ga0207678_10007050 3300026067 Bacteria 9982
255 Ga0207678_10053611 3300026067 Bacteria 3475
256 Ga0207678_10181956 3300026067 Bacteria 1795
257 Ga0207678_11485311 3300026067 Bacteria 598
258 Ga0207708_10003796 3300026075 Bacteria 11142
259 Ga0207708_10046198 3300026075 Bacteria 3317
260 Ga0207708_10179847 3300026075 Bacteria 1679
261 Ga0207708_10263282 3300026075 Bacteria 1392
262 Ga0207708_10270858 3300026075 Bacteria 1373
263 Ga0207708_10398424 3300026075 Bacteria 1138
264 Ga0207702_10036029 3300026078 Bacteria 4137
265 Ga0207702_10649833 3300026078 Bacteria 1037
266 Ga0207641_10539933 3300026088 Bacteria 1136
267 Ga0207648_10328997 3300026089 Bacteria 1374
268 Ga0207648_11117100 3300026089 Bacteria 739
269 Ga0207676_10189021 3300026095 Bacteria 1811
270 Ga0207676_10495147 3300026095 Bacteria 1160
271 Ga0207676_12569734 3300026095 Bacteria 506
272 Ga0207674_10419292 3300026116 Bacteria 1293
273 Ga0207674_11094020 3300026116 Bacteria 766
274 Ga0207674_11822119 3300026116 Unclassified 575
275 Ga0207675_100273657 3300026118 Bacteria 1639
276 Ga0207675_100943685 3300026118 Bacteria 880
277 Ga0207675_102645590 3300026118 Bacteria 511
278 Ga0207683_10091184 3300026121 Bacteria 2714
279 Ga0207683_10183010 3300026121 Bacteria 1900
280 Ga0207698_10736414 3300026142 Bacteria 984
281 Ga0207698_11229936 3300026142 Bacteria 763
282 Ga0207428_11196577 3300027907 Bacteria 529
283 Ga0268266_10149068 3300028379 Bacteria 2106
284 Ga0268266_10542884 3300028379 Bacteria 1113
285 Ga0268265_10112397 3300028380 Bacteria 2227
286 Ga0307408_100022050 3300031548 Bacteria 4321
287 Ga0307408_101845131 3300031548 Bacteria 579
288 Ga0307405_10036007 3300031731 Bacteria 2962
289 Ga0307413_10013045 3300031824 Bacteria 4159
290 Ga0307413_10621240 3300031824 Bacteria 887
291 Ga0307413_11005187 3300031824 Bacteria 715
292 Ga0307410_10014611 3300031852 Bacteria 4626
293 Ga0307410_10242006 3300031852 Bacteria 1399
294 Ga0307410_10763600 3300031852 Unclassified 819
295 Ga0307410_11937327 3300031852 Bacteria 525
296 Ga0307406_10011212 3300031901 Bacteria 5080
297 Ga0307406_10154419 3300031901 Bacteria 1642
298 Ga0307407_10016290 3300031903 Bacteria 3697
299 Ga0307407_10120461 3300031903 Bacteria 1663
300 Ga0307407_11131409 3300031903 Bacteria 609
301 Ga0307412_10994015 3300031911 Bacteria 741
302 Ga0307409_100013452 3300031995 Bacteria 5268
303 Ga0307409_100333282 3300031995 Bacteria 1425
304 Ga0307409_100441510 3300031995 Bacteria 1254
305 Ga0307409_102106264 3300031995 Bacteria 594
306 Ga0307409_102115631 3300031995 Bacteria 592
307 Ga0307416_100020379 3300032002 Bacteria 4730
308 Ga0307416_100225494 3300032002 Bacteria 1802
309 Ga0307416_100383181 3300032002 Bacteria 1437
310 Ga0307416_102004206 3300032002 Bacteria 681
311 Ga0307414_10029513 3300032004 Bacteria 3570
312 Ga0307411_10067058 3300032005 Bacteria 2413
313 Ga0307411_10424226 3300032005 Bacteria 1106
314 Ga0307415_100080933 3300032126 Bacteria 2319
315 Ga0307415_100497344 3300032126 Bacteria 1065
316 Ga0307415_100889966 3300032126 Bacteria 820
