F435330

General Info

Members Datasets Scaffolds Average Seq Length
403 216 387 481

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100044328|Ga0068853_1000443282
Length 504
Sequence MYLNTVTAETLRRRGTYKLSLRRPTSAVKIRLIIILPCMFFYKVYSQTPADTITLSLPEIVAMAKEKSIASKQAATVRETKYWVWRTFRSNYQPQLSLNGTLPAYSKTFTQVLQPDGSILFQPIHNNQSIAATGGTIFGTTQLQRFDDFDRHNTLYNGVPYAVGYSQPLWQFNSLRWDKKIEPLKFNESRQAYIESLEQVAITASGYFFDLLLAQVNLQIAETNLTNTQKIQAIANEKLELGKITRNEILQLELEQLKAQKAVGIARRDMEIATLNLRSFTGLTGQENIKLQVPASVIQMSVTTEKVVAEAYENRSDAIAFVRRIAEAKRDVAKAKGDNGLNATLTARLGYSKSAAELAKVYHAPQDQQLVQLDFTIPILDWGRSKSRTKTAEANQQFTRYAVEQDKQIFTQQIVTQVTLFDMMHDQLTLSARADTIASEKYQIAKDRYVLGNLSITDLSIAFQEKDQAKRDYIAALRDFWGSYYQLRYLSLYDFEKNEKILYK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
9 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
12 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
13 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
14 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
15 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
16 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
17 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
207 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.41
Nodule 0
Rhizoplane 0.74
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1109292 2162886007 Bacteria 16391
2 SwRhRL2b_contig_1157535 2162886007 Bacteria 16452
3 SwRhRL2b_contig_2471198 2162886007 Bacteria 1916
4 JGI24739J22299_10004869 3300001989 Bacteria 5118
5 JGI24737J22298_10000041 3300001990 Bacteria 37211
6 JGI24743J22301_10010882 3300001991 Bacteria 1629
7 JGI24735J21928_10000001 3300002067 Bacteria 650042
8 JGI25162J39368_1000121 3300002737 Bacteria 85899
9 JGI25162J39368_1002782 3300002737 Bacteria 6189
10 JGI25154J39366_1000100 3300002738 Bacteria 76811
11 JGI25157J39369_1004602 3300002741 Bacteria 2455
12 JGI25165J46597_1001237 3300003214 Bacteria 15127
13 rootH1_10026547 3300003316 Bacteria 11340
14 rootH1_10049259 3300003316 Bacteria 11540
15 rootH2_10000343 3300003320 Bacteria 102217
16 rootH2_10021608 3300003320 Bacteria 1833
17 rootL2_10089064 3300003322 Bacteria 3259
18 rootL2_10125616 3300003322 Bacteria 2539
19 rootL2_10253563 3300003322 Unclassified 2242
20 rootH1_10001370 3300003323 Bacteria 113238
21 rootH1_10015647 3300003323 Bacteria 3869
22 rootH1_10015649 3300003323 Bacteria 1746
23 rootH1_10063115 3300003323 Bacteria 5032
24 JGI25160J50197_1001283 3300003354 Bacteria 12742
25 JGI25160J50197_1007572 3300003354 Bacteria 4235
26 Ga0055536_1000009 3300003781 Bacteria 311572
27 Ga0055528_1000572 3300003790 Bacteria 27859
28 Ga0055530_10000943 3300003791 Bacteria 23778
29 Ga0055531_10014302 3300003794 Bacteria 3582
30 Ga0065165_1000017 3300005262 Bacteria 278286
31 Ga0065714_10002263 3300005288 Bacteria 65514
32 Ga0065714_10002864 3300005288 Bacteria 54801
33 Ga0065714_10009241 3300005288 Bacteria 2988
34 Ga0065714_10064508 3300005288 Bacteria 46035
35 Ga0065714_10077226 3300005288 Bacteria 2710
36 Ga0065704_10000229 3300005289 Bacteria 80338
37 Ga0065704_10074770 3300005289 Bacteria 6027
38 Ga0070658_10000080 3300005327 Bacteria 90682
39 Ga0070658_10137360 3300005327 Bacteria 2040
40 Ga0070676_10000140 3300005328 Bacteria 27970
41 Ga0070683_100021523 3300005329 Bacteria 5755
42 Ga0070683_100261577 3300005329 Bacteria 1646
43 Ga0070670_100137395 3300005331 Bacteria 2112
44 Ga0068869_100140679 3300005334 Bacteria 1863
45 Ga0070666_10000042 3300005335 Bacteria 112296
46 Ga0070666_10025999 3300005335 Bacteria 3820
47 Ga0068868_100019165 3300005338 Bacteria 5126
48 Ga0068868_100039680 3300005338 Bacteria 3659
49 Ga0068868_100046323 3300005338 Bacteria 3403
50 Ga0070660_100004493 3300005339 Bacteria 9639
51 Ga0070661_100011648 3300005344 Bacteria 6132
52 Ga0070668_100021853 3300005347 Bacteria 4833
53 Ga0070668_100026530 3300005347 Bacteria 4397
54 Ga0070675_100112069 3300005354 Bacteria 2309
55 Ga0070671_100036952 3300005355 Bacteria 4049
56 Ga0070671_100074571 3300005355 Bacteria 2835
57 Ga0070673_100019435 3300005364 Bacteria 4875
58 Ga0070673_100052488 3300005364 Bacteria 3199
59 Ga0070688_100056164 3300005365 Bacteria 2472
60 Ga0070659_100005576 3300005366 Bacteria 9044
61 Ga0070659_100013275 3300005366 Bacteria 6126
62 Ga0070667_100018965 3300005367 Bacteria 5703
63 Ga0070667_100040632 3300005367 Bacteria 3900
64 Ga0070678_100007973 3300005456 Bacteria 6314
65 Ga0070662_100000081 3300005457 Bacteria 53265
66 Ga0070662_100015275 3300005457 Bacteria 5140
67 Ga0068867_100000843 3300005459 Bacteria 20637
68 Ga0068867_100142024 3300005459 Bacteria 1878
69 Ga0070679_100007702 3300005530 Bacteria 10082
70 Ga0070679_100042032 3300005530 Bacteria 4552
71 Ga0068853_100023658 3300005539 Bacteria 5146
72 Ga0068853_100044328 3300005539 Bacteria 3808
73 Ga0068853_100076495 3300005539 Bacteria 2923
74 Ga0068853_100091621 3300005539 Bacteria 2674
75 Ga0070665_100000001 3300005548 Bacteria 1083363
76 Ga0070665_100000072 3300005548 Bacteria 198575
77 Ga0068855_100000090 3300005563 Bacteria 110528
78 Ga0068855_100006355 3300005563 Bacteria 14401
79 Ga0068855_100007153 3300005563 Bacteria 13546
80 Ga0068855_100013657 3300005563 Bacteria 9794
81 Ga0068855_100092382 3300005563 Bacteria 3490
82 Ga0068855_100127328 3300005563 Bacteria 2911
83 Ga0070664_100049893 3300005564 Bacteria 3540
84 Ga0068857_100045029 3300005577 Bacteria 3913
85 Ga0068857_100076669 3300005577 Bacteria 2982
86 Ga0068857_100143997 3300005577 Bacteria 2155
87 Ga0068854_100060967 3300005578 Bacteria 2731
88 Ga0068856_100000129 3300005614 Bacteria 76536
89 Ga0068856_100028219 3300005614 Bacteria 5479
90 Ga0068856_100131497 3300005614 Bacteria 2507
91 Ga0068852_100000281 3300005616 Bacteria 33979
92 Ga0068859_100000130 3300005617 Bacteria 71018
