F435412

General Info

Members Datasets Scaffolds Average Seq Length
403 211 806 156

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10931274|Ga0207648_109312741
Length 178
Sequence VYDAAGPRGKAGRNAVVTKPLWAPWRLEYITQADEQVGCVFCDEAAGVLDPDDSLLVHKGDTAIALLNKYPYSSGHLMVAPHRHVGALSDLTGAEVLEIHGLAVLAIEALGIYGPAGYNLGWNLGRVAGAGIADHIHLHVVPRWSGDTNFMPVLADVKVIPEHLLDTRDRLREAWANQ

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.94
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10931274 3300026089 Bacteria 812
2 Ga0070658_10014564 3300005327 Bacteria 6311
3 Ga0070658_10035897 3300005327 Bacteria 3994
4 Ga0070658_10364326 3300005327 Bacteria 1238
5 Ga0070683_100107115 3300005329 Bacteria 2635
6 Ga0070683_101706800 3300005329 Unclassified 605
7 Ga0070690_100181696 3300005330 Bacteria 1454
8 Ga0070690_100471722 3300005330 Archaea 934
9 Ga0070680_100072348 3300005336 Bacteria 2833
10 Ga0070680_100290122 3300005336 Unclassified 1387
11 Ga0070680_100341802 3300005336 Bacteria 1272
12 Ga0070682_101181789 3300005337 Bacteria 645
13 Ga0068868_100056537 3300005338 Bacteria 3098
14 Ga0068868_100508459 3300005338 Bacteria 1056
15 Ga0070660_100002027 3300005339 Bacteria 13965
16 Ga0070660_100004217 3300005339 Bacteria 9924
17 Ga0070660_100165611 3300005339 Bacteria 1783
18 Ga0070660_100780837 3300005339 Unclassified 803
19 Ga0070661_100013126 3300005344 Bacteria 5813
20 Ga0070661_100197637 3300005344 Bacteria 1535
21 Ga0070668_100795556 3300005347 Archaea 840
22 Ga0070675_100065483 3300005354 Bacteria 3005
23 Ga0070675_100613047 3300005354 Bacteria 987
24 Ga0070671_100059695 3300005355 Bacteria 3174
25 Ga0070673_100676499 3300005364 Bacteria 946
26 Ga0070673_102051361 3300005364 Bacteria 543
27 Ga0070659_100010385 3300005366 Bacteria 6848
28 Ga0070659_100632401 3300005366 Bacteria 922
29 Ga0070709_10460131 3300005434 Unclassified 960
30 Ga0070714_100194665 3300005435 Bacteria 1852
31 Ga0070711_100009922 3300005439 Bacteria 5873
32 Ga0070700_100339436 3300005441 Bacteria 1110
33 Ga0070694_100141276 3300005444 Bacteria 1749
34 Ga0070708_100172084 3300005445 Bacteria 2022
35 Ga0070708_100856282 3300005445 Bacteria 854
36 Ga0070678_101070538 3300005456 Bacteria 743
37 Ga0070681_10020430 3300005458 Bacteria 6637
38 Ga0070681_10022772 3300005458 Bacteria 6296
39 Ga0070681_10030413 3300005458 Bacteria 5418
40 Ga0070681_10042811 3300005458 Bacteria 4537
41 Ga0070706_100314906 3300005467 Bacteria 1460
42 Ga0070699_100144502 3300005518 Bacteria 2102
43 Ga0070679_100033639 3300005530 Bacteria 5076
44 Ga0070679_100093873 3300005530 Bacteria 2987
45 Ga0070679_100137254 3300005530 Bacteria 2426
46 Ga0070679_100199529 3300005530 Unclassified 1967
47 Ga0070679_100329494 3300005530 Bacteria 1475
48 Ga0070679_100700448 3300005530 Unclassified 956
49 Ga0070679_100901243 3300005530 Bacteria 828
50 Ga0070684_100066557 3300005535 Unclassified 3163
51 Ga0070684_100256792 3300005535 Archaea 1598
52 Ga0070684_100292505 3300005535 Bacteria 1494
53 Ga0068853_100193969 3300005539 Bacteria 1846
54 Ga0070696_100173406 3300005546 Unclassified 1596
55 Ga0070696_100799534 3300005546 Bacteria 776
56 Ga0070665_100027725 3300005548 Bacteria 5702
57 Ga0070665_100148252 3300005548 Bacteria 2349
58 Ga0070665_100231798 3300005548 Bacteria 1847
59 Ga0068855_100062357 3300005563 Bacteria 4352
60 Ga0068855_100154720 3300005563 Unclassified 2606
61 Ga0068855_100157044 3300005563 Unclassified 2584
62 Ga0068855_100178816 3300005563 Bacteria 2399
63 Ga0070664_100639972 3300005564 Archaea 988
64 Ga0068857_100611853 3300005577 Bacteria 1030
65 Ga0068857_100853280 3300005577 Unclassified 871
66 Ga0068856_100037071 3300005614 Bacteria 4783
67 Ga0068856_100087815 3300005614 Bacteria 3092
68 Ga0068852_100134758 3300005616 Bacteria 2279
69 Ga0068852_100187777 3300005616 Bacteria 1948
