F435329

General Info

Members Datasets Scaffolds Average Seq Length
403 179 806 412

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100129660|Ga0070679_1001296602
Length 436
Sequence MIKAVKGTRDILPPASAVWNRVEAQAREVFRTFNYHEIRTPIFEETALFARGVGEDTDIVGKEMYTWEDRDGSSLTLRPEATASVMRAYIEHRLDQIPGIKKFYYIGPMFRRERPQKGRYRQFFQIGAEAIGSESPIVDAEVIEMVVELLRRAGLHPAAGYESGAEVPAIAKRGQDGFHLILNSVGCATCRPKFMAALKEKLTTIAPALCADCQRRATTNPLRVLDCKVPDDQAAIDTLPSILDYLCEDCHAHFRIVQEHLRQRGIPFEVRPRLVRGLDYYMRTTFEITHGSLGAQNSVLGGGRYDGLAEALGSKVPAPGIGFSIGEDRLVMSVEEAHPEGHQPSVDVFLAPLGDVAEQHAGALAAELRGAGISVERSVDRKXKRALETANKMGARFALILGDNEIAAGTYLMKDMATGEQVSLSREALAAHIQKN

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.25
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100129660 3300005530 Bacteria 2503
2 Ga0070658_10071131 3300005327 Bacteria 2849
3 Ga0070683_100000030 3300005329 Bacteria 152931
4 Ga0070683_100210180 3300005329 Unclassified 1849
5 Ga0068869_100070670 3300005334 Bacteria 2583
6 Ga0070666_10013648 3300005335 Bacteria 5158
7 Ga0070680_100005103 3300005336 Bacteria 9912
8 Ga0068868_100046129 3300005338 Bacteria 3411
9 Ga0070661_100058706 3300005344 Bacteria 2820
10 Ga0070661_100109517 3300005344 Bacteria 2061
11 Ga0070671_100112213 3300005355 Bacteria 2290
12 Ga0070673_100109929 3300005364 Bacteria 2284
13 Ga0070659_100004981 3300005366 Bacteria 9509
14 Ga0070659_100146269 3300005366 Bacteria 1925
15 Ga0070667_100180803 3300005367 Bacteria 1865
16 Ga0070714_100002212 3300005435 Bacteria 14324
17 Ga0070713_100005915 3300005436 Bacteria 8412
18 Ga0070713_100084573 3300005436 Bacteria 2715
19 Ga0070711_100020680 3300005439 Bacteria 4246
20 Ga0070711_100233613 3300005439 Bacteria 1435
21 Ga0070708_100049780 3300005445 Bacteria 3708
22 Ga0070681_10006510 3300005458 Bacteria 11364
23 Ga0070681_10035486 3300005458 Bacteria 5010
24 Ga0070681_10123243 3300005458 Bacteria 2524
25 Ga0070681_10231973 3300005458 Bacteria 1760
26 Ga0068867_100032082 3300005459 Bacteria 3796
27 Ga0070699_100062345 3300005518 Bacteria 3231
28 Ga0070679_100032577 3300005530 Bacteria 5156
29 Ga0070679_100069588 3300005530 Bacteria 3510
30 Ga0070679_100137754 3300005530 Bacteria 2422
31 Ga0070684_100000088 3300005535 Bacteria 60042
32 Ga0070684_100040734 3300005535 Bacteria 4001
33 Ga0070684_100058333 3300005535 Bacteria 3374
34 Ga0070684_100074016 3300005535 Bacteria 3003
35 Ga0070684_100078523 3300005535 Bacteria 2916
36 Ga0068853_100003168 3300005539 Bacteria 12577
37 Ga0068853_100012305 3300005539 Bacteria 6959
38 Ga0068853_100104475 3300005539 Bacteria 2508
39 Ga0070695_100031477 3300005545 Bacteria 3310
40 Ga0070696_100022404 3300005546 Bacteria 4291
41 Ga0070693_100020687 3300005547 Bacteria 3476
42 Ga0070665_100048836 3300005548 Bacteria 4248
43 Ga0068855_100010390 3300005563 Bacteria 11229
44 Ga0068855_100016542 3300005563 Bacteria 8872
45 Ga0068855_100020234 3300005563 Bacteria 7989
46 Ga0068855_100034568 3300005563 Bacteria 6026
47 Ga0068855_100205027 3300005563 Bacteria 2219
48 Ga0068855_100205582 3300005563 Bacteria 2215
49 Ga0070664_100022505 3300005564 Bacteria 5198
50 Ga0068857_100000632 3300005577 Bacteria 25867
51 Ga0068857_100085723 3300005577 Bacteria 2815
52 Ga0068856_100000805 3300005614 Bacteria 33867
53 Ga0068856_100022137 3300005614 Bacteria 6180
54 Ga0068856_100043298 3300005614 Bacteria 4429
55 Ga0068856_100050752 3300005614 Bacteria 4090
56 Ga0068856_100069872 3300005614 Bacteria 3473
57 Ga0068866_10026230 3300005718 Bacteria 2749
58 Ga0068863_100072684 3300005841 Bacteria 3254
59 Ga0068858_100160040 3300005842 Bacteria 2120
60 Ga0070717_10001489 3300006028 Bacteria 16216
61 Ga0070717_10013870 3300006028 Bacteria 6190
62 Ga0097621_100016289 3300006237 Bacteria 5615
63 Ga0097621_100019894 3300006237 Bacteria 5164
64 Ga0097621_100062091 3300006237 Bacteria 3067
65 Ga0097621_100151062 3300006237 Bacteria 1992
66 Ga0068871_100049080 3300006358 Bacteria 3410
67 Ga0068871_100057958 3300006358 Bacteria 3152
68 Ga0068871_100093528 3300006358 Bacteria 2508
69 Ga0068871_100096785 3300006358 Bacteria 2466
70 Ga0075431_100025542 3300006847 Bacteria 6056
71 Ga0068865_100019496 3300006881 Bacteria 4390
72 Ga0105240_10000855 3300009093 Bacteria 54907