93 Ga0068864_100002546 3300005618 Bacteria 15048
94 Ga0068863_100008085 3300005841 Bacteria 10273
95 Ga0068863_100220245 3300005841 Unclassified 1828
96 Ga0068858_100003098 3300005842 Bacteria 16637
97 Ga0068860_100001453 3300005843 Bacteria 25628
98 Ga0068860_100002504 3300005843 Bacteria 19274
99 Ga0068860_100016152 3300005843 Bacteria 7285
100 Ga0081539_10000337 3300005985 Bacteria 103868
101 Ga0075366_10002447 3300006195 Bacteria 9508
102 Ga0075366_10068606 3300006195 Bacteria 2110
103 Ga0097621_100000039 3300006237 Bacteria 67231
104 Ga0097621_100000081 3300006237 Bacteria 50723
105 Ga0097621_100009477 3300006237 Bacteria 7069
106 Ga0068871_100000300 3300006358 Bacteria 34429
107 Ga0068871_100002549 3300006358 Bacteria 12434
108 Ga0068871_100034096 3300006358 Bacteria 4037
109 Ga0068865_100000180 3300006881 Bacteria 35127
110 Ga0097620_100000130 3300006931 Bacteria 71018
111 Ga0105240_10000283 3300009093 Bacteria 99553
112 Ga0105240_10298018 3300009093 Bacteria 1845
113 Ga0105245_10112423 3300009098 Bacteria 2534
114 Ga0105247_10037070 3300009101 Bacteria 2974
115 Ga0105241_10000514 3300009174 Bacteria 29151
116 Ga0105241_10001533 3300009174 Bacteria 17705
117 Ga0105241_10003973 3300009174 Bacteria 10930
118 Ga0105241_10006553 3300009174 Bacteria 8581
119 Ga0105241_10054143 3300009174 Bacteria 3070
120 Ga0105241_10081126 3300009174 Bacteria 2540
121 Ga0105241_10105016 3300009174 Bacteria 2252
122 Ga0105242_10089423 3300009176 Bacteria 2588
123 Ga0105237_10000411 3300009545 Bacteria 60960
124 Ga0105237_10000963 3300009545 Bacteria 38740
125 Ga0105237_10001962 3300009545 Bacteria 26195
126 Ga0105237_10009372 3300009545 Bacteria 10489
127 Ga0105237_10013274 3300009545 Bacteria 8642
128 Ga0105237_10022043 3300009545 Bacteria 6537
129 Ga0105237_10023345 3300009545 Bacteria 6339
130 Ga0105237_10080916 3300009545 Bacteria 3238
131 Ga0105237_10115306 3300009545 Unclassified 2680
132 Ga0105238_10002377 3300009551 Bacteria 18888
133 Ga0105249_10004268 3300009553 Bacteria 12351
134 Ga0105249_10012134 3300009553 Bacteria 7584
135 Ga0105249_10016508 3300009553 Bacteria 6549
136 Ga0105239_10000013 3300010375 Bacteria 327371
137 Ga0105239_10000106 3300010375 Bacteria 117256
138 Ga0105239_10000132 3300010375 Bacteria 105380
139 Ga0105239_10000528 3300010375 Bacteria 55243
140 Ga0105239_10001538 3300010375 Bacteria 30493
141 Ga0105239_10006197 3300010375 Bacteria 13918
142 Ga0105239_10016107 3300010375 Bacteria 8271
143 Ga0105239_10071450 3300010375 Bacteria 3813
144 Ga0105246_10041915 3300011119 Bacteria 3097
145 Ga0157373_10000261 3300013100 Bacteria 42879
146 Ga0157373_10009612 3300013100 Bacteria 7136
147 Ga0157373_10055596 3300013100 Bacteria 2812
148 Ga0157371_10000050 3300013102 Bacteria 183160
149 Ga0157371_10001830 3300013102 Bacteria 21442
150 Ga0157371_10001867 3300013102 Bacteria 21086
151 Ga0157371_10035312 3300013102 Unclassified 3583
152 Ga0157371_10053526 3300013102 Unclassified 2866
153 Ga0157371_10088341 3300013102 Bacteria 2194
154 Ga0157370_10000285 3300013104 Bacteria 64200
155 Ga0157370_10015299 3300013104 Bacteria 7805
156 Ga0157369_10001695 3300013105 Bacteria 26849
157 Ga0157369_10025169 3300013105 Bacteria 6608
158 Ga0157369_10183580 3300013105 Bacteria 2200
159 Ga0157374_10000007 3300013296 Bacteria 595643
160 Ga0157374_10000135 3300013296 Bacteria 67340
161 Ga0157374_10003320 3300013296 Bacteria 13514
162 Ga0157374_10025011 3300013296 Bacteria 5357
163 Ga0157374_10051431 3300013296 Bacteria 3834
164 Ga0157374_10121795 3300013296 Bacteria 2518
165 Ga0157374_10191255 3300013296 Unclassified 2002
166 Ga0157378_10005063 3300013297 Bacteria 11573
167 Ga0157378_10009998 3300013297 Bacteria 8274
168 Ga0157378_10024654 3300013297 Bacteria 5296
169 Ga0157378_10032461 3300013297 Bacteria 4613
170 Ga0157378_10045337 3300013297 Bacteria 3907
171 Ga0157378_10149541 3300013297 Unclassified 2175
172 Ga0157378_10184865 3300013297 Bacteria 1962
173 Ga0157378_10188375 3300013297 Bacteria 1944
174 Ga0163162_10000097 3300013306 Bacteria 79518
175 Ga0163162_10000899 3300013306 Bacteria 27700
176 Ga0163162_10003016 3300013306 Bacteria 16084
177 Ga0163162_10006867 3300013306 Bacteria 11044
178 Ga0163162_10063136 3300013306 Bacteria 3745
179 Ga0163162_10091521 3300013306 Bacteria 3125
180 Ga0157372_10000011 3300013307 Bacteria 277202
181 Ga0157372_10001527 3300013307 Bacteria 25162
182 Ga0157372_10015408 3300013307 Bacteria 8193
183 Ga0157372_10250569 3300013307 Bacteria 2055
184 Ga0157372_10367948 3300013307 Bacteria 1675
185 Ga0157375_10000250 3300013308 Bacteria 49016
186 Ga0157375_10041548 3300013308 Bacteria 4441
187 Ga0157375_10227951 3300013308 Unclassified 2022
188 Ga0163163_10000389 3300014325 Bacteria 41878
189 Ga0163163_10037815 3300014325 Bacteria 4697
190 Ga0182008_10000012 3300014497 Bacteria 297475
191 Ga0182008_10000078 3300014497 Bacteria 77087
192 Ga0157379_10149917 3300014968 Bacteria 2103
193 Ga0157376_10000374 3300014969 Bacteria 29126
194 Ga0157376_10003324 3300014969 Bacteria 11067
195 Ga0157376_10026381 3300014969 Bacteria 4591
196 Ga0182006_1000166 3300015261 Bacteria 69787
197 Ga0182006_1000297 3300015261 Bacteria 43680
198 Ga0182006_1001324 3300015261 Bacteria 15184
199 Ga0182006_1003364 3300015261 Bacteria 8224
200 Ga0163161_10000215 3300017792 Bacteria 52730
201 Ga0163161_10000574 3300017792 Bacteria 29528
202 Ga0163161_10015258 3300017792 Bacteria 5354
203 Ga0163161_10017912 3300017792 Bacteria 4963
204 Ga0163161_10025057 3300017792 Bacteria 4218
205 Ga0207427_100125 3300025231 Bacteria 96142
206 Ga0209437_100008 3300025233 Bacteria 921142
207 Ga0209437_100017 3300025233 Bacteria 694471
208 Ga0209258_100029 3300025242 Bacteria 490648
209 Ga0209646_1000006 3300025246 Bacteria 694084