70 Ga0068852_100675438 3300005616 Unclassified 1042
71 Ga0068861_101424193 3300005719 Bacteria 678
72 Ga0068851_10168339 3300005834 Bacteria 1208
73 Ga0068870_10266823 3300005840 Bacteria 1068
74 Ga0068858_100639488 3300005842 Bacteria 1033
75 Ga0070717_10509763 3300006028 Bacteria 1088
76 Ga0070712_100667863 3300006175 Unclassified 884
77 Ga0097621_100244485 3300006237 Bacteria 1570
78 Ga0097621_100265079 3300006237 Bacteria 1508
79 Ga0075428_101027034 3300006844 Bacteria 872
80 Ga0075430_100240435 3300006846 Bacteria 1500
81 Ga0075434_100034876 3300006871 Bacteria 4972
82 Ga0075434_100783530 3300006871 Bacteria 970
83 Ga0075435_100023205 3300007076 Bacteria 4794
84 Ga0075435_100488581 3300007076 Bacteria 1064
85 Ga0105240_10177073 3300009093 Unclassified 2521
86 Ga0105240_10637210 3300009093 Bacteria 1170
87 Ga0105240_11078875 3300009093 Unclassified 855
88 Ga0105240_11393288 3300009093 Bacteria 737
89 Ga0105245_10503572 3300009098 Bacteria 1227
90 Ga0105245_10999798 3300009098 Bacteria 881
91 Ga0105245_11063684 3300009098 Bacteria 855
92 Ga0105247_10129535 3300009101 Bacteria 1643
93 Ga0114129_10583088 3300009147 Bacteria 1451
94 Ga0114129_11231142 3300009147 Bacteria 931
95 Ga0105243_10730060 3300009148 Archaea 969
96 Ga0105241_10183128 3300009174 Unclassified 1739
97 Ga0105241_10721547 3300009174 Bacteria 912
98 Ga0105241_11061956 3300009174 Bacteria 761
99 Ga0105242_10126052 3300009176 Bacteria 2204
100 Ga0105248_10014722 3300009177 Bacteria 8611
101 Ga0105248_10911081 3300009177 Bacteria 993
102 Ga0105237_10056224 3300009545 Bacteria 3939
103 Ga0105237_10343807 3300009545 Unclassified 1496
104 Ga0105238_10009715 3300009551 Bacteria 9633
105 Ga0105239_10330514 3300010375 Bacteria 1719
106 Ga0157373_10420881 3300013100 Unclassified 959
107 Ga0157373_10429729 3300013100 Unclassified 949
108 Ga0157371_10291012 3300013102 Bacteria 1181
109 Ga0157370_10080941 3300013104 Plasmid 3057
110 Ga0157370_10106398 3300013104 Bacteria 2625
111 Ga0157370_11148405 3300013104 Bacteria 701
112 Ga0157369_10074516 3300013105 Bacteria 3640
113 Ga0157369_10160718 3300013105 Bacteria 2371
114 Ga0157369_11737333 3300013105 Unclassified 634
115 Ga0157374_10029024 3300013296 Bacteria 5003
116 Ga0157374_11925645 3300013296 Unclassified 617
117 Ga0157378_10070935 3300013297 Bacteria 3128
118 Ga0157378_11708143 3300013297 Bacteria 677
119 Ga0163162_10025002 3300013306 Bacteria 5900
120 Ga0157372_10013604 3300013307 Bacteria 8697
121 Ga0157372_10122483 3300013307 Unclassified 2988
122 Ga0157372_10581271 3300013307 Bacteria 1306
123 Ga0157372_10952573 3300013307 Bacteria 995
124 Ga0157375_11235615 3300013308 Bacteria 877
125 Ga0157380_10141615 3300014326 Bacteria 2067
126 Ga0157380_11021738 3300014326 Bacteria 861
127 Ga0157377_10084274 3300014745 Bacteria 1864
128 Ga0157377_10085254 3300014745 Bacteria 1854
129 Ga0157377_10373657 3300014745 Bacteria 963
130 Ga0157377_11193329 3300014745 Bacteria 589
131 Ga0157376_10136965 3300014969 Bacteria 2192
132 Ga0182007_10138903 3300015262 Bacteria 821
133 Ga0197907_10644306 3300020069 Unclassified 942
134 Ga0206350_10862815 3300020080 Bacteria 790
135 Ga0206354_10743337 3300020081 Bacteria 1439
136 Ga0206354_11517536 3300020081 Unclassified 1760
137 Ga0206353_10717111 3300020082 Bacteria 584
138 Ga0206353_12004710 3300020082 Bacteria 2204
139 Ga0213874_10222148 3300021377 Bacteria 687
140 Ga0213876_10149732 3300021384 Archaea 1241
141 Ga0224712_10399667 3300022467 Bacteria 655
142 Ga0207656_10395499 3300025321 Bacteria 694
143 Ga0207643_10158948 3300025908 Bacteria 1359
144 Ga0207705_10003034 3300025909 Bacteria 12807
145 Ga0207654_10608858 3300025911 Bacteria 780
146 Ga0207707_10011540 3300025912 Bacteria 7693
147 Ga0207707_10014835 3300025912 Bacteria 6786
148 Ga0207707_10034215 3300025912 Bacteria 4446