73 Ga0105240_10006864 3300009093 Bacteria 16641
74 Ga0105240_10029714 3300009093 Bacteria 7112
75 Ga0105240_10044665 3300009093 Bacteria 5627
76 Ga0105240_10186195 3300009093 Bacteria 2445
77 Ga0105245_10004408 3300009098 Bacteria 12452
78 Ga0105245_10005929 3300009098 Bacteria 10733
79 Ga0105245_10011353 3300009098 Bacteria 7758
80 Ga0105245_10062617 3300009098 Bacteria 3357
81 Ga0105245_10083156 3300009098 Bacteria 2930
82 Ga0105245_10277175 3300009098 Bacteria 1638
83 Ga0105247_10079023 3300009101 Bacteria 2070
84 Ga0105241_10011139 3300009174 Bacteria 6593
85 Ga0105241_10025412 3300009174 Bacteria 4401
86 Ga0105241_10030234 3300009174 Bacteria 4046
87 Ga0105241_10031623 3300009174 Bacteria 3963
88 Ga0105241_10110394 3300009174 Bacteria 2200
89 Ga0105241_10115954 3300009174 Bacteria 2150
90 Ga0105241_10169681 3300009174 Bacteria 1801
91 Ga0105242_10008201 3300009176 Bacteria 8025
92 Ga0105242_10126425 3300009176 Bacteria 2201
93 Ga0105242_10131555 3300009176 Bacteria 2161
94 Ga0105242_10135608 3300009176 Bacteria 2130
95 Ga0105242_10157004 3300009176 Bacteria 1988
96 Ga0105248_10006327 3300009177 Bacteria 12994
97 Ga0105248_10006887 3300009177 Bacteria 12458
98 Ga0105248_10110807 3300009177 Bacteria 3095
99 Ga0105248_10142010 3300009177 Bacteria 2709
100 Ga0105237_10000802 3300009545 Bacteria 42922
101 Ga0105237_10013306 3300009545 Bacteria 8630
102 Ga0105237_10081883 3300009545 Bacteria 3219
103 Ga0105237_10115531 3300009545 Bacteria 2677
104 Ga0105237_10142521 3300009545 Bacteria 2391
105 Ga0105237_10172705 3300009545 Bacteria 2162
106 Ga0105237_10192822 3300009545 Bacteria 2037
107 Ga0105237_10198285 3300009545 Bacteria 2007
108 Ga0105237_10230312 3300009545 Bacteria 1854
109 Ga0105238_10002330 3300009551 Bacteria 19101
110 Ga0105238_10013017 3300009551 Bacteria 8396
111 Ga0105238_10019260 3300009551 Bacteria 6952
112 Ga0105238_10066246 3300009551 Bacteria 3614
113 Ga0105249_10013795 3300009553 Bacteria 7139
114 Ga0105249_10070577 3300009553 Bacteria 3225
115 Ga0105239_10004969 3300010375 Bacteria 15704
116 Ga0105239_10007540 3300010375 Bacteria 12478
117 Ga0105239_10154337 3300010375 Bacteria 2563
118 Ga0105239_10505201 3300010375 Bacteria 1375
119 Ga0105246_10015435 3300011119 Bacteria 4826
120 Ga0157373_10040511 3300013100 Bacteria 3333
121 Ga0157371_10177314 3300013102 Bacteria 1524
122 Ga0157370_10003445 3300013104 Bacteria 18570
123 Ga0157370_10011718 3300013104 Bacteria 9153
124 Ga0157370_10014852 3300013104 Bacteria 7946
125 Ga0157370_10126762 3300013104 Bacteria 2383
126 Ga0157369_10000445 3300013105 Bacteria 54768
127 Ga0157369_10012123 3300013105 Bacteria 9786
128 Ga0157369_10057931 3300013105 Bacteria 4179
129 Ga0157369_10106372 3300013105 Bacteria 2986
130 Ga0157369_10155245 3300013105 Bacteria 2418
131 Ga0157369_10273053 3300013105 Bacteria 1761
132 Ga0157374_10012321 3300013296 Bacteria 7440
133 Ga0157374_10186290 3300013296 Bacteria 2029
134 Ga0157378_10006800 3300013297 Bacteria 9978
135 Ga0157378_10016703 3300013297 Bacteria 6431
136 Ga0163162_10141716 3300013306 Bacteria 2518
137 Ga0157372_10029268 3300013307 Bacteria 6013
138 Ga0157375_10007926 3300013308 Bacteria 9298
139 Ga0163163_10018046 3300014325 Bacteria 6593
140 Ga0163163_10258800 3300014325 Bacteria 1791
141 Ga0157376_10010601 3300014969 Bacteria 6749
142 Ga0157376_10112861 3300014969 Bacteria 2395
143 Ga0157376_10122490 3300014969 Bacteria 2307
144 Ga0213872_10000930 3300021361 Bacteria 20639
145 Ga0213876_10003728 3300021384 Bacteria 8638
146 Ga0213876_10006910 3300021384 Bacteria 6183
147 Ga0213876_10036278 3300021384 Bacteria 2601
148 Ga0213875_10000006 3300021388 Bacteria 579005
149 Ga0213875_10000065 3300021388 Bacteria 128682
150 Ga0213875_10004805 3300021388 Bacteria 7344
151 Ga0213875_10005460 3300021388 Bacteria 6815
152 Ga0213875_10048902 3300021388 Bacteria 1983
153 Ga0207654_10037716 3300025911 Bacteria 2707
154 Ga0207654_10090377 3300025911 Bacteria 1865
155 Ga0207707_10000744 3300025912 Bacteria 32131
156 Ga0207707_10070429 3300025912 Bacteria 3047
157 Ga0207707_10111617 3300025912 Bacteria 2390
158 Ga0207707_10139283 3300025912 Bacteria 2121
159 Ga0207707_10175568 3300025912 Bacteria 1872