210 Ga0209646_1001501 3300025246 Bacteria 6201
211 Ga0209026_1000954 3300025250 Bacteria 14493
212 Ga0209148_1000163 3300025254 Bacteria 137449
213 Ga0209233_1000024 3300025261 Bacteria 695418
214 Ga0209673_1000354 3300025273 Bacteria 83443
215 Ga0209676_1000001 3300025292 Bacteria 1852142
216 Ga0209564_1003201 3300025295 Bacteria 11499
217 Ga0209564_1004937 3300025295 Bacteria 7884
218 Ga0209758_1003655 3300025297 Bacteria 13704
219 Ga0209050_1000018 3300025298 Bacteria 723263
220 Ga0209050_1000163 3300025298 Bacteria 154895
221 Ga0207426_1000093 3300025302 Bacteria 277663
222 Ga0207426_1002304 3300025302 Bacteria 12553
223 Ga0207426_1023208 3300025302 Unclassified 2119
224 Ga0209257_1005362 3300025304 Bacteria 9055
225 Ga0207710_10059063 3300025900 Bacteria 1735
226 Ga0207680_10000228 3300025903 Bacteria 27141
227 Ga0207647_10000028 3300025904 Bacteria 109750
228 Ga0207647_10000058 3300025904 Bacteria 84631
229 Ga0207647_10015760 3300025904 Bacteria 5173
230 Ga0207645_10001698 3300025907 Bacteria 17878
231 Ga0207705_10000035 3300025909 Bacteria 201649
232 Ga0207654_10006862 3300025911 Bacteria 5731
233 Ga0207695_10000684 3300025913 Bacteria 66519
234 Ga0207695_10016050 3300025913 Bacteria 8786
235 Ga0207695_10150857 3300025913 Bacteria 2264
236 Ga0207695_10219468 3300025913 Bacteria 1809
237 Ga0207671_10001126 3300025914 Bacteria 32182
238 Ga0207671_10001753 3300025914 Bacteria 24394
239 Ga0207671_10003445 3300025914 Bacteria 15761
240 Ga0207671_10004030 3300025914 Bacteria 14263
241 Ga0207671_10006546 3300025914 Bacteria 10353
242 Ga0207671_10036741 3300025914 Bacteria 3633
243 Ga0207657_10008412 3300025919 Bacteria 10474
244 Ga0207694_10133450 3300025924 Bacteria 1992
245 Ga0207650_10140639 3300025925 Unclassified 1897
246 Ga0207659_10068846 3300025926 Bacteria 2576
247 Ga0207644_10026621 3300025931 Bacteria 3987
248 Ga0207644_10098507 3300025931 Bacteria 2192
249 Ga0207690_10010265 3300025932 Bacteria 5562
250 Ga0207690_10118169 3300025932 Bacteria 1921
251 Ga0207706_10000147 3300025933 Bacteria 76792
252 Ga0207706_10003522 3300025933 Bacteria 14949
253 Ga0207704_10000076 3300025938 Bacteria 61793
254 Ga0207704_10068098 3300025938 Bacteria 2243
255 Ga0207689_10014206 3300025942 Bacteria 6775
256 Ga0207689_10027846 3300025942 Bacteria 4728
257 Ga0207689_10109231 3300025942 Unclassified 2273
258 Ga0207661_10140985 3300025944 Bacteria 2074
259 Ga0207679_10014731 3300025945 Bacteria 5150
260 Ga0207667_10000009 3300025949 Bacteria 603135
261 Ga0207667_10007095 3300025949 Bacteria 13527
262 Ga0207667_10007728 3300025949 Bacteria 12855
263 Ga0207667_10105740 3300025949 Bacteria 2904
264 Ga0207667_10259955 3300025949 Bacteria 1775
265 Ga0207651_10013810 3300025960 Bacteria 4637
266 Ga0207651_10083717 3300025960 Bacteria 2308
267 Ga0207668_10114461 3300025972 Unclassified 2030
268 Ga0207640_10187732 3300025981 Bacteria 1555
269 Ga0207658_10053090 3300025986 Bacteria 2993
270 Ga0207677_10010111 3300026023 Bacteria 5327
271 Ga0207677_10099398 3300026023 Bacteria 2136
272 Ga0207639_10012990 3300026041 Bacteria 5813
273 Ga0207639_10040244 3300026041 Bacteria 3487
274 Ga0207702_10000300 3300026078 Bacteria 57198
275 Ga0207702_10036631 3300026078 Bacteria 4104
276 Ga0207702_10043918 3300026078 Bacteria 3754
277 Ga0207641_10000158 3300026088 Bacteria 96378
278 Ga0207641_10091729 3300026088 Unclassified 2659
279 Ga0207648_10000648 3300026089 Bacteria 39101
280 Ga0207648_10087474 3300026089 Bacteria 2719
281 Ga0207676_10237559 3300026095 Bacteria 1633
282 Ga0207674_10045717 3300026116 Bacteria 4501
283 Ga0207674_10092281 3300026116 Bacteria 3018
284 Ga0207675_100005173 3300026118 Bacteria 12557
285 Ga0207683_10038383 3300026121 Bacteria 4174
286 Ga0207683_10125373 3300026121 Bacteria 2307
287 Ga0207698_10044934 3300026142 Bacteria 3323
288 Ga0268266_10000089 3300028379 Bacteria 198566
289 Ga0268266_10000232 3300028379 Bacteria 95941
290 Ga0268264_10001350 3300028381 Bacteria 23002
291 Ga0268264_10001875 3300028381 Bacteria 19096
292 Ga0268264_10002631 3300028381 Bacteria 15680
293 Ga0268264_10028914 3300028381 Bacteria 4538
294 Ga0307515_10000246 3300028794 Bacteria 134348
295 Ga0307515_10000707 3300028794 Bacteria 76907
296 Ga0307515_10000993 3300028794 Bacteria 64832
297 Ga0307515_10124457 3300028794 Bacteria 2892
298 Ga0265327_10000284 3300031251 Bacteria 100178
299 Ga0307509_10198039 3300031507 Bacteria 1849
300 Ga0307516_10000189 3300031730 Bacteria 79794
301 Ga0307407_10000017 3300031903 Bacteria 136012
302 Ga0307412_10000045 3300031911 Bacteria 165021
303 Ga0307416_100000011 3300032002 Bacteria 300622
304 Ga0307414_10000533 3300032004 Bacteria 19793
305 Ga0307414_10019489 3300032004 Bacteria 4205
306 Ga0307414_10056781 3300032004 Bacteria 2748
307 Ga0307414_10114465 3300032004 Bacteria 2061
308 Ga0307507_10001380 3300033179 Bacteria 54486
309 Ga0307510_10001267 3300033180 Bacteria 27507
310 Ga0307510_10004144 3300033180 Bacteria 17022
311 Ga0316584_0009501 3300036712 Bacteria 6754
312 Ga0395899_0000188 3300037312 Bacteria 90869
313 Ga0395899_0000888 3300037312 Bacteria 28385
314 Ga0395900_0000226 3300037418 Bacteria 88588
315 Ga0395898_0004590 3300037466 Bacteria 15073
316 Ga0395905_0000068 3300037471 Bacteria 177163
317 Ga0395901_0000136 3300038443 Bacteria 95382
318 Ga0436365_0269604 3300039437 Bacteria 1735
319 Ga0436365_1732514 3300039437 Bacteria 16095
320 Ga0436361_0803447 3300039447 Bacteria 4486
321 Ga0451795_1603602 3300041456 Unclassified 2088
322 Ga0439431_0000539 3300041997 Bacteria 8039
323 Ga0466969_0028693 3300044656 Bacteria 2844
324 Ga0466969_0035181 3300044656 Bacteria 2534
325 Ga0466966_0019459 3300044684 Bacteria 4466
326 Ga0466961_0035312 3300044693 Unclassified 3211
327 Ga0466971_0017089 3300044719 Bacteria 3206