149 Ga0207707_10240701 3300025912 Bacteria 1573
150 Ga0207707_10337297 3300025912 Bacteria 1300
151 Ga0207695_10256088 3300025913 Bacteria 1649
152 Ga0207695_10313019 3300025913 Bacteria 1460
153 Ga0207671_10191744 3300025914 Bacteria 1594
154 Ga0207693_10463357 3300025915 Bacteria 990
155 Ga0207663_10013600 3300025916 Bacteria 4427
156 Ga0207660_10038669 3300025917 Bacteria 3331
157 Ga0207660_10056748 3300025917 Bacteria 2803
158 Ga0207657_10002977 3300025919 Bacteria 18168
159 Ga0207657_10005676 3300025919 Bacteria 13017
160 Ga0207657_10018820 3300025919 Bacteria 6577
161 Ga0207657_11014337 3300025919 Bacteria 636
162 Ga0207649_10015486 3300025920 Bacteria 4285
163 Ga0207649_10040814 3300025920 Bacteria 2823
164 Ga0207652_10021733 3300025921 Bacteria 5298
165 Ga0207652_10039938 3300025921 Bacteria 3984
166 Ga0207652_10084314 3300025921 Bacteria 2784
167 Ga0207652_10232061 3300025921 Unclassified 1663
168 Ga0207652_10935497 3300025921 Unclassified 764
169 Ga0207694_10016875 3300025924 Bacteria 5515
170 Ga0207650_10077243 3300025925 Bacteria 2517
171 Ga0207659_10051020 3300025926 Bacteria 2940
172 Ga0207659_10219554 3300025926 Bacteria 1528
173 Ga0207687_10143746 3300025927 Bacteria 1813
174 Ga0207687_10377035 3300025927 Bacteria 1161
175 Ga0207687_11237758 3300025927 Bacteria 642
176 Ga0207664_10228463 3300025929 Bacteria 1617
177 Ga0207664_10457693 3300025929 Bacteria 1139
178 Ga0207664_10771853 3300025929 Unclassified 865
179 Ga0207690_10037157 3300025932 Bacteria 3160
180 Ga0207690_10298300 3300025932 Bacteria 1260
181 Ga0207690_10418397 3300025932 Bacteria 1072
182 Ga0207690_10657770 3300025932 Unclassified 859
183 Ga0207706_10162891 3300025933 Bacteria 1960
184 Ga0207706_10749011 3300025933 Bacteria 832
185 Ga0207669_10187549 3300025937 Bacteria 1489
186 Ga0207704_10204513 3300025938 Bacteria 1448
187 Ga0207665_10203799 3300025939 Bacteria 1442
188 Ga0207691_10345758 3300025940 Bacteria 1273
189 Ga0207711_10006698 3300025941 Bacteria 9692
190 Ga0207661_10068132 3300025944 Bacteria 2897
191 Ga0207661_10628765 3300025944 Unclassified 986
192 Ga0207679_10424968 3300025945 Archaea 1173
193 Ga0207667_10039166 3300025949 Bacteria 5053
194 Ga0207667_10088718 3300025949 Bacteria 3198
195 Ga0207667_10127923 3300025949 Unclassified 2616
196 Ga0207667_10498544 3300025949 Bacteria 1235
197 Ga0207677_10633508 3300026023 Archaea 942
198 Ga0207677_11055670 3300026023 Bacteria 739
199 Ga0207639_10206893 3300026041 Bacteria 1687
200 Ga0207678_10887828 3300026067 Unclassified 788
201 Ga0207702_10315718 3300026078 Unclassified 1487
202 Ga0207702_10341501 3300026078 Bacteria 1430
203 Ga0207674_10014089 3300026116 Bacteria 8834
204 Ga0207674_10022883 3300026116 Bacteria 6705
205 Ga0207683_10095502 3300026121 Bacteria 2650
206 Ga0207683_10559705 3300026121 Bacteria 1057
207 Ga0207683_10568230 3300026121 Bacteria 1049
208 Ga0207698_10037084 3300026142 Bacteria 3586
209 Ga0207698_10672145 3300026142 Unclassified 1028
210 Ga0268266_10022082 3300028379 Bacteria 5425
211 Ga0268266_10214642 3300028379 Bacteria 1766
212 Ga0265322_10057920 3300028654 Bacteria 1099
213 Ga0265338_10090537 3300028800 Bacteria 2531
214 Ga0265330_10063932 3300031235 Bacteria 1599
215 Ga0265328_10261378 3300031239 Bacteria 664
216 Ga0265320_10388119 3300031240 Bacteria 617
217 Ga0265331_10074593 3300031250 Bacteria 1583
218 Ga0265314_10061931 3300031711 Bacteria 2545
219 Ga0307410_10621062 3300031852 Bacteria 903
220 Ga0307406_10829084 3300031901 Bacteria 782
221 Ga0307412_10721577 3300031911 Bacteria 858
222 Ga0307409_100036575 3300031995 Bacteria 3611
223 Ga0307409_100111283 3300031995 Bacteria 2297
224 Ga0307409_100230916 3300031995 Bacteria 1677
225 Ga0307416_100031834 3300032002 Bacteria 3976
226 Ga0307416_100550109 3300032002 Bacteria 1227