317 Ga0395898_0104401 3300037466 Bacteria 2718
318 Ga0395898_0166828 3300037466 Bacteria 2106
319 Ga0395898_0694611 3300037466 Bacteria 959
320 Ga0436364_0528163 3300037853 Bacteria 9222
321 Ga0395901_0060414 3300038443 Bacteria 3944
322 Ga0395901_0345282 3300038443 Bacteria 1537
323 Ga0436365_0226989 3300039437 Bacteria 10155
324 Ga0436360_1111404 3300039438 Bacteria 698
325 Ga0436363_0230425 3300039450 Bacteria 32869
326 Ga0436362_0278040 3300039453 Unclassified 543
327 Ga0451807_0956944 3300041486 Bacteria 741
328 Ga0451851_0926579 3300041507 Bacteria 600
329 Ga0451853_0429023 3300041512 Bacteria 699
330 Ga0439458_0099091 3300042157 Bacteria 755
331 Ga0439460_0101183 3300042461 Bacteria 926
332 Ga0466966_0313249 3300044684 Bacteria 943
333 Ga0466957_0850635 3300044842 Bacteria 650
334 Ga0466957_1237567 3300044842 Bacteria 541
335 Ga0466960_0782007 3300044901 Bacteria 577
336 Ga0466959_0035526 3300045049 Bacteria 3685
337 Ga0466959_0216449 3300045049 Bacteria 1330
338 Ga0466958_0324527 3300045836 Bacteria 990
339 Ga0466967_0018603 3300045976 Bacteria 5559
340 Ga0466967_0365995 3300045976 Bacteria 1398
341 Ga0495596_0263737 3300046500 Bacteria 669
342 Ga0495643_0480282 3300046522 Bacteria 537
343 Ga0495644_0241763 3300046523 Bacteria 700
344 Ga0495589_0193510 3300046794 Bacteria 962
345 Ga0496100_0003353 3300048903 Bacteria 8345
346 Ga0496101_0001683 3300048904 Bacteria 13248
347 Ga0496101_0284558 3300048904 Bacteria 1293
348 Ga0496101_0378947 3300048904 Bacteria 1113
349 Ga0496102_0010319 3300048905 Bacteria 8034
350 Ga0496102_0015613 3300048905 Bacteria 6616
351 Ga0496102_1291160 3300048905 Bacteria 649
352 Ga0496103_0242750 3300048906 Bacteria 1159
353 Ga0496103_0244619 3300048906 Bacteria 1154
354 Ga0496104_0006392 3300048907 Bacteria 10363
355 Ga0496104_0311303 3300048907 Bacteria 1488
356 Ga0496105_0047971 3300048908 Bacteria 3525
357 Ga0496105_0201327 3300048908 Bacteria 1625
358 Ga0496106_0005410 3300048909 Bacteria 9442
359 Ga0496106_0028987 3300048909 Bacteria 4125
360 Ga0496106_0048363 3300048909 Bacteria 3203
361 Ga0496106_0561997 3300048909 Bacteria 915
362 Ga0496107_0007985 3300048910 Bacteria 7304
363 Ga0496107_0017415 3300048910 Bacteria 5055
364 Ga0496108_0001581 3300048911 Bacteria 18027
365 Ga0496108_0004771 3300048911 Bacteria 10931
366 Ga0496108_0275773 3300048911 Bacteria 1464
367 Ga0496108_0765082 3300048911 Bacteria 835
368 Ga0496108_1055877 3300048911 Bacteria 692
369 Ga0496108_1616168 3300048911 Bacteria 536
370 Ga0496109_0071904 3300048912 Bacteria 3177
371 Ga0496109_0087703 3300048912 Bacteria 2874
372 Ga0496109_0396339 3300048912 Bacteria 1304
373 Ga0496110_0006986 3300048913 Bacteria 8982
374 Ga0496110_0081010 3300048913 Bacteria 2894
375 Ga0496110_0127464 3300048913 Bacteria 2297
376 Ga0496110_0522754 3300048913 Bacteria 1079
377 Ga0496111_0002437 3300048914 Bacteria 11236
378 Ga0496111_0020357 3300048914 Bacteria 4619
379 Ga0496111_0194575 3300048914 Bacteria 1507
380 Ga0496112_0024355 3300048915 Bacteria 5793