160 Ga0207707_10178646 3300025912 Bacteria 1853
161 Ga0207695_10002919 3300025913 Bacteria 24718
162 Ga0207695_10003253 3300025913 Bacteria 23096
163 Ga0207695_10004474 3300025913 Bacteria 19040
164 Ga0207695_10023034 3300025913 Bacteria 7051
165 Ga0207695_10069015 3300025913 Bacteria 3619
166 Ga0207695_10100429 3300025913 Bacteria 2889
167 Ga0207695_10142120 3300025913 Bacteria 2348
168 Ga0207671_10033440 3300025914 Bacteria 3825
169 Ga0207671_10048850 3300025914 Bacteria 3131
170 Ga0207671_10054194 3300025914 Bacteria 2972
171 Ga0207671_10111312 3300025914 Bacteria 2083
172 Ga0207657_10009515 3300025919 Bacteria 9759
173 Ga0207652_10053912 3300025921 Bacteria 3455
174 Ga0207652_10062758 3300025921 Bacteria 3211
175 Ga0207652_10107978 3300025921 Bacteria 2466
176 Ga0207652_10230285 3300025921 Bacteria 1670
177 Ga0207681_10218962 3300025923 Bacteria 1472
178 Ga0207681_10248161 3300025923 Bacteria 1389
179 Ga0207694_10005128 3300025924 Bacteria 10112
180 Ga0207694_10037406 3300025924 Bacteria 3728
181 Ga0207694_10074670 3300025924 Bacteria 2654
182 Ga0207687_10002412 3300025927 Bacteria 12676
183 Ga0207687_10036627 3300025927 Bacteria 3342
184 Ga0207687_10053768 3300025927 Bacteria 2815
185 Ga0207700_10002333 3300025928 Bacteria 10879
186 Ga0207700_10024893 3300025928 Bacteria 4149
187 Ga0207664_10006792 3300025929 Bacteria 7907
188 Ga0207644_10106977 3300025931 Bacteria 2109
189 Ga0207686_10004071 3300025934 Bacteria 7848
190 Ga0207686_10021453 3300025934 Bacteria 3707
191 Ga0207686_10056748 3300025934 Bacteria 2463
192 Ga0207691_10073650 3300025940 Bacteria 3080
193 Ga0207711_10002360 3300025941 Bacteria 16915
194 Ga0207711_10010906 3300025941 Bacteria 7553
195 Ga0207711_10093471 3300025941 Bacteria 2649
196 Ga0207711_10189218 3300025941 Bacteria 1875
197 Ga0207689_10074149 3300025942 Bacteria 2796
198 Ga0207661_10000035 3300025944 Bacteria 152976
199 Ga0207661_10001824 3300025944 Bacteria 14562
200 Ga0207661_10083869 3300025944 Bacteria 2638
201 Ga0207661_10112243 3300025944 Bacteria 2307
202 Ga0207661_10253149 3300025944 Unclassified 1566
203 Ga0207667_10009668 3300025949 Bacteria 11342
204 Ga0207667_10022312 3300025949 Bacteria 6996
205 Ga0207667_10035639 3300025949 Bacteria 5337
206 Ga0207667_10116213 3300025949 Bacteria 2757
207 Ga0207667_10132126 3300025949 Bacteria 2571
208 Ga0207712_10037752 3300025961 Bacteria 3297
209 Ga0207703_10012110 3300026035 Bacteria 6720
210 Ga0207703_10291781 3300026035 Bacteria 1485
211 Ga0207639_10020465 3300026041 Bacteria 4736
212 Ga0207639_10077161 3300026041 Bacteria 2625
213 Ga0207678_10025809 3300026067 Bacteria 5127
214 Ga0207702_10006149 3300026078 Bacteria 10391
215 Ga0207702_10007548 3300026078 Bacteria 9272
216 Ga0207702_10028495 3300026078 Bacteria 4643
217 Ga0207702_10216244 3300026078 Bacteria 1784
218 Ga0207702_10291781 3300026078 Bacteria 1545
219 Ga0207641_10093592 3300026088 Bacteria 2634
220 Ga0207641_10122142 3300026088 Bacteria 2326
221 Ga0207641_10200971 3300026088 Bacteria 1837
222 Ga0207648_10022004 3300026089 Bacteria 5727
223 Ga0207676_10020361 3300026095 Bacteria 4854
224 Ga0207674_10006088 3300026116 Bacteria 14258
225 Ga0207674_10007292 3300026116 Bacteria 12891
226 Ga0207674_10016365 3300026116 Bacteria 8121
227 Ga0207674_10017456 3300026116 Bacteria 7831
228 Ga0207674_10195295 3300026116 Bacteria 1973
229 Ga0268266_10263593 3300028379 Bacteria 1597
230 Ga0268264_10234857 3300028381 Bacteria 1695
231 Ga0265323_10000947 3300028653 Bacteria 15239
232 Ga0265338_10057839 3300028800 Bacteria 3427
233 Ga0265320_10008804 3300031240 Bacteria 6141
234 Ga0265325_10015496 3300031241 Bacteria 4285
235 Ga0265340_10010620 3300031247 Bacteria 4923
236 Ga0265340_10053672 3300031247 Bacteria 1946
237 Ga0265331_10001328 3300031250 Bacteria 18314
238 Ga0265331_10009240 3300031250 Bacteria 5552
239 Ga0265331_10069399 3300031250 Bacteria 1651
240 Ga0265316_10001997 3300031344 Bacteria 21474
241 Ga0265316_10006801 3300031344 Bacteria 10876
242 Ga0265316_10019372 3300031344 Bacteria 5822
243 Ga0265316_10020900 3300031344 Bacteria 5560
244 Ga0265316_10042040 3300031344 Bacteria 3654
245 Ga0265316_10066657 3300031344 Bacteria 2785
246 Ga0265316_10077688 3300031344 Bacteria 2549