227 Ga0307415_100374579 3300032126 Bacteria 1207
228 Ga0373942_0098986 3300035207 Bacteria 889
229 Ga0373947_0001020 3300035725 Bacteria 17119
230 Ga0395900_0009702 3300037418 Bacteria 9865
231 Ga0395900_0281511 3300037418 Bacteria 1655
232 Ga0395900_0330083 3300037418 Bacteria 1503
233 Ga0395900_0342897 3300037418 Bacteria 1469
234 Ga0395898_0001107 3300037466 Bacteria 41584
235 Ga0395898_0067943 3300037466 Bacteria 3450
236 Ga0395898_0069700 3300037466 Bacteria 3402
237 Ga0395898_0986048 3300037466 Unclassified 779
238 Ga0395905_0012023 3300037471 Bacteria 8347
239 Ga0395901_0002293 3300038443 Bacteria 19499
240 Ga0395901_0016940 3300038443 Bacteria 7428
241 Ga0395901_0059814 3300038443 Bacteria 3964
242 Ga0395901_0107445 3300038443 Bacteria 2929
243 Ga0395901_0670759 3300038443 Bacteria 1038
244 Ga0395901_1583915 3300038443 Bacteria 609
245 Ga0436365_0267621 3300039437 Bacteria 1593
246 Ga0436365_1426153 3300039437 Bacteria 1306
247 Ga0436365_1934096 3300039437 Bacteria 1724
248 Ga0436363_0735791 3300039450 Bacteria 842
249 Ga0436363_1703964 3300039450 Bacteria 2712
250 Ga0450920_052568 3300042122 Bacteria 818
251 Ga0466972_0631855 3300044658 Bacteria 507
252 Ga0466965_0135173 3300044683 Bacteria 1281
253 Ga0466965_0217360 3300044683 Bacteria 1018
254 Ga0466966_0006608 3300044684 Bacteria 7677
255 Ga0466966_0011751 3300044684 Bacteria 5804
256 Ga0466966_0259511 3300044684 Bacteria 1046
257 Ga0466961_0031607 3300044693 Bacteria 3403
258 Ga0466961_0082420 3300044693 Bacteria 2035
259 Ga0466961_0085550 3300044693 Bacteria 1994
260 Ga0466961_0113079 3300044693 Bacteria 1707
261 Ga0466963_0000010 3300044694 Bacteria 68690
262 Ga0466963_0027479 3300044694 Bacteria 3644
263 Ga0466963_0035941 3300044694 Bacteria 3228
264 Ga0466963_0037969 3300044694 Bacteria 3148
265 Ga0466963_0134109 3300044694 Bacteria 1712
266 Ga0466963_0157728 3300044694 Bacteria 1578
267 Ga0466963_0301249 3300044694 Bacteria 1127
268 Ga0466964_0021866 3300044706 Unclassified 2476
269 Ga0466964_0126422 3300044706 Bacteria 1159
270 Ga0466964_0383661 3300044706 Bacteria 730
271 Ga0466964_0574400 3300044706 Bacteria 615
272 Ga0466964_0742570 3300044706 Bacteria 550
273 Ga0466971_0000509 3300044719 Bacteria 15309
274 Ga0466971_0422909 3300044719 Bacteria 651
275 Ga0466968_0059524 3300044735 Bacteria 1645
276 Ga0466970_0096693 3300044765 Bacteria 1606
277 Ga0466970_0097761 3300044765 Bacteria 1597
278 Ga0466957_0003780 3300044842 Bacteria 8362
279 Ga0466957_0046255 3300044842 Bacteria 2642
280 Ga0466957_0086295 3300044842 Bacteria 1961
281 Ga0466957_0110275 3300044842 Bacteria 1744
282 Ga0466957_0379738 3300044842 Bacteria 963
283 Ga0466960_0353733 3300044901 Bacteria 838
284 Ga0466959_0090797 3300045049 Bacteria 2194
285 Ga0466959_0194941 3300045049 Bacteria 1412
286 Ga0466959_0343991 3300045049 Bacteria 1017
287 Ga0466958_0046779 3300045836 Bacteria 2611
288 Ga0466958_0323475 3300045836 Bacteria 991
289 Ga0466958_0348998 3300045836 Bacteria 952
290 Ga0466967_0005512 3300045976 Bacteria 8782
291 Ga0466967_0008373 3300045976 Bacteria 7569
292 Ga0466967_0020214 3300045976 Bacteria 5375
293 Ga0466967_0026713 3300045976 Bacteria 4787
294 Ga0466967_0029068 3300045976 Bacteria 4622
295 Ga0466967_0052309 3300045976 Bacteria 3584
296 Ga0466967_0072513 3300045976 Bacteria 3086
297 Ga0466967_0093790 3300045976 Bacteria 2732
298 Ga0466967_0288682 3300045976 Bacteria 1575
299 Ga0466967_0293271 3300045976 Bacteria 1563
300 Ga0466967_0740937 3300045976 Bacteria 974
301 Ga0466967_0760389 3300045976 Bacteria 961
302 Ga0466967_1689373 3300045976 Bacteria 630
303 Ga0495592_0172473 3300046454 Bacteria 1480
304 Ga0495641_0019078 3300046461 Bacteria 3521
305 Ga0495607_0273213 3300046501 Unclassified 805
306 Ga0495630_0375340 3300046517 Bacteria 1089
307 Ga0495621_0258606 3300046539 Bacteria 713