328 Ga0466959_0008498 3300045049 Bacteria 7265
329 Ga0466958_0039730 3300045836 Bacteria 2827
330 Ga0466958_0080989 3300045836 Unclassified 1998
331 Ga0495650_0000273 3300046471 Bacteria 98757
332 Ga0495585_0000132 3300046492 Bacteria 80905
333 Ga0495585_0037031 3300046492 Bacteria 2748
334 Ga0495583_0045690 3300046506 Bacteria 2024
335 Ga0495606_0000130 3300046507 Bacteria 127805
336 Ga0495606_0011133 3300046507 Bacteria 7373
337 Ga0495610_0000151 3300046512 Bacteria 76854
338 Ga0495610_0002033 3300046512 Bacteria 17292
339 Ga0495616_0002729 3300046513 Bacteria 11555
340 Ga0495631_0005500 3300046518 Bacteria 6623
341 Ga0495644_0007986 3300046523 Bacteria 4071
342 Ga0495648_0043766 3300046524 Bacteria 2803
343 Ga0495609_0039161 3300046538 Bacteria 2135
344 Ga0495633_0000035 3300046558 Bacteria 185403
345 Ga0495633_0009219 3300046558 Bacteria 5471
346 Ga0495668_0000032 3300046616 Bacteria 254951
347 Ga0495668_0000513 3300046616 Bacteria 48303
348 Ga0495625_0000036 3300046660 Bacteria 221680
349 Ga0495625_0000227 3300046660 Bacteria 88834
350 Ga0495625_0000358 3300046660 Bacteria 69690
351 Ga0495625_0012165 3300046660 Bacteria 6983
352 Ga0495625_0050616 3300046660 Bacteria 2980
353 Ga0495661_0001031 3300046665 Bacteria 24752
354 Ga0495661_0010531 3300046665 Bacteria 6306
355 Ga0495661_0058503 3300046665 Bacteria 2297
356 Ga0495649_0000017 3300046694 Bacteria 221685
357 Ga0495660_0005464 3300046810 Bacteria 7612
358 Ga0495687_000001 3300047443 Bacteria 1215582
359 Ga0495687_002988 3300047443 Bacteria 12791
360 Ga0495687_005612 3300047443 Bacteria 7932
361 Ga0495677_0006183 3300047445 Bacteria 4523
362 Ga0495686_0022968 3300047472 Bacteria 4120
363 Ga0495686_0033922 3300047472 Bacteria 3291
364 Ga0495686_0046651 3300047472 Bacteria 2738
365 Ga0495614_0052396 3300048089 Bacteria 1749
366 Ga0496115_0114154 3300048918 Bacteria 2220
367 Ga0496123_0012248 3300048926 Bacteria 7334
368 Ga0501034_0031521 3300049571 Bacteria 5384
369 Ga0501034_0034236 3300049571 Bacteria 5150
370 Ga0501241_009072 3300049758 Bacteria 1812
371 nmdc:mga0k408_1683_c1 3300050493 Bacteria 11936
372 nmdc:mga0k408_23843_c1 3300050493 Bacteria 3456
373 Ga0500644_0000528 3300053088 Bacteria 16038
374 Ga0500583_0000367 3300053092 Bacteria 14822
375 Ga0500583_0030849 3300053092 Bacteria 2351
376 Ga0500651_0000646 3300053093 Bacteria 17380
377 Ga0500607_045016 3300053121 Bacteria 2371
378 Ga0500608_000502 3300053122 Bacteria 14608
379 Ga0500618_000004 3300053125 Bacteria 293180
380 Ga0500642_0003131 3300053130 Bacteria 4963
381 Ga0500652_015478 3300053131 Bacteria 2753
382 Ga0500568_0037049 3300053139 Unclassified 1981
383 Ga0500577_0001759 3300053142 Bacteria 5532
384 Ga0500604_0006911 3300053151 Bacteria 3004
385 Ga0500616_0005705 3300053153 Bacteria 8386
386 Ga0500633_0001643 3300053160 Bacteria 4324
387 Ga0500611_000028 3300053727 Bacteria 93696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100261577 Ga0070683_1002615771 381
2 3300013102 Ga0157371_10053526 Ga0157371_100535262 381
3 3300036712 Ga0316584_0009501 Ga0316584_0009501_1820_3148 399
4 3300025972 Ga0207668_10114461 Ga0207668_101144611 422
5 3300041456 Ga0451795_1603602 Ga0451795_1603602_230_1693 427
6 3300013296 Ga0157374_10051431 Ga0157374_100514312 428
7 3300039437 Ga0436365_1732514 Ga0436365_1732514_8511_9965 428
8 3300053153 Ga0500616_0005705 Ga0500616_0005705_6002_7357 431
9 3300001989 JGI24739J22299_10004869 JGI24739J22299_100048692 434
10 3300025302 Ga0207426_1023208 Ga0207426_10232081 434
11 3300013297 Ga0157378_10184865 Ga0157378_101848651 437
12 3300009176 Ga0105242_10089423 Ga0105242_100894232 439
13 3300009093 Ga0105240_10298018 Ga0105240_102980182 440
14 3300010375 Ga0105239_10001538 Ga0105239_100015385 440
15 3300013100 Ga0157373_10055596 Ga0157373_100555962 440
16 3300013102 Ga0157371_10088341 Ga0157371_100883412 440
17 3300013105 Ga0157369_10025169 Ga0157369_100251693 440
18 3300013296 Ga0157374_10025011 Ga0157374_100250114 440
19 3300013297 Ga0157378_10045337 Ga0157378_100453372 440
20 3300013307 Ga0157372_10250569 Ga0157372_102505691 440
21 3300046523 Ga0495644_0007986 Ga0495644_0007986_931_2286 440
22 3300047445 Ga0495677_0006183 Ga0495677_0006183_1677_3032 440
23 3300053151 Ga0500604_0006911 Ga0500604_0006911_30_1385 440
24 3300009545 Ga0105237_10000963 Ga0105237_100009636 442
25 3300010375 Ga0105239_10000013 Ga0105239_10000013208 442
26 3300047472 Ga0495686_0022968 Ga0495686_0022968_1247_2623 443
27 3300048089 Ga0495614_0052396 Ga0495614_0052396_36_1400 443
28 3300053122 Ga0500608_000502 Ga0500608_000502_7204_8568 443
29 3300053130 Ga0500642_0003131 Ga0500642_0003131_3104_4468 443
30 3300013306 Ga0163162_10000899 Ga0163162_1000089914 449
31 3300049571 Ga0501034_0031521 Ga0501034_0031521_3581_5128 453
32 3300053727 Ga0500611_000028 Ga0500611_000028_52682_54133 455
33 3300028794 Ga0307515_10124457 Ga0307515_101244572 457
34 iso_pu_bacteria 2738541283 2738755280 457
35 3300005347 Ga0070668_100021853 Ga0070668_1000218534 458
36 3300005367 Ga0070667_100018965 Ga0070667_1000189653 458
37 3300005843 Ga0068860_100002504 Ga0068860_1000025049 458
38 3300025942 Ga0207689_10014206 Ga0207689_100142066 458
39 3300026089 Ga0207648_10087474 Ga0207648_100874742 458
40 3300026118 Ga0207675_100005173 Ga0207675_10000517311 458
41 3300028381 Ga0268264_10002631 Ga0268264_100026317 458
42 3300005539 Ga0068853_100076495 Ga0068853_1000764952 460
43 3300009545 Ga0105237_10001962 Ga0105237_1000196215 460
44 3300025914 Ga0207671_10004030 Ga0207671_1000403013 461
45 iso_pu_bacteria 2911138879 2911138926 462
46 3300002737 JGI25162J39368_1000121 JGI25162J39368_100012140 463
47 3300009093 Ga0105240_10000283 Ga0105240_1000028324 463
48 3300009174 Ga0105241_10003973 Ga0105241_100039737 463