247 Ga0265316_10105346 3300031344 Bacteria 2140
248 Ga0265313_10004278 3300031595 Bacteria 11054
249 Ga0265313_10054580 3300031595 Bacteria 1897
250 Ga0265314_10001081 3300031711 Bacteria 31584
251 Ga0265314_10008865 3300031711 Bacteria 8587
252 Ga0265314_10012274 3300031711 Bacteria 7005
253 Ga0373926_0011211 3300035083 Bacteria 3014
254 Ga0373934_0001762 3300035086 Bacteria 7959
255 Ga0373934_0005458 3300035086 Bacteria 4709
256 Ga0373923_0011183 3300035111 Bacteria 3286
257 Ga0373936_0019587 3300035113 Bacteria 2623
258 Ga0373953_0011290 3300035117 Bacteria 3131
259 Ga0373953_0018949 3300035117 Bacteria 2554
260 Ga0373954_0001710 3300035118 Bacteria 9001
261 Ga0373954_0015927 3300035118 Bacteria 3363
262 Ga0373954_0019287 3300035118 Bacteria 3075
263 Ga0373957_0017696 3300035120 Bacteria 2487
264 Ga0373943_0020250 3300035170 Bacteria 3065
265 Ga0373943_0029850 3300035170 Bacteria 2578
266 Ga0373955_0008196 3300035172 Bacteria 4841
267 Ga0373955_0100239 3300035172 Bacteria 1661
268 Ga0373935_0009717 3300035692 Bacteria 5760
269 Ga0373935_0071321 3300035692 Bacteria 2241
270 Ga0373927_0000417 3300035695 Bacteria 32693
271 Ga0373927_0001597 3300035695 Bacteria 16995
272 Ga0373927_0004369 3300035695 Bacteria 9913
273 Ga0373927_0017472 3300035695 Bacteria 4719
274 Ga0373927_0036359 3300035695 Bacteria 3203
275 Ga0373933_0009151 3300035724 Bacteria 5407
276 Ga0373933_0021481 3300035724 Bacteria 3667
277 Ga0373933_0055931 3300035724 Bacteria 2368
278 Ga0373947_0000119 3300035725 Bacteria 39799
279 Ga0373947_0013417 3300035725 Bacteria 4694
280 Ga0373947_0036376 3300035725 Bacteria 2920
281 Ga0373947_0114014 3300035725 Bacteria 1711
282 Ga0373947_0226369 3300035725 Bacteria 1231
283 Ga0373937_0006501 3300036401 Bacteria 10087
284 Ga0373937_0026743 3300036401 Bacteria 5214
285 Ga0373937_0030302 3300036401 Bacteria 4900
286 Ga0373937_0036205 3300036401 Bacteria 4496
287 Ga0373937_0041841 3300036401 Bacteria 4181
288 Ga0373937_0115189 3300036401 Bacteria 2503
289 Ga0373925_0000296 3300037068 Bacteria 52149
290 Ga0373925_0026260 3300037068 Bacteria 4261
291 Ga0373925_0040446 3300037068 Bacteria 3452
292 Ga0373925_0111264 3300037068 Bacteria 2116
293 Ga0373925_0122199 3300037068 Bacteria 2022
294 Ga0436364_0478514 3300037853 Bacteria 578677
295 Ga0436364_0521244 3300037853 Bacteria 1449
296 Ga0436364_0654010 3300037853 Bacteria 80215
297 Ga0436364_0680477 3300037853 Unclassified 1657
298 Ga0436364_0765146 3300037853 Bacteria 4455
299 Ga0436364_0868704 3300037853 Bacteria 1945
300 Ga0436364_0978961 3300037853 Bacteria 2847
301 Ga0436364_0997952 3300037853 Bacteria 2598
302 Ga0436364_1190629 3300037853 Bacteria 3931
303 Ga0436364_1220942 3300037853 Bacteria 7713
304 Ga0436364_1261775 3300037853 Bacteria 2691
305 Ga0436365_0822880 3300039437 Bacteria 1662
306 Ga0436365_1290822 3300039437 Bacteria 2941
307 Ga0436365_1480846 3300039437 Bacteria 12536
308 Ga0436365_1598756 3300039437 Bacteria 6696
309 Ga0436360_1205318 3300039438 Bacteria 30708
310 Ga0436361_0079738 3300039447 Bacteria 122121
311 Ga0436363_0168862 3300039450 Bacteria 2128
312 Ga0436363_0817651 3300039450 Bacteria 23201
313 Ga0436362_0413929 3300039453 Bacteria 4097
314 Ga0436362_0979442 3300039453 Unclassified 1618
315 Ga0453684_0121540 3300044712 Bacteria 3151
316 Ga0453684_0167268 3300044712 Bacteria 2595
317 Ga0453684_0302829 3300044712 Bacteria 1816
318 Ga0451576_0009967 3300045051 Bacteria 10959
319 Ga0451576_0083138 3300045051 Bacteria 3331
320 Ga0466967_0508472 3300045976 Bacteria 1183
321 Ga0495592_0039468 3300046454 Bacteria 3546
322 Ga0495592_0085348 3300046454 Bacteria 2276
323 Ga0495651_0016486 3300046462 Bacteria 5723
324 Ga0495651_0089031 3300046462 Bacteria 2318
325 Ga0495653_0099582 3300046463 Bacteria 2109
326 Ga0495580_0005574 3300046472 Bacteria 10376
327 Ga0495580_0011498 3300046472 Bacteria 6847
328 Ga0495580_0020813 3300046472 Bacteria 4849
329 Ga0495580_0030939 3300046472 Bacteria 3871
330 Ga0495664_0005950 3300046477 Bacteria 6719
331 Ga0495630_0132261 3300046517 Bacteria 1895
332 Ga0495652_0181237 3300046529 Bacteria 1616
333 Ga0495665_0069528 3300046531 Bacteria 1856
334 Ga0495665_0094441 3300046531 Bacteria 1571