308 Ga0495613_0328516 3300046689 Bacteria 1054
309 Ga0495615_0212094 3300048090 Bacteria 601
310 Ga0496100_0027588 3300048903 Bacteria 3493
311 Ga0496100_0093899 3300048903 Archaea 2053
312 Ga0496100_0205260 3300048903 Bacteria 1438
313 Ga0496101_0008249 3300048904 Bacteria 6801
314 Ga0496101_0012553 3300048904 Bacteria 5655
315 Ga0496101_0026673 3300048904 Bacteria 4018
316 Ga0496102_0047089 3300048905 Bacteria 3917
317 Ga0496102_1747876 3300048905 Archaea 539
318 Ga0496103_0070672 3300048906 Bacteria 2184
319 Ga0496103_0302848 3300048906 Unclassified 1028
320 Ga0496104_0008929 3300048907 Bacteria 8908
321 Ga0496105_0037676 3300048908 Bacteria 3981
322 Ga0496106_0011265 3300048909 Bacteria 6619
323 Ga0496106_0016266 3300048909 Bacteria 5504
324 Ga0496106_0087301 3300048909 Bacteria 2403
325 Ga0496107_0009503 3300048910 Bacteria 6746
326 Ga0496107_0166713 3300048910 Bacteria 1633
327 Ga0496107_0833016 3300048910 Archaea 674
328 Ga0496108_0201023 3300048911 Bacteria 1729
329 Ga0496109_0013623 3300048912 Bacteria 7062
330 Ga0496110_0032503 3300048913 Bacteria 4507
331 Ga0496111_0010808 3300048914 Bacteria 6135
332 Ga0496112_0010171 3300048915 Bacteria 8524
333 Ga0496112_0199520 3300048915 Bacteria 1960
334 Ga0496112_0579176 3300048915 Bacteria 1055
335 Ga0496112_0594708 3300048915 Bacteria 1038
336 Ga0496112_1277113 3300048915 Unclassified 650
337 Ga0496113_0107365 3300048916 Bacteria 2169
338 Ga0496113_0339754 3300048916 Bacteria 1204
339 Ga0496114_0000778 3300048917 Bacteria 23790
340 Ga0496114_0043966 3300048917 Bacteria 3704
341 Ga0496115_0004762 3300048918 Bacteria 9849
342 Ga0501031_0000181 3300049568 Bacteria 35725
343 Ga0501031_0585636 3300049568 Bacteria 718
344 Ga0501032_0330062 3300049569 Unclassified 984
345 Ga0501033_0010838 3300049570 Bacteria 6991
346 Ga0501036_0008838 3300049572 Bacteria 8270
347 Ga0501037_0016571 3300049573 Bacteria 5423
348 Ga0501038_0037501 3300049574 Bacteria 4250
349 Ga0501039_0026266 3300049575 Bacteria 4475
350 Ga0501040_0208488 3300049576 Bacteria 1389
351 Ga0501041_0066760 3300049577 Bacteria 2204
352 Ga0501041_0448296 3300049577 Bacteria 819
353 Ga0501042_0059274 3300049578 Bacteria 2733
354 Ga0501042_0347803 3300049578 Unclassified 1072
355 Ga0501043_0035795 3300049579 Bacteria 3906
356 Ga0501048_0873987 3300049582 Unclassified 646
357 Ga0501067_0001486 3300049583 Bacteria 12752
358 Ga0501067_0501212 3300049583 Bacteria 679
359 Ga0501068_0107253 3300049584 Bacteria 1734
360 Ga0501068_0250899 3300049584 Unclassified 1128
361 Ga0501069_0008836 3300049585 Bacteria 5309
362 Ga0501069_0057406 3300049585 Bacteria 2170
363 Ga0501069_0307329 3300049585 Unclassified 930
364 Ga0501069_0394218 3300049585 Unclassified 819
365 Ga0501070_0160233 3300049586 Bacteria 1855
366 Ga0501071_0001134 3300049587 Bacteria 14875
367 Ga0501072_0001330 3300049588 Bacteria 18529
368 Ga0501073_0055566 3300049589 Bacteria 2770
369 Ga0501074_0057234 3300049590 Bacteria 2808
370 Ga0501075_0019755 3300049591 Bacteria 4890
371 Ga0501076_0299241 3300049592 Unclassified 1319
372 Ga0501076_0442601 3300049592 Bacteria 1070
373 Ga0501076_0572205 3300049592 Bacteria 932
374 Ga0501077_0027416 3300049593 Bacteria 3617
375 Ga0501079_0001512 3300049741 Bacteria 16472
376 Ga0501079_1612737 3300049741 Bacteria 510
377 Ga0501080_0012155 3300049742 Bacteria 7889
378 Ga0501080_0586518 3300049742 Bacteria 990
379 Ga0501080_1178711 3300049742 Unclassified 659
380 Ga0501081_0059476 3300049743 Bacteria 2645
381 Ga0501081_0428878 3300049743 Unclassified 981
382 Ga0501083_0041954 3300049744 Bacteria 3103
383 Ga0501035_0035885 3300049822 Bacteria 4497
384 Ga0501044_0179504 3300049823 Bacteria 2085
385 Ga0501045_0009691 3300049824 Bacteria 6737
386 Ga0501045_0078783 3300049824 Bacteria 2429
387 Ga0501045_0800449 3300049824 Bacteria 694