49 3300009545 Ga0105237_10080916 Ga0105237_100809163 463
50 3300010375 Ga0105239_10000132 Ga0105239_1000013230 463
51 3300013105 Ga0157369_10001695 Ga0157369_1000169516 463
52 3300013307 Ga0157372_10000011 Ga0157372_10000011121 463
53 3300013307 Ga0157372_10015408 Ga0157372_100154082 463
54 3300015261 Ga0182006_1001324 Ga0182006_10013244 463
55 3300017792 Ga0163161_10017912 Ga0163161_100179123 463
56 3300025233 Ga0209437_100017 Ga0209437_100017502 463
57 3300025913 Ga0207695_10000684 Ga0207695_1000068450 463
58 3300025913 Ga0207695_10219468 Ga0207695_102194682 463
59 3300025914 Ga0207671_10003445 Ga0207671_100034455 463
60 3300037312 Ga0395899_0000188 Ga0395899_0000188_85825_87279 463
61 3300044656 Ga0466969_0035181 Ga0466969_0035181_737_2191 463
62 3300044684 Ga0466966_0019459 Ga0466966_0019459_1762_3216 463
63 3300044693 Ga0466961_0035312 Ga0466961_0035312_1705_3159 463
64 3300045836 Ga0466958_0039730 Ga0466958_0039730_261_1715 463
65 3300046524 Ga0495648_0043766 Ga0495648_0043766_42_1466 463
66 3300046665 Ga0495661_0001031 Ga0495661_0001031_5862_7286 463
67 3300046665 Ga0495661_0058503 Ga0495661_0058503_408_1832 463
68 3300047472 Ga0495686_0046651 Ga0495686_0046651_286_1710 463
69 3300005985 Ga0081539_10000337 Ga0081539_1000033742 464
70 3300041997 Ga0439431_0000539 Ga0439431_0000539_771_2408 464
71 3300046518 Ga0495631_0005500 Ga0495631_0005500_3514_4941 464
72 3300049571 Ga0501034_0034236 Ga0501034_0034236_2676_4106 464
73 3300053142 Ga0500577_0001759 Ga0500577_0001759_2679_4109 464
74 3300005530 Ga0070679_100042032 Ga0070679_1000420324 465
75 3300009098 Ga0105245_10112423 Ga0105245_101124232 465
76 3300009101 Ga0105247_10037070 Ga0105247_100370702 465
77 3300009174 Ga0105241_10001533 Ga0105241_100015338 465
78 3300009545 Ga0105237_10115306 Ga0105237_101153061 465
79 3300009553 Ga0105249_10012134 Ga0105249_100121343 465
80 3300013296 Ga0157374_10191255 Ga0157374_101912552 465
81 3300013297 Ga0157378_10149541 Ga0157378_101495413 465
82 3300013306 Ga0163162_10063136 Ga0163162_100631361 465
83 3300013308 Ga0157375_10227951 Ga0157375_102279513 465
84 3300014969 Ga0157376_10026381 Ga0157376_100263814 465
85 3300025242 Ga0209258_100029 Ga0209258_10002925 465
86 3300025254 Ga0209148_1000163 Ga0209148_100016342 465
87 3300053088 Ga0500644_0000528 Ga0500644_0000528_12472_13902 465
88 3300053092 Ga0500583_0030849 Ga0500583_0030849_44_1474 465
89 3300053121 Ga0500607_045016 Ga0500607_045016_751_2181 465
90 3300053160 Ga0500633_0001643 Ga0500633_0001643_854_2284 465
91 3300032004 Ga0307414_10114465 Ga0307414_101144651 466
92 3300044656 Ga0466969_0028693 Ga0466969_0028693_858_2291 466
93 3300044719 Ga0466971_0017089 Ga0466971_0017089_588_2021 466
94 3300045049 Ga0466959_0008498 Ga0466959_0008498_3010_4443 466
95 3300045836 Ga0466958_0080989 Ga0466958_0080989_550_1983 466
96 3300003354 JGI25160J50197_1007572 JGI25160J50197_10075723 467
97 3300003790 Ga0055528_1000572 Ga0055528_100057219 467
98 3300003794 Ga0055531_10014302 Ga0055531_100143023 467
99 3300005262 Ga0065165_1000017 Ga0065165_100001741 467
100 3300005539 Ga0068853_100044328 Ga0068853_1000443282 467
101 3300005563 Ga0068855_100006355 Ga0068855_1000063556 467
102 3300005577 Ga0068857_100076669 Ga0068857_1000766692 467
103 3300009174 Ga0105241_10081126 Ga0105241_100811262 467
104 3300009545 Ga0105237_10023345 Ga0105237_100233455 467
105 3300013297 Ga0157378_10032461 Ga0157378_100324614 467
106 3300015261 Ga0182006_1000166 Ga0182006_100016618 467
107 3300025273 Ga0209673_1000354 Ga0209673_100035421 467
108 3300025295 Ga0209564_1003201 Ga0209564_10032017 467
109 3300025297 Ga0209758_1003655 Ga0209758_10036553 467
110 3300025298 Ga0209050_1000163 Ga0209050_100016313 467
111 3300025302 Ga0207426_1002304 Ga0207426_10023047 467
112 3300025304 Ga0209257_1005362 Ga0209257_10053624 467
113 3300025949 Ga0207667_10007728 Ga0207667_100077284 467
114 3300026116 Ga0207674_10092281 Ga0207674_100922812 467
115 iso_pu_bacteria 2929239360 2929239493 467
116 3300005548 Ga0070665_100000001 Ga0070665_100000001219 468
117 3300006195 Ga0075366_10068606 Ga0075366_100686062 468
118 3300025295 Ga0209564_1004937 Ga0209564_10049373 468
119 3300028379 Ga0268266_10000232 Ga0268266_1000023270 468
120 3300046660 Ga0495625_0012165 Ga0495625_0012165_5405_6844 468
121 3300013102 Ga0157371_10000050 Ga0157371_1000005016 469
122 3300013297 Ga0157378_10024654 Ga0157378_100246542 469
123 3300017792 Ga0163161_10000574 Ga0163161_100005742 469
124 3300025914 Ga0207671_10001126 Ga0207671_100011266 469
125 3300031903 Ga0307407_10000017 Ga0307407_1000001748 469
126 3300032002 Ga0307416_100000011 Ga0307416_10000001193 469
127 3300046512 Ga0495610_0000151 Ga0495610_0000151_2234_3694 469
128 3300053093 Ga0500651_0000646 Ga0500651_0000646_11653_13101 469
129 3300005563 Ga0068855_100007153 Ga0068855_1000071534 470
130 3300017792 Ga0163161_10000215 Ga0163161_1000021535 470
131 3300017792 Ga0163161_10025057 Ga0163161_100250573 470
132 3300025949 Ga0207667_10007095 Ga0207667_100070954 470
133 3300028381 Ga0268264_10028914 Ga0268264_100289143 470
134 3300031730 Ga0307516_10000189 Ga0307516_1000018934 470
135 3300048918 Ga0496115_0114154 Ga0496115_0114154_311_1765 470
136 iso_pu_bacteria 2599185184 2599477146 470
137 iso_pu_bacteria 2852623160 2852623552 470
138 iso_pu_bacteria 2884933994 2884937546 470
139 iso_pu_bacteria 2919437846 2919442076 470
140 iso_pu_bacteria 2928078545 2928079059 470
141 iso_pu_bacteria 2928147474 2928148570 470
142 iso_pu_bacteria 2932082852 2932085864 470
143 3300005563 Ga0068855_100000090 Ga0068855_10000009038 471
144 3300013297 Ga0157378_10009998 Ga0157378_100099982 471
145 3300025949 Ga0207667_10000009 Ga0207667_10000009334 471
146 3300047443 Ga0495687_000001 Ga0495687_000001_971503_972960 471