335 Ga0495640_0025510 3300046533 Bacteria 4286
336 Ga0495587_0005453 3300046536 Bacteria 8297
337 Ga0495587_0026884 3300046536 Bacteria 3505
338 Ga0495587_0065884 3300046536 Bacteria 2114
339 Ga0495587_0075942 3300046536 Bacteria 1951
340 Ga0495645_0005468 3300046543 Bacteria 8724
341 Ga0495667_0026970 3300046559 Bacteria 3872
342 Ga0495667_0063020 3300046559 Bacteria 2428
343 Ga0495634_0133389 3300046642 Bacteria 1582
344 Ga0495635_0029261 3300046663 Bacteria 3830
345 Ga0495657_0108226 3300046675 Bacteria 1763
346 Ga0495599_0011875 3300046678 Bacteria 5358
347 Ga0495599_0037933 3300046678 Bacteria 3027
348 Ga0495623_0086900 3300046679 Bacteria 1927
349 Ga0495623_0133140 3300046679 Bacteria 1486
350 Ga0495623_0151073 3300046679 Bacteria 1372
351 Ga0495658_0080672 3300046683 Bacteria 1909
352 Ga0495600_0035140 3300046809 Bacteria 3254
353 Ga0495604_0085277 3300047317 Bacteria 2357
354 Ga0495636_0102323 3300047318 Bacteria 1254
355 Ga0495680_0074538 3300047322 Bacteria 2577
356 Ga0495680_0109609 3300047322 Bacteria 2047
357 Ga0495675_0020704 3300047444 Bacteria 4186
358 Ga0495684_0008156 3300047471 Bacteria 8102
359 Ga0495684_0030111 3300047471 Bacteria 4167
360 Ga0495684_0048165 3300047471 Bacteria 3259
361 Ga0495602_0004643 3300048088 Bacteria 14342
362 Ga0495602_0061208 3300048088 Bacteria 3275
363 Ga0495602_0112976 3300048088 Bacteria 2203
364 Ga0496112_0030888 3300048915 Bacteria 5190
365 Ga0501031_0004105 3300049568 Bacteria 9406
366 Ga0501032_0001057 3300049569 Bacteria 22010
367 Ga0501032_0209731 3300049569 Bacteria 1270
368 Ga0501033_0005032 3300049570 Bacteria 10524
369 Ga0501033_0031271 3300049570 Bacteria 4001
370 Ga0501036_0000378 3300049572 Bacteria 31410
371 Ga0501038_0007215 3300049574 Bacteria 10268
372 Ga0501038_0034526 3300049574 Bacteria 4446
373 Ga0501039_0004471 3300049575 Bacteria 10556
374 Ga0501043_0000809 3300049579 Bacteria 27808
375 Ga0501043_0146530 3300049579 Bacteria 1848
376 Ga0501046_0005375 3300049580 Bacteria 11450
377 Ga0501046_0117722 3300049580 Bacteria 2024
378 Ga0501047_0031162 3300049581 Bacteria 5143
379 Ga0501047_0038993 3300049581 Bacteria 4595
380 Ga0501047_0176846 3300049581 Bacteria 2001
381 Ga0501048_0057751 3300049582 Bacteria 2751
382 Ga0501068_0000327 3300049584 Bacteria 23786
383 Ga0501069_0005446 3300049585 Bacteria 6620
384 Ga0501070_0013344 3300049586 Bacteria 6929
385 Ga0501072_0000785 3300049588 Bacteria 23290
386 Ga0501073_0001271 3300049589 Bacteria 18513
387 Ga0501074_0111874 3300049590 Bacteria 1953
388 Ga0501076_0058898 3300049592 Bacteria 3054
389 Ga0501077_0011746 3300049593 Bacteria 5475
390 Ga0501079_0008173 3300049741 Bacteria 7930
391 Ga0501080_0000378 3300049742 Bacteria 34218
392 Ga0501083_0007829 3300049744 Bacteria 7571
393 Ga0501035_0004835 3300049822 Bacteria 12777
394 Ga0501035_0041170 3300049822 Bacteria 4172
395 Ga0501035_0071440 3300049822 Bacteria 3073
396 Ga0501044_0005241 3300049823 Bacteria 14421
397 Ga0501044_0011288 3300049823 Bacteria 9681
398 nmdc:mga05p37_67423_c1 3300050507 Bacteria 4402
399 nmdc:mga08x19_14377_c1 3300050514 Bacteria 4800
400 Ga0495601_0069651 3300053077 Bacteria 2244
401 Ga0500568_0001052 3300053139 Bacteria 18821
402 Ga0501084_0198326 3300054114 Bacteria 1693
403 Ga0501082_0006031 3300060353 Bacteria 10512
404 Ga0070679_100129660
405 Ga0070658_10071131
406 Ga0070683_100000030
407 Ga0070683_100210180
408 Ga0068869_100070670
409 Ga0070666_10013648
410 Ga0070680_100005103
411 Ga0068868_100046129
412 Ga0070661_100058706
413 Ga0070661_100109517
414 Ga0070671_100112213
415 Ga0070673_100109929
416 Ga0070659_100004981
417 Ga0070659_100146269
418 Ga0070667_100180803
419 Ga0070714_100002212
420 Ga0070713_100005915
421 Ga0070713_100084573
422 Ga0070711_100020680
423 Ga0070711_100233613
424 Ga0070708_100049780
425 Ga0070681_10006510
426 Ga0070681_10035486
427 Ga0070681_10123243
428 Ga0070681_10231973
429 Ga0068867_100032082
430 Ga0070699_100062345
431 Ga0070679_100032577
432 Ga0070679_100069588
433 Ga0070679_100137754
434 Ga0070684_100000088
435 Ga0070684_100040734
436 Ga0070684_100058333
437 Ga0070684_100074016
438 Ga0070684_100078523
439 Ga0068853_100003168
440 Ga0068853_100012305
441 Ga0068853_100104475