388 nmdc:mga05p37_330931_c1 3300050507 Bacteria 1799
389 nmdc:mga0n895_30326_c1 3300050512 Bacteria 5167
390 nmdc:mga0rr50_543847_c1 3300050513 Bacteria 989
391 nmdc:mga0rr50_81590_c1 3300050513 Bacteria 2496
392 nmdc:mga0a205_34051_c1 3300050515 Bacteria 4886
393 Ga0495655_0007445 3300053083 Bacteria 2037
394 Ga0495655_0086804 3300053083 Bacteria 905
395 Ga0501084_0000440 3300054114 Bacteria 31982
396 Ga0590075_005446 3300059424 Bacteria 3004
397 Ga0501082_0002801 3300060353 Bacteria 15217
398 Ga0501082_0309116 3300060353 Unclassified 1377
399 Ga0466962_0005630 3300061719 Bacteria 6015
400 Ga0466962_0022885 3300061719 Bacteria 3003
401 Ga0466962_0201016 3300061719 Bacteria 974
402 Ga0530510_0018192 3300061734 Bacteria 4982
403 Ga0530510_0045884 3300061734 Unclassified 3157
404 Ga0207648_10931274
405 Ga0070658_10014564
406 Ga0070658_10035897
407 Ga0070658_10364326
408 Ga0070683_100107115
409 Ga0070683_101706800
410 Ga0070690_100181696
411 Ga0070690_100471722
412 Ga0070680_100072348
413 Ga0070680_100290122
414 Ga0070680_100341802
415 Ga0070682_101181789
416 Ga0068868_100056537
417 Ga0068868_100508459
418 Ga0070660_100002027
419 Ga0070660_100004217
420 Ga0070660_100165611
421 Ga0070660_100780837
422 Ga0070661_100013126
423 Ga0070661_100197637
424 Ga0070668_100795556
425 Ga0070675_100065483
426 Ga0070675_100613047
427 Ga0070671_100059695
428 Ga0070673_100676499
429 Ga0070673_102051361
430 Ga0070659_100010385
431 Ga0070659_100632401
432 Ga0070709_10460131
433 Ga0070714_100194665
434 Ga0070711_100009922
435 Ga0070700_100339436
436 Ga0070694_100141276
437 Ga0070708_100172084
438 Ga0070708_100856282
439 Ga0070678_101070538
440 Ga0070681_10020430
441 Ga0070681_10022772
442 Ga0070681_10030413
443 Ga0070681_10042811
444 Ga0070706_100314906
445 Ga0070699_100144502
446 Ga0070679_100033639
447 Ga0070679_100093873
448 Ga0070679_100137254
449 Ga0070679_100199529
450 Ga0070679_100329494
451 Ga0070679_100700448
452 Ga0070679_100901243
453 Ga0070684_100066557
454 Ga0070684_100256792
455 Ga0070684_100292505
456 Ga0068853_100193969
457 Ga0070696_100173406
458 Ga0070696_100799534
459 Ga0070665_100027725
460 Ga0070665_100148252
461 Ga0070665_100231798
462 Ga0068855_100062357
463 Ga0068855_100154720
464 Ga0068855_100157044
465 Ga0068855_100178816
466 Ga0070664_100639972
467 Ga0068857_100611853
468 Ga0068857_100853280
469 Ga0068856_100037071
470 Ga0068856_100087815
471 Ga0068852_100134758
472 Ga0068852_100187777
473 Ga0068852_100675438
474 Ga0068861_101424193
475 Ga0068851_10168339
476 Ga0068870_10266823
477 Ga0068858_100639488
478 Ga0070717_10509763
479 Ga0070712_100667863
480 Ga0097621_100244485
481 Ga0097621_100265079
482 Ga0075428_101027034
483 Ga0075430_100240435
484 Ga0075434_100034876
485 Ga0075434_100783530
486 Ga0075435_100023205
487 Ga0075435_100488581
488 Ga0105240_10177073
489 Ga0105240_10637210
490 Ga0105240_11078875
491 Ga0105240_11393288
492 Ga0105245_10503572
493 Ga0105245_10999798
494 Ga0105245_11063684
495 Ga0105247_10129535
496 Ga0114129_10583088
497 Ga0114129_11231142
498 Ga0105243_10730060
499 Ga0105241_10183128
500 Ga0105241_10721547
501 Ga0105241_11061956
502 Ga0105242_10126052
503 Ga0105248_10014722
504 Ga0105248_10911081
505 Ga0105237_10056224
506 Ga0105237_10343807
507 Ga0105238_10009715
508 Ga0105239_10330514
509 Ga0157373_10420881
510 Ga0157373_10429729
511 Ga0157371_10291012
512 Ga0157370_10080941
513 Ga0157370_10106398
514 Ga0157370_11148405
515 Ga0157369_10074516
516 Ga0157369_10160718
517 Ga0157369_11737333
518 Ga0157374_10029024
519 Ga0157374_11925645
520 Ga0157378_10070935
521 Ga0157378_11708143
522 Ga0163162_10025002
523 Ga0157372_10013604
524 Ga0157372_10122483
525 Ga0157372_10581271
526 Ga0157372_10952573
527 Ga0157375_11235615
528 Ga0157380_10141615
529 Ga0157380_11021738
530 Ga0157377_10084274