147 iso_pu_bacteria 2738541302 2738855151 471
148 iso_pu_bacteria 2818991437 2819547833 471
149 iso_pu_bacteria 2945997725 2945999747 471
150 3300005288 Ga0065714_10064508 Ga0065714_1006450833 472
151 3300005843 Ga0068860_100016152 Ga0068860_1000161526 472
152 3300013296 Ga0157374_10000007 Ga0157374_10000007480 472
153 3300013306 Ga0163162_10006867 Ga0163162_100068672 472
154 3300014969 Ga0157376_10000374 Ga0157376_1000037421 472
155 3300028381 Ga0268264_10001875 Ga0268264_100018752 472
156 3300032004 Ga0307414_10000533 Ga0307414_100005338 472
157 3300032004 Ga0307414_10056781 Ga0307414_100567812 472
158 3300001991 JGI24743J22301_10010882 JGI24743J22301_100108822 473
159 3300003316 rootH1_10049259 rootH1_100492599 473
160 3300003320 rootH2_10000343 rootH2_1000034325 473
161 3300003323 rootH1_10001370 rootH1_1000137051 473
162 3300003323 rootH1_10015649 rootH1_100156491 473
163 3300003323 rootH1_10063115 rootH1_100631153 473
164 3300003354 JGI25160J50197_1001283 JGI25160J50197_10012832 473
165 3300003781 Ga0055536_1000009 Ga0055536_1000009198 473
166 3300003791 Ga0055530_10000943 Ga0055530_100009437 473
167 3300005288 Ga0065714_10077226 Ga0065714_100772263 473
168 3300005327 Ga0070658_10137360 Ga0070658_101373601 473
169 3300005328 Ga0070676_10000140 Ga0070676_100001404 473
170 3300005329 Ga0070683_100021523 Ga0070683_1000215234 473
171 3300005331 Ga0070670_100137395 Ga0070670_1001373952 473
172 3300005334 Ga0068869_100140679 Ga0068869_1001406792 473
173 3300005335 Ga0070666_10025999 Ga0070666_100259992 473
174 3300005338 Ga0068868_100019165 Ga0068868_1000191651 473
175 3300005338 Ga0068868_100039680 Ga0068868_1000396802 473
176 3300005339 Ga0070660_100004493 Ga0070660_1000044932 473
177 3300005344 Ga0070661_100011648 Ga0070661_1000116482 473
178 3300005354 Ga0070675_100112069 Ga0070675_1001120692 473
179 3300005364 Ga0070673_100019435 Ga0070673_1000194353 473
180 3300005364 Ga0070673_100052488 Ga0070673_1000524882 473
181 3300005365 Ga0070688_100056164 Ga0070688_1000561642 473
182 3300005366 Ga0070659_100013275 Ga0070659_1000132752 473
183 3300005456 Ga0070678_100007973 Ga0070678_1000079734 473
184 3300005457 Ga0070662_100000081 Ga0070662_10000008111 473
185 3300005457 Ga0070662_100015275 Ga0070662_1000152753 473
186 3300005459 Ga0068867_100000843 Ga0068867_10000084314 473
187 3300005459 Ga0068867_100142024 Ga0068867_1001420242 473
188 3300005530 Ga0070679_100007702 Ga0070679_1000077028 473
189 3300005539 Ga0068853_100023658 Ga0068853_1000236583 473
190 3300005539 Ga0068853_100091621 Ga0068853_1000916212 473
191 3300005548 Ga0070665_100000072 Ga0070665_100000072153 473
192 3300005563 Ga0068855_100092382 Ga0068855_1000923822 473
193 3300005564 Ga0070664_100049893 Ga0070664_1000498934 473
194 3300005577 Ga0068857_100045029 Ga0068857_1000450292 473
195 3300005577 Ga0068857_100143997 Ga0068857_1001439971 473
196 3300005578 Ga0068854_100060967 Ga0068854_1000609672 473
197 3300005614 Ga0068856_100000129 Ga0068856_10000012934 473
198 3300005614 Ga0068856_100131497 Ga0068856_1001314972 473
199 3300005616 Ga0068852_100000281 Ga0068852_1000002815 473
200 3300006237 Ga0097621_100000039 Ga0097621_10000003922 473
201 3300006358 Ga0068871_100002549 Ga0068871_10000254910 473
202 3300006358 Ga0068871_100034096 Ga0068871_1000340963 473
203 3300006881 Ga0068865_100000180 Ga0068865_10000018025 473
204 3300009174 Ga0105241_10000514 Ga0105241_1000051418 473
205 3300009174 Ga0105241_10006553 Ga0105241_100065534 473
206 3300009545 Ga0105237_10022043 Ga0105237_100220434 473
207 3300009551 Ga0105238_10002377 Ga0105238_100023774 473
208 3300009553 Ga0105249_10004268 Ga0105249_100042685 473
209 3300010375 Ga0105239_10071450 Ga0105239_100714502 473
210 3300011119 Ga0105246_10041915 Ga0105246_100419152 473
211 3300013296 Ga0157374_10000135 Ga0157374_1000013549 473
212 3300013296 Ga0157374_10003320 Ga0157374_100033202 473
213 3300013296 Ga0157374_10121795 Ga0157374_101217952 473
214 3300013297 Ga0157378_10188375 Ga0157378_101883752 473
215 3300013307 Ga0157372_10367948 Ga0157372_103679482 473
216 3300014497 Ga0182008_10000012 Ga0182008_10000012251 473
217 3300025246 Ga0209646_1001501 Ga0209646_10015013 473
218 3300025292 Ga0209676_1000001 Ga0209676_10000011152 473
219 3300025298 Ga0209050_1000018 Ga0209050_1000018432 473
220 3300025302 Ga0207426_1000093 Ga0207426_1000093144 473
221 3300025904 Ga0207647_10000058 Ga0207647_1000005822 473
222 3300025907 Ga0207645_10001698 Ga0207645_1000169813 473
223 3300025911 Ga0207654_10006862 Ga0207654_100068624 473
224 3300025913 Ga0207695_10016050 Ga0207695_100160502 473
225 3300025919 Ga0207657_10008412 Ga0207657_100084129 473
226 3300025926 Ga0207659_10068846 Ga0207659_100688461 473
227 3300025931 Ga0207644_10098507 Ga0207644_100985072 473
228 3300025932 Ga0207690_10118169 Ga0207690_101181691 473
229 3300025933 Ga0207706_10000147 Ga0207706_1000014737 473
230 3300025933 Ga0207706_10003522 Ga0207706_100035227 473
231 3300025938 Ga0207704_10000076 Ga0207704_1000007618 473
232 3300025942 Ga0207689_10109231 Ga0207689_101092312 473
233 3300025944 Ga0207661_10140985 Ga0207661_101409851 473
234 3300025945 Ga0207679_10014731 Ga0207679_100147312 473
235 3300025949 Ga0207667_10259955 Ga0207667_102599551 473
236 3300025960 Ga0207651_10013810 Ga0207651_100138103 473
237 3300025960 Ga0207651_10083717 Ga0207651_100837172 473
238 3300025981 Ga0207640_10187732 Ga0207640_101877321 473
239 3300026023 Ga0207677_10010111 Ga0207677_100101111 473
240 3300026041 Ga0207639_10012990 Ga0207639_100129904 473
241 3300026041 Ga0207639_10040244 Ga0207639_100402441 473
242 3300026078 Ga0207702_10000300 Ga0207702_1000030047 473
243 3300026078 Ga0207702_10043918 Ga0207702_100439182 473
244 3300026089 Ga0207648_10000648 Ga0207648_100006483 473