381 Ga0496112_0097064 3300048915 Bacteria 2917
382 Ga0496112_0104586 3300048915 Bacteria 2801
383 Ga0496113_0005105 3300048916 Bacteria 8154
384 Ga0496113_0015075 3300048916 Bacteria 5296
385 Ga0496113_0078089 3300048916 Bacteria 2533
386 Ga0496114_0807058 3300048917 Bacteria 817
387 Ga0496115_0007214 3300048918 Bacteria 8167
388 Ga0501034_0517010 3300049571 Bacteria 1106
389 Ga0501040_0675014 3300049576 Bacteria 747
390 nmdc:mga0yw44_540309_c1 3300050492 Bacteria 791
391 nmdc:mga05p37_1484345_c1 3300050507 Bacteria 676
392 nmdc:mga08y16_468146_c1 3300050511 Bacteria 1283
393 nmdc:mga08y16_468732_c1 3300050511 Bacteria 1282
394 nmdc:mga08y16_702963_c1 3300050511 Bacteria 1010
395 nmdc:mga0n895_271897_c1 3300050512 Bacteria 1719
396 nmdc:mga0rr50_241515_c1 3300050513 Bacteria 1497
397 nmdc:mga08x19_436233_c1 3300050514 Bacteria 921
398 nmdc:mga0a205_217906_c1 3300050515 Bacteria 1795
399 Ga0500556_0000497 3300053104 Bacteria 27294
400 Ga0500616_0007805 3300053153 Bacteria 6745
401 Ga0587073_0284482 3300059492 Bacteria 532
402 Ga0587076_138464 3300059645 Bacteria 580
403 Ga0466962_0083324 3300061719 Bacteria 1530
404 Ga0395899_0728400
405 JGI25406J46586_10012889
406 JGI25407J50210_10073509
407 Ga0070676_10107845
408 Ga0070683_100042194
409 Ga0070683_100075359
410 Ga0070683_100549784
411 Ga0070683_100559921
412 Ga0070683_100867624
413 Ga0070683_101101851
414 Ga0070683_102074566
415 Ga0070670_101956483
416 Ga0068869_100178472
417 Ga0068869_101270508
418 Ga0070682_100002413
419 Ga0070682_100322039
420 Ga0068868_100156992
421 Ga0070660_100196962
422 Ga0070660_100471409
423 Ga0070660_100891409
424 Ga0070660_101592989
425 Ga0070689_101121246
426 Ga0070691_10082899
427 Ga0070691_10548238
428 Ga0070687_100951883
429 Ga0070687_101079938
430 Ga0070661_100245806
431 Ga0070692_10093753
432 Ga0070668_100086537
433 Ga0070668_100134278
434 Ga0070669_100178261
435 Ga0070669_100222961
436 Ga0070669_101071665
437 Ga0070675_100051187
438 Ga0070675_100701786
439 Ga0070671_100076920
440 Ga0070671_100546818
441 Ga0070674_100184772
442 Ga0070673_100728227
443 Ga0070688_100308498
444 Ga0070659_100074207
445 Ga0070659_100191823
446 Ga0070659_100246109
447 Ga0070709_10295676
448 Ga0070714_100805644
449 Ga0070713_100861869
450 Ga0070701_10178274
451 Ga0070700_100011939
452 Ga0070700_100073873
453 Ga0070700_100146276
454 Ga0070663_100007848
455 Ga0070663_100191426
456 Ga0070663_100473641
457 Ga0070663_100962833
458 Ga0070663_101180280
459 Ga0070662_100041279
460 Ga0070662_100041307
461 Ga0070662_101959280
462 Ga0068867_100352423
463 Ga0068867_101166072
464 Ga0070685_11220039
465 Ga0070684_100004339
466 Ga0070684_100236981
467 Ga0070684_101382333
468 Ga0070684_101735808
469 Ga0070686_100213647
470 Ga0070693_100036334
471 Ga0070665_100008022
472 Ga0070665_100647141
473 Ga0070704_100147003
474 Ga0070704_101556277
475 Ga0068855_100284986
476 Ga0070664_100387460
477 Ga0070664_102023566
478 Ga0068857_100650119
479 Ga0068857_100888507
480 Ga0068854_100029127