531 Ga0157377_10085254
532 Ga0157377_10373657
533 Ga0157377_11193329
534 Ga0157376_10136965
535 Ga0182007_10138903
536 Ga0197907_10644306
537 Ga0206350_10862815
538 Ga0206354_10743337
539 Ga0206354_11517536
540 Ga0206353_10717111
541 Ga0206353_12004710
542 Ga0213874_10222148
543 Ga0213876_10149732
544 Ga0224712_10399667
545 Ga0207656_10395499
546 Ga0207643_10158948
547 Ga0207705_10003034
548 Ga0207654_10608858
549 Ga0207707_10011540
550 Ga0207707_10014835
551 Ga0207707_10034215
552 Ga0207707_10240701
553 Ga0207707_10337297
554 Ga0207695_10256088
555 Ga0207695_10313019
556 Ga0207671_10191744
557 Ga0207693_10463357
558 Ga0207663_10013600
559 Ga0207660_10038669
560 Ga0207660_10056748
561 Ga0207657_10002977
562 Ga0207657_10005676
563 Ga0207657_10018820
564 Ga0207657_11014337
565 Ga0207649_10015486
566 Ga0207649_10040814
567 Ga0207652_10021733
568 Ga0207652_10039938
569 Ga0207652_10084314
570 Ga0207652_10232061
571 Ga0207652_10935497
572 Ga0207694_10016875
573 Ga0207650_10077243
574 Ga0207659_10051020
575 Ga0207659_10219554
576 Ga0207687_10143746
577 Ga0207687_10377035
578 Ga0207687_11237758
579 Ga0207664_10228463
580 Ga0207664_10457693
581 Ga0207664_10771853
582 Ga0207690_10037157
583 Ga0207690_10298300
584 Ga0207690_10418397
585 Ga0207690_10657770
586 Ga0207706_10162891
587 Ga0207706_10749011
588 Ga0207669_10187549
589 Ga0207704_10204513
590 Ga0207665_10203799
591 Ga0207691_10345758
592 Ga0207711_10006698
593 Ga0207661_10068132
594 Ga0207661_10628765
595 Ga0207679_10424968
596 Ga0207667_10039166
597 Ga0207667_10088718
598 Ga0207667_10127923
599 Ga0207667_10498544
600 Ga0207677_10633508
601 Ga0207677_11055670
602 Ga0207639_10206893
603 Ga0207678_10887828
604 Ga0207702_10315718
605 Ga0207702_10341501
606 Ga0207674_10014089
607 Ga0207674_10022883
608 Ga0207683_10095502
609 Ga0207683_10559705
610 Ga0207683_10568230
611 Ga0207698_10037084
612 Ga0207698_10672145
613 Ga0268266_10022082
614 Ga0268266_10214642
615 Ga0265322_10057920
616 Ga0265338_10090537
617 Ga0265330_10063932
618 Ga0265328_10261378
619 Ga0265320_10388119
620 Ga0265331_10074593
621 Ga0265314_10061931
622 Ga0307410_10621062
623 Ga0307406_10829084
624 Ga0307412_10721577
625 Ga0307409_100036575
626 Ga0307409_100111283
627 Ga0307409_100230916
628 Ga0307416_100031834
629 Ga0307416_100550109
630 Ga0307415_100374579
631 Ga0373942_0098986
632 Ga0373947_0001020
633 Ga0395900_0009702
634 Ga0395900_0281511
635 Ga0395900_0330083
636 Ga0395900_0342897
637 Ga0395898_0001107
638 Ga0395898_0067943
639 Ga0395898_0069700
640 Ga0395898_0986048
641 Ga0395905_0012023
642 Ga0395901_0002293
643 Ga0395901_0016940
644 Ga0395901_0059814
645 Ga0395901_0107445
646 Ga0395901_0670759
647 Ga0395901_1583915
648 Ga0436365_0267621
649 Ga0436365_1426153
650 Ga0436365_1934096
651 Ga0436363_0735791
652 Ga0436363_1703964
653 Ga0450920_052568
654 Ga0466972_0631855
655 Ga0466965_0135173
656 Ga0466965_0217360
657 Ga0466966_0006608
658 Ga0466966_0011751
659 Ga0466966_0259511
660 Ga0466961_0031607
661 Ga0466961_0082420
662 Ga0466961_0085550
663 Ga0466961_0113079
664 Ga0466963_0000010
665 Ga0466963_0027479
666 Ga0466963_0035941
667 Ga0466963_0037969
668 Ga0466963_0134109
669 Ga0466963_0157728
670 Ga0466963_0301249
671 Ga0466964_0021866
672 Ga0466964_0126422
673 Ga0466964_0383661
674 Ga0466964_0574400
675 Ga0466964_0742570
676 Ga0466971_0000509
677 Ga0466971_0422909
678 Ga0466968_0059524
679 Ga0466970_0096693
680 Ga0466970_0097761
681 Ga0466957_0003780
682 Ga0466957_0046255
683 Ga0466957_0086295
684 Ga0466957_0110275
685 Ga0466957_0379738
686 Ga0466960_0353733
687 Ga0466959_0090797
688 Ga0466959_0194941
689 Ga0466959_0343991
690 Ga0466958_0046779
691 Ga0466958_0323475
692 Ga0466958_0348998
693 Ga0466967_0005512
694 Ga0466967_0008373
695 Ga0466967_0020214
696 Ga0466967_0026713
697 Ga0466967_0029068
698 Ga0466967_0052309