245 3300026095 Ga0207676_10237559 Ga0207676_102375591 473
246 3300026116 Ga0207674_10045717 Ga0207674_100457172 473
247 3300026121 Ga0207683_10038383 Ga0207683_100383833 473
248 3300026121 Ga0207683_10125373 Ga0207683_101253731 473
249 3300026142 Ga0207698_10044934 Ga0207698_100449342 473
250 3300028379 Ga0268266_10000089 Ga0268266_10000089151 473
251 3300033180 Ga0307510_10004144 Ga0307510_100041447 473
252 3300039447 Ga0436361_0803447 Ga0436361_0803447_1820_3274 473
253 3300046616 Ga0495668_0000513 Ga0495668_0000513_26327_27787 473
254 3300049758 Ga0501241_009072 Ga0501241_009072_214_1779 473
255 3300053131 Ga0500652_015478 Ga0500652_015478_811_2280 473
256 3300053139 Ga0500568_0037049 Ga0500568_0037049_331_1800 473
257 iso_pu_bacteria 2775506987 2776613809 473
258 3300001990 JGI24737J22298_10000041 JGI24737J22298_100000416 474
259 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001485 474
260 3300003316 rootH1_10026547 rootH1_100265479 474
261 3300003320 rootH2_10021608 rootH2_100216082 474
262 3300003322 rootL2_10125616 rootL2_101256162 474
263 3300005288 Ga0065714_10009241 Ga0065714_100092413 474
264 3300005327 Ga0070658_10000080 Ga0070658_1000008011 474
265 3300005335 Ga0070666_10000042 Ga0070666_1000004282 474
266 3300005338 Ga0068868_100046323 Ga0068868_1000463232 474
267 3300005347 Ga0070668_100026530 Ga0070668_1000265303 474
268 3300005355 Ga0070671_100036952 Ga0070671_1000369523 474
269 3300005355 Ga0070671_100074571 Ga0070671_1000745712 474
270 3300005366 Ga0070659_100005576 Ga0070659_1000055765 474
271 3300005367 Ga0070667_100040632 Ga0070667_1000406323 474
272 3300005563 Ga0068855_100013657 Ga0068855_1000136574 474
273 3300005563 Ga0068855_100127328 Ga0068855_1001273282 474
274 3300005614 Ga0068856_100028219 Ga0068856_1000282193 474
275 3300005617 Ga0068859_100000130 Ga0068859_10000013045 474
276 3300005618 Ga0068864_100002546 Ga0068864_10000254614 474
277 3300005841 Ga0068863_100008085 Ga0068863_1000080857 474
278 3300005841 Ga0068863_100220245 Ga0068863_1002202452 474
279 3300005842 Ga0068858_100003098 Ga0068858_1000030986 474
280 3300005843 Ga0068860_100001453 Ga0068860_10000145318 474
281 3300006195 Ga0075366_10002447 Ga0075366_100024471 474
282 3300006237 Ga0097621_100000081 Ga0097621_10000008110 474
283 3300006237 Ga0097621_100009477 Ga0097621_1000094774 474
284 3300006358 Ga0068871_100000300 Ga0068871_10000030020 474
285 3300006931 Ga0097620_100000130 Ga0097620_10000013023 474
286 3300009174 Ga0105241_10105016 Ga0105241_101050162 474
287 3300009545 Ga0105237_10000411 Ga0105237_1000041117 474
288 3300009545 Ga0105237_10009372 Ga0105237_100093726 474
289 3300009545 Ga0105237_10013274 Ga0105237_100132745 474
290 3300009553 Ga0105249_10016508 Ga0105249_100165085 474
291 3300010375 Ga0105239_10000106 Ga0105239_1000010642 474
292 3300010375 Ga0105239_10000528 Ga0105239_100005284 474
293 3300010375 Ga0105239_10006197 Ga0105239_1000619712 474
294 3300010375 Ga0105239_10016107 Ga0105239_100161072 474
295 3300013102 Ga0157371_10035312 Ga0157371_100353122 474
296 3300013104 Ga0157370_10000285 Ga0157370_1000028526 474
297 3300013105 Ga0157369_10183580 Ga0157369_101835802 474
298 3300013297 Ga0157378_10005063 Ga0157378_100050632 474
299 3300013306 Ga0163162_10003016 Ga0163162_100030164 474
300 3300013306 Ga0163162_10091521 Ga0163162_100915213 474
301 3300013307 Ga0157372_10001527 Ga0157372_1000152721 474
302 3300013308 Ga0157375_10000250 Ga0157375_1000025034 474
303 3300013308 Ga0157375_10041548 Ga0157375_100415483 474
304 3300014325 Ga0163163_10000389 Ga0163163_1000038924 474
305 3300014325 Ga0163163_10037815 Ga0163163_100378153 474
306 3300014497 Ga0182008_10000078 Ga0182008_1000007827 474
307 3300014968 Ga0157379_10149917 Ga0157379_101499171 474
308 3300014969 Ga0157376_10003324 Ga0157376_100033244 474
309 3300015261 Ga0182006_1000297 Ga0182006_100029712 474
310 3300017792 Ga0163161_10015258 Ga0163161_100152585 474
311 3300025900 Ga0207710_10059063 Ga0207710_100590632 474
312 3300025903 Ga0207680_10000228 Ga0207680_100002284 474
313 3300025904 Ga0207647_10000028 Ga0207647_1000002858 474
314 3300025904 Ga0207647_10015760 Ga0207647_100157602 474
315 3300025909 Ga0207705_10000035 Ga0207705_1000003590 474
316 3300025913 Ga0207695_10150857 Ga0207695_101508572 474
317 3300025914 Ga0207671_10001753 Ga0207671_1000175317 474
318 3300025914 Ga0207671_10006546 Ga0207671_100065465 474
319 3300025925 Ga0207650_10140639 Ga0207650_101406391 474
320 3300025931 Ga0207644_10026621 Ga0207644_100266213 474
321 3300025932 Ga0207690_10010265 Ga0207690_100102654 474
322 3300025938 Ga0207704_10068098 Ga0207704_100680982 474
323 3300025942 Ga0207689_10027846 Ga0207689_100278464 474
324 3300025949 Ga0207667_10105740 Ga0207667_101057403 474
325 3300025986 Ga0207658_10053090 Ga0207658_100530903 474
326 3300026023 Ga0207677_10099398 Ga0207677_100993982 474
327 3300026078 Ga0207702_10036631 Ga0207702_100366313 474
328 3300026088 Ga0207641_10000158 Ga0207641_1000015823 474
329 3300026088 Ga0207641_10091729 Ga0207641_100917291 474
330 3300028381 Ga0268264_10001350 Ga0268264_100013509 474
331 3300028794 Ga0307515_10000246 Ga0307515_1000024682 474
332 3300028794 Ga0307515_10000993 Ga0307515_1000099320 474
333 3300031251 Ga0265327_10000284 Ga0265327_1000028422 474
334 3300031507 Ga0307509_10198039 Ga0307509_101980392 474
335 3300033179 Ga0307507_10001380 Ga0307507_1000138020 474
336 3300037312 Ga0395899_0000888 Ga0395899_0000888_24480_25937 474
337 3300037418 Ga0395900_0000226 Ga0395900_0000226_48095_49552 474
338 3300037466 Ga0395898_0004590 Ga0395898_0004590_1661_3118 474
339 3300037471 Ga0395905_0000068 Ga0395905_0000068_139233_140690 474
340 3300038443 Ga0395901_0000136 Ga0395901_0000136_70240_71697 474