442 Ga0070695_100031477
443 Ga0070696_100022404
444 Ga0070693_100020687
445 Ga0070665_100048836
446 Ga0068855_100010390
447 Ga0068855_100016542
448 Ga0068855_100020234
449 Ga0068855_100034568
450 Ga0068855_100205027
451 Ga0068855_100205582
452 Ga0070664_100022505
453 Ga0068857_100000632
454 Ga0068857_100085723
455 Ga0068856_100000805
456 Ga0068856_100022137
457 Ga0068856_100043298
458 Ga0068856_100050752
459 Ga0068856_100069872
460 Ga0068866_10026230
461 Ga0068863_100072684
462 Ga0068858_100160040
463 Ga0070717_10001489
464 Ga0070717_10013870
465 Ga0097621_100016289
466 Ga0097621_100019894
467 Ga0097621_100062091
468 Ga0097621_100151062
469 Ga0068871_100049080
470 Ga0068871_100057958
471 Ga0068871_100093528
472 Ga0068871_100096785
473 Ga0075431_100025542
474 Ga0068865_100019496
475 Ga0105240_10000855
476 Ga0105240_10006864
477 Ga0105240_10029714
478 Ga0105240_10044665
479 Ga0105240_10186195
480 Ga0105245_10004408
481 Ga0105245_10005929
482 Ga0105245_10011353
483 Ga0105245_10062617
484 Ga0105245_10083156
485 Ga0105245_10277175
486 Ga0105247_10079023
487 Ga0105241_10011139
488 Ga0105241_10025412
489 Ga0105241_10030234
490 Ga0105241_10031623
491 Ga0105241_10110394
492 Ga0105241_10115954
493 Ga0105241_10169681
494 Ga0105242_10008201
495 Ga0105242_10126425
496 Ga0105242_10131555
497 Ga0105242_10135608
498 Ga0105242_10157004
499 Ga0105248_10006327
500 Ga0105248_10006887
501 Ga0105248_10110807
502 Ga0105248_10142010
503 Ga0105237_10000802
504 Ga0105237_10013306
505 Ga0105237_10081883
506 Ga0105237_10115531
507 Ga0105237_10142521
508 Ga0105237_10172705
509 Ga0105237_10192822
510 Ga0105237_10198285
511 Ga0105237_10230312
512 Ga0105238_10002330
513 Ga0105238_10013017
514 Ga0105238_10019260
515 Ga0105238_10066246
516 Ga0105249_10013795
517 Ga0105249_10070577
518 Ga0105239_10004969
519 Ga0105239_10007540
520 Ga0105239_10154337
521 Ga0105239_10505201
522 Ga0105246_10015435
523 Ga0157373_10040511
524 Ga0157371_10177314
525 Ga0157370_10003445
526 Ga0157370_10011718
527 Ga0157370_10014852
528 Ga0157370_10126762
529 Ga0157369_10000445
530 Ga0157369_10012123
531 Ga0157369_10057931
532 Ga0157369_10106372
533 Ga0157369_10155245
534 Ga0157369_10273053
535 Ga0157374_10012321
536 Ga0157374_10186290
537 Ga0157378_10006800
538 Ga0157378_10016703
539 Ga0163162_10141716
540 Ga0157372_10029268
541 Ga0157375_10007926
542 Ga0163163_10018046
543 Ga0163163_10258800
544 Ga0157376_10010601
545 Ga0157376_10112861
546 Ga0157376_10122490
547 Ga0213872_10000930
548 Ga0213876_10003728
549 Ga0213876_10006910
550 Ga0213876_10036278
551 Ga0213875_10000006
552 Ga0213875_10000065
553 Ga0213875_10004805
554 Ga0213875_10005460
555 Ga0213875_10048902
556 Ga0207654_10037716
557 Ga0207654_10090377
558 Ga0207707_10000744
559 Ga0207707_10070429
560 Ga0207707_10111617
561 Ga0207707_10139283
562 Ga0207707_10175568
563 Ga0207707_10178646
564 Ga0207695_10002919
565 Ga0207695_10003253
566 Ga0207695_10004474
567 Ga0207695_10023034
568 Ga0207695_10069015
569 Ga0207695_10100429
570 Ga0207695_10142120
571 Ga0207671_10033440
572 Ga0207671_10048850
573 Ga0207671_10054194
574 Ga0207671_10111312
575 Ga0207657_10009515
576 Ga0207652_10053912
577 Ga0207652_10062758
578 Ga0207652_10107978
579 Ga0207652_10230285
580 Ga0207681_10218962
581 Ga0207681_10248161
582 Ga0207694_10005128
583 Ga0207694_10037406
584 Ga0207694_10074670
585 Ga0207687_10002412
586 Ga0207687_10036627
587 Ga0207687_10053768
588 Ga0207700_10002333
589 Ga0207700_10024893
590 Ga0207664_10006792
591 Ga0207644_10106977
592 Ga0207686_10004071
593 Ga0207686_10021453
594 Ga0207686_10056748
595 Ga0207691_10073650
596 Ga0207711_10002360
597 Ga0207711_10010906
598 Ga0207711_10093471
599 Ga0207711_10189218
600 Ga0207689_10074149
601 Ga0207661_10000035
602 Ga0207661_10001824
603 Ga0207661_10083869
604 Ga0207661_10112243
605 Ga0207661_10253149
606 Ga0207667_10009668
607 Ga0207667_10022312
608 Ga0207667_10035639
609 Ga0207667_10116213
610 Ga0207667_10132126
611 Ga0207712_10037752
612 Ga0207703_10012110
613 Ga0207703_10291781
614 Ga0207639_10020465
615 Ga0207639_10077161
616 Ga0207678_10025809
617 Ga0207702_10006149
618 Ga0207702_10007548
619 Ga0207702_10028495
620 Ga0207702_10216244
621 Ga0207702_10291781