481 Ga0068854_100217206
482 Ga0068854_100635105
483 Ga0068854_100859493
484 Ga0068856_100383720
485 Ga0068856_100525548
486 Ga0070702_100005959
487 Ga0068852_100078904
488 Ga0068859_100084911
489 Ga0068859_100644044
490 Ga0068864_100048348
491 Ga0068864_102553049
492 Ga0068866_10382350
493 Ga0068861_100078415
494 Ga0068861_100151647
495 Ga0068861_100408230
496 Ga0068861_100536197
497 Ga0068870_10174415
498 Ga0068870_10239928
499 Ga0068870_10509713
500 Ga0068863_100342353
501 Ga0068858_100210358
502 Ga0068858_100288921
503 Ga0068860_100071530
504 Ga0068860_102529494
505 Ga0068862_100582704
506 Ga0068862_101881338
507 Ga0081538_10008845
508 Ga0081538_10013845
509 Ga0081538_10032297
510 Ga0081540_1002225
511 Ga0081540_1027445
512 Ga0081539_10034989
513 Ga0070717_10026711
514 Ga0070717_10098098
515 Ga0075432_10216910
516 Ga0075432_10499130
517 Ga0070712_100006571
518 Ga0068871_101042056
519 Ga0075428_100792369
520 Ga0075431_100190860
521 Ga0075433_10288750
522 Ga0068865_100148467
523 Ga0068865_100199460
524 Ga0068865_100385015
525 Ga0068865_100846722
526 Ga0075436_100227798
527 Ga0097620_100084910
528 Ga0097620_100644039
529 Ga0111539_10523770
530 Ga0105245_10007024
531 Ga0105245_10041901
532 Ga0105245_10368480
533 Ga0105245_10738328
534 Ga0105245_10901463
535 Ga0105247_10137932
536 Ga0114129_11480520
537 Ga0114129_11633435
538 Ga0105243_10295495
539 Ga0105243_10322084
540 Ga0105243_10472669
541 Ga0105243_10567537
542 Ga0105243_10672918
543 Ga0105242_10422250
544 Ga0105242_10468636
545 Ga0105248_10016268
546 Ga0105248_10221766
547 Ga0105248_11176896
548 Ga0105237_10396284
549 Ga0105237_10830197
550 Ga0105238_10858612
551 Ga0105238_12193597
552 Ga0105249_10196726
553 Ga0105249_10269829
554 Ga0105249_10922964
555 Ga0105249_11110321
556 Ga0105239_10020705
557 Ga0105239_10672027
558 Ga0105239_11035123
559 Ga0105239_12195581
560 Ga0105246_10061412
561 Ga0105246_11320655
562 Ga0105246_11601735
563 Ga0157369_10133563
564 Ga0157374_10001031
565 Ga0157374_11626820
566 Ga0157378_10368109
567 Ga0157378_10394737
568 Ga0163162_10125693
569 Ga0163162_12777018
570 Ga0157372_10039938
571 Ga0157372_10528695
572 Ga0157375_11449675
573 Ga0163163_10230670
574 Ga0163163_10357510
575 Ga0157380_10071880
576 Ga0157380_11744428
577 Ga0182008_10137522
578 Ga0157377_10001906
579 Ga0157377_10511269
580 Ga0157376_10527510
581 Ga0213874_10024128
582 Ga0213875_10020301
583 Ga0207656_10263983
584 Ga0207642_10026784
585 Ga0207642_10092351
586 Ga0207642_10375231
587 Ga0207688_10000219
588 Ga0207688_10012555
589 Ga0207688_10015767
590 Ga0207705_10162428
591 Ga0207705_11438185
592 Ga0207671_10979669
593 Ga0207693_10035123
594 Ga0207693_10341594
595 Ga0207662_10304997
596 Ga0207662_11024241
597 Ga0207657_10230657
598 Ga0207657_10311875
599 Ga0207657_10404007
600 Ga0207657_10521139
601 Ga0207657_11201603
602 Ga0207650_10243842
603 Ga0207659_10162792
604 Ga0207659_10727509
605 Ga0207687_10050083
606 Ga0207687_10243110
607 Ga0207687_10293311
608 Ga0207687_11365060
609 Ga0207644_11539582
610 Ga0207690_10034888