341 3300039437 Ga0436365_0269604 Ga0436365_0269604_247_1710 474
342 3300046471 Ga0495650_0000273 Ga0495650_0000273_47067_48524 474
343 3300046492 Ga0495585_0000132 Ga0495585_0000132_70090_71547 474
344 3300046492 Ga0495585_0037031 Ga0495585_0037031_190_1647 474
345 3300046506 Ga0495583_0045690 Ga0495583_0045690_242_1699 474
346 3300046507 Ga0495606_0000130 Ga0495606_0000130_49219_50676 474
347 3300046507 Ga0495606_0011133 Ga0495606_0011133_4060_5517 474
348 3300046512 Ga0495610_0002033 Ga0495610_0002033_3554_5011 474
349 3300046513 Ga0495616_0002729 Ga0495616_0002729_5940_7397 474
350 3300046538 Ga0495609_0039161 Ga0495609_0039161_582_2039 474
351 3300046558 Ga0495633_0000035 Ga0495633_0000035_27811_29268 474
352 3300046558 Ga0495633_0009219 Ga0495633_0009219_3216_4673 474
353 3300046616 Ga0495668_0000032 Ga0495668_0000032_167313_168770 474
354 3300046660 Ga0495625_0000036 Ga0495625_0000036_214239_215696 474
355 3300046660 Ga0495625_0000227 Ga0495625_0000227_62200_63657 474
356 3300046660 Ga0495625_0000358 Ga0495625_0000358_6051_7508 474
357 3300046660 Ga0495625_0050616 Ga0495625_0050616_796_2253 474
358 3300046665 Ga0495661_0010531 Ga0495661_0010531_83_1540 474
359 3300046694 Ga0495649_0000017 Ga0495649_0000017_5985_7442 474
360 3300046810 Ga0495660_0005464 Ga0495660_0005464_925_2382 474
361 3300047443 Ga0495687_002988 Ga0495687_002988_4066_5523 474
362 3300047443 Ga0495687_005612 Ga0495687_005612_4941_6398 474
363 3300047472 Ga0495686_0033922 Ga0495686_0033922_308_1765 474
364 3300048926 Ga0496123_0012248 Ga0496123_0012248_5639_7096 474
365 3300050493 nmdc:mga0k408_1683_c1 nmdc:mga0k408_1683_c1_43_1500 474
366 3300050493 nmdc:mga0k408_23843_c1 nmdc:mga0k408_23843_c1_457_1914 474
367 3300053092 Ga0500583_0000367 Ga0500583_0000367_11407_12873 474
368 3300053125 Ga0500618_000004 Ga0500618_000004_250830_252287 474
369 3300003322 rootL2_10253563 rootL2_102535632 475
370 3300025914 Ga0207671_10036741 Ga0207671_100367411 475
371 3300025924 Ga0207694_10133450 Ga0207694_101334503 475
372 iso_pu_bacteria 2738541284 2738764338 475
373 3300005289 Ga0065704_10074770 Ga0065704_100747704 476
374 3300028794 Ga0307515_10000707 Ga0307515_1000070718 476
375 3300002738 JGI25154J39366_1000100 JGI25154J39366_100010043 477
376 3300002741 JGI25157J39369_1004602 JGI25157J39369_10046022 477
377 3300005288 Ga0065714_10002263 Ga0065714_1000226352 477
378 3300025246 Ga0209646_1000006 Ga0209646_100000619 477
379 3300025250 Ga0209026_1000954 Ga0209026_10009548 477
380 3300033180 Ga0307510_10001267 Ga0307510_1000126721 477
381 3300013100 Ga0157373_10009612 Ga0157373_100096124 478
382 3300009174 Ga0105241_10054143 Ga0105241_100541432 479
383 3300003322 rootL2_10089064 rootL2_100890642 480
384 3300013306 Ga0163162_10000097 Ga0163162_1000009729 480
385 3300003323 rootH1_10015647 rootH1_100156473 481
386 3300002737 JGI25162J39368_1002782 JGI25162J39368_10027825 482
387 3300003214 JGI25165J46597_1001237 JGI25165J46597_10012374 482
388 3300025231 Ga0207427_100125 Ga0207427_10012564 482
389 3300025233 Ga0209437_100008 Ga0209437_100008596 482
390 3300025261 Ga0209233_1000024 Ga0209233_100002461 482
391 iso_pu_bacteria 2896109856 2896110560 482
392 2162886007 SwRhRL2b_contig_2471198 SwRhRL2b_0741.00000750 491
393 3300013102 Ga0157371_10001867 Ga0157371_1000186711 491
394 3300013104 Ga0157370_10015299 Ga0157370_100152992 491
395 2162886007 SwRhRL2b_contig_1109292 SwRhRL2b_0698.00006380 494
396 2162886007 SwRhRL2b_contig_1157535 SwRhRL2b_0197.00007440 494
397 3300005288 Ga0065714_10002864 Ga0065714_1000286438 494
398 3300005289 Ga0065704_10000229 Ga0065704_1000022913 494
399 3300013100 Ga0157373_10000261 Ga0157373_1000026111 494
400 3300013102 Ga0157371_10001830 Ga0157371_100018303 494
401 3300015261 Ga0182006_1003364 Ga0182006_10033645 494
402 3300031911 Ga0307412_10000045 Ga0307412_10000045140 494
403 3300032004 Ga0307414_10019489 Ga0307414_100194893 494

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

304

491

0.97

PF02321

OEP

Outer membrane efflux protein

126

282

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1m-assembly2.cif.gz_C conformational flexibility in the multidrug efflux system protein acra 0.9526 207 282
3mxz-assembly1.cif.gz_A crystal structure of tubulin folding cofactor a from arabidopsis thaliana 0.9401 204 281
2f1m-assembly1.cif.gz_A conformational flexibility in the multidrug efflux system protein acra 0.9285 205 282
2f1m-assembly2.cif.gz_D conformational flexibility in the multidrug efflux system protein acra 0.9172 205 282
5ng5-assembly1.cif.gz_B multi-drug efflux; membrane transport; rnd superfamily; drug resistance 0.8533 207 284
ID Description Score Start End Superfamily
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9595 207 278 1.10.287.470
3mxzA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9401 204 281 1.20.58.90
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9307 207 278 1.10.287.470
2f1mA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9299 207 278 1.10.287.470
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9223 207 278 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A512B371-F1-model_v4 Membrane protein 0.8768 46 494 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A2P8FRT5-F1-model_v4 Outer membrane efflux protein 0.8621 32 494 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A1G8BL73-F1-model_v4 Outer membrane protein TolC 0.8555 32 494 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A433WC78-F1-model_v4 TolC family protein 0.8539 31 492 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A512B371-F1-model_v4 Membrane protein 0.8449 46 494 GO:0009279
GO:0015288
GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
85.56 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map