699 Ga0466967_0072513
700 Ga0466967_0093790
701 Ga0466967_0288682
702 Ga0466967_0293271
703 Ga0466967_0740937
704 Ga0466967_0760389
705 Ga0466967_1689373
706 Ga0495592_0172473
707 Ga0495641_0019078
708 Ga0495607_0273213
709 Ga0495630_0375340
710 Ga0495621_0258606
711 Ga0495613_0328516
712 Ga0495615_0212094
713 Ga0496100_0027588
714 Ga0496100_0093899
715 Ga0496100_0205260
716 Ga0496101_0008249
717 Ga0496101_0012553
718 Ga0496101_0026673
719 Ga0496102_0047089
720 Ga0496102_1747876
721 Ga0496103_0070672
722 Ga0496103_0302848
723 Ga0496104_0008929
724 Ga0496105_0037676
725 Ga0496106_0011265
726 Ga0496106_0016266
727 Ga0496106_0087301
728 Ga0496107_0009503
729 Ga0496107_0166713
730 Ga0496107_0833016
731 Ga0496108_0201023
732 Ga0496109_0013623
733 Ga0496110_0032503
734 Ga0496111_0010808
735 Ga0496112_0010171
736 Ga0496112_0199520
737 Ga0496112_0579176
738 Ga0496112_0594708
739 Ga0496112_1277113
740 Ga0496113_0107365
741 Ga0496113_0339754
742 Ga0496114_0000778
743 Ga0496114_0043966
744 Ga0496115_0004762
745 Ga0501031_0000181
746 Ga0501031_0585636
747 Ga0501032_0330062
748 Ga0501033_0010838
749 Ga0501036_0008838
750 Ga0501037_0016571
751 Ga0501038_0037501
752 Ga0501039_0026266
753 Ga0501040_0208488
754 Ga0501041_0066760
755 Ga0501041_0448296
756 Ga0501042_0059274
757 Ga0501042_0347803
758 Ga0501043_0035795
759 Ga0501048_0873987
760 Ga0501067_0001486
761 Ga0501067_0501212
762 Ga0501068_0107253
763 Ga0501068_0250899
764 Ga0501069_0008836
765 Ga0501069_0057406
766 Ga0501069_0307329
767 Ga0501069_0394218
768 Ga0501070_0160233
769 Ga0501071_0001134
770 Ga0501072_0001330
771 Ga0501073_0055566
772 Ga0501074_0057234
773 Ga0501075_0019755
774 Ga0501076_0299241
775 Ga0501076_0442601
776 Ga0501076_0572205
777 Ga0501077_0027416
778 Ga0501079_0001512
779 Ga0501079_1612737
780 Ga0501080_0012155
781 Ga0501080_0586518
782 Ga0501080_1178711
783 Ga0501081_0059476
784 Ga0501081_0428878
785 Ga0501083_0041954
786 Ga0501035_0035885
787 Ga0501044_0179504
788 Ga0501045_0009691
789 Ga0501045_0078783
790 Ga0501045_0800449
791 nmdc:mga05p37_330931_c1
792 nmdc:mga0n895_30326_c1
793 nmdc:mga0rr50_543847_c1
794 nmdc:mga0rr50_81590_c1
795 nmdc:mga0a205_34051_c1
796 Ga0495655_0007445
797 Ga0495655_0086804
798 Ga0501084_0000440
799 Ga0590075_005446
800 Ga0501082_0002801
801 Ga0501082_0309116
802 Ga0466962_0005630
803 Ga0466962_0022885
804 Ga0466962_0201016
805 Ga0530510_0018192
806 Ga0530510_0045884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

51

146

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8606 35 159
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.8583 21 130
3fit-assembly1.cif.gz_A-2 fhit (fragile histidine triad protein) in complex with adenosine/sulfate amp analog 0.8502 36 159
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8474 39 158
2fhi-assembly1.cif.gz_A-2 substrate analog (ib2) complex with the his 96 asn substitution of the fragile histidine triad protein, fhit 0.8455 38 157
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8926 38 129 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.87 59 134 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.863 38 131 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8548 38 157 3.30.428.10
af_Q58276_1_129_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8524 22 133 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2S6Q4C0-F1-model_v4 HIT domain-containing protein 0.8804 21 133 GO:0006790
GO:0009150
GO:0047627
AF-A0A662R0Z4-F1-model_v4 HIT family protein 0.8789 21 132 GO:0003824
GO:0009117
AF-A0A497J7B6-F1-model_v4 HIT family protein 0.8777 22 133 GO:0003824
GO:0009117
AF-A0A662PED9-F1-model_v4 HIT family protein 0.8722 20 133 GO:0006790
GO:0009150
GO:0047627
AF-X1E0D2-F1-model_v4 HIT domain-containing protein 0.8722 21 129 GO:0000166
GO:0003824

Map