611 Ga0207690_10319816
612 Ga0207690_10659104
613 Ga0207690_11066163
614 Ga0207706_10024118
615 Ga0207706_10042375
616 Ga0207706_10976054
617 Ga0207686_10433308
618 Ga0207686_10433967
619 Ga0207709_10282171
620 Ga0207709_10873218
621 Ga0207709_11027358
622 Ga0207669_10028247
623 Ga0207669_10254418
624 Ga0207669_10432339
625 Ga0207669_10866412
626 Ga0207704_10069833
627 Ga0207704_10179083
628 Ga0207704_10238637
629 Ga0207704_11455951
630 Ga0207665_10104887
631 Ga0207691_10265681
632 Ga0207689_10102856
633 Ga0207689_10350654
634 Ga0207661_10078996
635 Ga0207661_10195521
636 Ga0207661_10488067
637 Ga0207661_10549316
638 Ga0207661_11618839
639 Ga0207661_11783787
640 Ga0207679_10155254
641 Ga0207679_10186858
642 Ga0207679_10193990
643 Ga0207679_10386885
644 Ga0207679_10923751
645 Ga0207679_11801492
646 Ga0207667_10244494
647 Ga0207651_10514057
648 Ga0207712_10363822
649 Ga0207668_10225969
650 Ga0207640_10262981
651 Ga0207640_10498139
652 Ga0207677_10018884
653 Ga0207677_10183106
654 Ga0207677_10330543
655 Ga0207677_11148722
656 Ga0207703_10009211
657 Ga0207678_10007050
658 Ga0207678_10053611
659 Ga0207678_10181956
660 Ga0207678_11485311
661 Ga0207708_10003796
662 Ga0207708_10046198
663 Ga0207708_10179847
664 Ga0207708_10263282
665 Ga0207708_10270858
666 Ga0207708_10398424
667 Ga0207702_10036029
668 Ga0207702_10649833
669 Ga0207641_10539933
670 Ga0207648_10328997
671 Ga0207648_11117100
672 Ga0207676_10189021
673 Ga0207676_10495147
674 Ga0207676_12569734
675 Ga0207674_10419292
676 Ga0207674_11094020
677 Ga0207674_11822119
678 Ga0207675_100273657
679 Ga0207675_100943685
680 Ga0207675_102645590
681 Ga0207683_10091184
682 Ga0207683_10183010
683 Ga0207698_10736414
684 Ga0207698_11229936
685 Ga0207428_11196577
686 Ga0268266_10149068
687 Ga0268266_10542884
688 Ga0268265_10112397
689 Ga0307408_100022050
690 Ga0307408_101845131
691 Ga0307405_10036007
692 Ga0307413_10013045
693 Ga0307413_10621240
694 Ga0307413_11005187
695 Ga0307410_10014611
696 Ga0307410_10242006
697 Ga0307410_10763600
698 Ga0307410_11937327
699 Ga0307406_10011212
700 Ga0307406_10154419
701 Ga0307407_10016290
702 Ga0307407_10120461
703 Ga0307407_11131409
704 Ga0307412_10994015
705 Ga0307409_100013452
706 Ga0307409_100333282
707 Ga0307409_100441510
708 Ga0307409_102106264
709 Ga0307409_102115631
710 Ga0307416_100020379
711 Ga0307416_100225494
712 Ga0307416_100383181
713 Ga0307416_102004206
714 Ga0307414_10029513
715 Ga0307411_10067058
716 Ga0307411_10424226
717 Ga0307415_100080933
718 Ga0307415_100497344
719 Ga0307415_100889966
720 Ga0395898_0104401
721 Ga0395898_0166828
722 Ga0395898_0694611
723 Ga0436364_0528163
724 Ga0395901_0060414
725 Ga0395901_0345282
726 Ga0436365_0226989
727 Ga0436360_1111404
728 Ga0436363_0230425
729 Ga0436362_0278040
730 Ga0451807_0956944
731 Ga0451851_0926579
732 Ga0451853_0429023
733 Ga0439458_0099091
734 Ga0439460_0101183
735 Ga0466966_0313249
736 Ga0466957_0850635
737 Ga0466957_1237567
738 Ga0466960_0782007
739 Ga0466959_0035526
740 Ga0466959_0216449