622 Ga0207641_10093592
623 Ga0207641_10122142
624 Ga0207641_10200971
625 Ga0207648_10022004
626 Ga0207676_10020361
627 Ga0207674_10006088
628 Ga0207674_10007292
629 Ga0207674_10016365
630 Ga0207674_10017456
631 Ga0207674_10195295
632 Ga0268266_10263593
633 Ga0268264_10234857
634 Ga0265323_10000947
635 Ga0265338_10057839
636 Ga0265320_10008804
637 Ga0265325_10015496
638 Ga0265340_10010620
639 Ga0265340_10053672
640 Ga0265331_10001328
641 Ga0265331_10009240
642 Ga0265331_10069399
643 Ga0265316_10001997
644 Ga0265316_10006801
645 Ga0265316_10019372
646 Ga0265316_10020900
647 Ga0265316_10042040
648 Ga0265316_10066657
649 Ga0265316_10077688
650 Ga0265316_10105346
651 Ga0265313_10004278
652 Ga0265313_10054580
653 Ga0265314_10001081
654 Ga0265314_10008865
655 Ga0265314_10012274
656 Ga0373926_0011211
657 Ga0373934_0001762
658 Ga0373934_0005458
659 Ga0373923_0011183
660 Ga0373936_0019587
661 Ga0373953_0011290
662 Ga0373953_0018949
663 Ga0373954_0001710
664 Ga0373954_0015927
665 Ga0373954_0019287
666 Ga0373957_0017696
667 Ga0373943_0020250
668 Ga0373943_0029850
669 Ga0373955_0008196
670 Ga0373955_0100239
671 Ga0373935_0009717
672 Ga0373935_0071321
673 Ga0373927_0000417
674 Ga0373927_0001597
675 Ga0373927_0004369
676 Ga0373927_0017472
677 Ga0373927_0036359
678 Ga0373933_0009151
679 Ga0373933_0021481
680 Ga0373933_0055931
681 Ga0373947_0000119
682 Ga0373947_0013417
683 Ga0373947_0036376
684 Ga0373947_0114014
685 Ga0373947_0226369
686 Ga0373937_0006501
687 Ga0373937_0026743
688 Ga0373937_0030302
689 Ga0373937_0036205
690 Ga0373937_0041841
691 Ga0373937_0115189
692 Ga0373925_0000296
693 Ga0373925_0026260
694 Ga0373925_0040446
695 Ga0373925_0111264
696 Ga0373925_0122199
697 Ga0436364_0478514
698 Ga0436364_0521244
699 Ga0436364_0654010
700 Ga0436364_0680477
701 Ga0436364_0765146
702 Ga0436364_0868704
703 Ga0436364_0978961
704 Ga0436364_0997952
705 Ga0436364_1190629
706 Ga0436364_1220942
707 Ga0436364_1261775
708 Ga0436365_0822880
709 Ga0436365_1290822
710 Ga0436365_1480846
711 Ga0436365_1598756
712 Ga0436360_1205318
713 Ga0436361_0079738
714 Ga0436363_0168862
715 Ga0436363_0817651
716 Ga0436362_0413929
717 Ga0436362_0979442
718 Ga0453684_0121540
719 Ga0453684_0167268
720 Ga0453684_0302829
721 Ga0451576_0009967
722 Ga0451576_0083138
723 Ga0466967_0508472
724 Ga0495592_0039468
725 Ga0495592_0085348
726 Ga0495651_0016486
727 Ga0495651_0089031
728 Ga0495653_0099582
729 Ga0495580_0005574
730 Ga0495580_0011498
731 Ga0495580_0020813
732 Ga0495580_0030939
733 Ga0495664_0005950
734 Ga0495630_0132261
735 Ga0495652_0181237
736 Ga0495665_0069528
737 Ga0495665_0094441
738 Ga0495640_0025510
739 Ga0495587_0005453
740 Ga0495587_0026884
741 Ga0495587_0065884
742 Ga0495587_0075942
743 Ga0495645_0005468
744 Ga0495667_0026970
745 Ga0495667_0063020
746 Ga0495634_0133389
747 Ga0495635_0029261
748 Ga0495657_0108226
749 Ga0495599_0011875
750 Ga0495599_0037933
751 Ga0495623_0086900
752 Ga0495623_0133140
753 Ga0495623_0151073
754 Ga0495658_0080672
755 Ga0495600_0035140
756 Ga0495604_0085277
757 Ga0495636_0102323
758 Ga0495680_0074538
759 Ga0495680_0109609
760 Ga0495675_0020704
761 Ga0495684_0008156
762 Ga0495684_0030111
763 Ga0495684_0048165
764 Ga0495602_0004643
765 Ga0495602_0061208
766 Ga0495602_0112976
767 Ga0496112_0030888
768 Ga0501031_0004105
769 Ga0501032_0001057
770 Ga0501032_0209731
771 Ga0501033_0005032
772 Ga0501033_0031271
773 Ga0501036_0000378
774 Ga0501038_0007215
775 Ga0501038_0034526
776 Ga0501039_0004471
777 Ga0501043_0000809
778 Ga0501043_0146530
779 Ga0501046_0005375
780 Ga0501046_0117722
781 Ga0501047_0031162
782 Ga0501047_0038993
783 Ga0501047_0176846
784 Ga0501048_0057751
785 Ga0501068_0000327
786 Ga0501069_0005446
787 Ga0501070_0013344
788 Ga0501072_0000785
789 Ga0501073_0001271
790 Ga0501074_0111874
791 Ga0501076_0058898
792 Ga0501077_0011746
793 Ga0501079_0008173
794 Ga0501080_0000378
795 Ga0501083_0007829
796 Ga0501035_0004835
797 Ga0501035_0041170
798 Ga0501035_0071440
799 Ga0501044_0005241
800 Ga0501044_0011288
801 nmdc:mga05p37_67423_c1
802 nmdc:mga08x19_14377_c1
803 Ga0495601_0069651
804 Ga0500568_0001052
805 Ga0501084_0198326
806 Ga0501082_0006031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03129

HGTP_anticodon

Anticodon binding domain

347

436

0.96

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

7

330

0.86

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

65

331

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v95-assembly1.cif.gz_A solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein) 0.8678 345 430
3rg8-assembly1.cif.gz_G crystal structure of treponema denticola pure 0.848 348 377
2i6f-assembly1.cif.gz_A receiver domain from myxococcus xanthus social motility protein frzs 0.7691 345 390
4e51-assembly1.cif.gz_A crystal structure of a histidyl-trna synthetase hisrs from burkholderia thailandensis bound to histidine 0.7643 1 429
3h16-assembly1.cif.gz_A crystal structure of a bacteria tir domain, pdtir from paracoccus denitrificans 0.7592 344 394
ID Description Score Start End Superfamily
1qe0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9447 344 424 3.40.50.800
1adjA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9293 345 430 3.40.50.800
af_Q58406_325_416_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9257 345 425 3.40.50.800
af_P9WFV5_326_422_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9169 346 429 3.40.50.800
af_Q86AS6_379_478_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.911 346 429 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A6M1CMD1-F1-model_v4 deleted 0.9252 132 287
AF-A0A6D0LZY0-F1-model_v4 deleted 0.901 179 308
AF-A0A2S8K4M5-F1-model_v4 deleted 0.8942 139 333
AF-A0A2V8X6S7-F1-model_v4 Histidine--tRNA ligase (EC 6.1.1.21) 0.8914 78 337 GO:0004821
GO:0005524
GO:0005737
GO:0006427
AF-A0A7C1V1W9-F1-model_v4 Histidine--tRNA ligase (EC 6.1.1.21) 0.8876 98 429 GO:0004821
GO:0005524
GO:0005737
GO:0006427

Map