741 Ga0466958_0324527
742 Ga0466967_0018603
743 Ga0466967_0365995
744 Ga0495596_0263737
745 Ga0495643_0480282
746 Ga0495644_0241763
747 Ga0495589_0193510
748 Ga0496100_0003353
749 Ga0496101_0001683
750 Ga0496101_0284558
751 Ga0496101_0378947
752 Ga0496102_0010319
753 Ga0496102_0015613
754 Ga0496102_1291160
755 Ga0496103_0242750
756 Ga0496103_0244619
757 Ga0496104_0006392
758 Ga0496104_0311303
759 Ga0496105_0047971
760 Ga0496105_0201327
761 Ga0496106_0005410
762 Ga0496106_0028987
763 Ga0496106_0048363
764 Ga0496106_0561997
765 Ga0496107_0007985
766 Ga0496107_0017415
767 Ga0496108_0001581
768 Ga0496108_0004771
769 Ga0496108_0275773
770 Ga0496108_0765082
771 Ga0496108_1055877
772 Ga0496108_1616168
773 Ga0496109_0071904
774 Ga0496109_0087703
775 Ga0496109_0396339
776 Ga0496110_0006986
777 Ga0496110_0081010
778 Ga0496110_0127464
779 Ga0496110_0522754
780 Ga0496111_0002437
781 Ga0496111_0020357
782 Ga0496111_0194575
783 Ga0496112_0024355
784 Ga0496112_0097064
785 Ga0496112_0104586
786 Ga0496113_0005105
787 Ga0496113_0015075
788 Ga0496113_0078089
789 Ga0496114_0807058
790 Ga0496115_0007214
791 Ga0501034_0517010
792 Ga0501040_0675014
793 nmdc:mga0yw44_540309_c1
794 nmdc:mga05p37_1484345_c1
795 nmdc:mga08y16_468146_c1
796 nmdc:mga08y16_468732_c1
797 nmdc:mga08y16_702963_c1
798 nmdc:mga0n895_271897_c1
799 nmdc:mga0rr50_241515_c1
800 nmdc:mga08x19_436233_c1
801 nmdc:mga0a205_217906_c1
802 Ga0500556_0000497
803 Ga0500616_0007805
804 Ga0587073_0284482
805 Ga0587076_138464
806 Ga0466962_0083324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

132

0.85

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

121

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.8713 4 127
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.8712 4 127
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8695 3 127
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.8626 3 128
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8625 3 127
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8695 3 127 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8632 1 124 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8625 3 127 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8599 3 125 3.10.180.10
af_A0A1D6H4U4_100_218_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8374 14 125 3.10.180.10
ID Description Score Start End GO Terms
AF-H0E166-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9696 1 137 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A7V9Q1B7-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9325 1 125 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A4Q3HTR6-F1-model_v4 Lactoylglutathione lyase 0.9225 2 77 GO:0016829
AF-A0A2E6GJ95-F1-model_v4 Lactoylglutathione lyase (EC 4.4.1.5) (Glyoxalase I) 0.9147 2 124 GO:0004462
GO:0005737
GO:0019243
GO:0046872
AF-A0A7V9Q1B7-F1-model_v4 Aldoketomutase (Ketone-aldehyde mutase) (Methylglyoxalase) (S-D-lactoylglutathione methylglyoxal lyase) 0.9112 1 125 GO:0004462
GO:0005737
GO:0019243
GO:0046872

Map