F435253

General Info

Members Datasets Scaffolds Average Seq Length
402 307 229 110

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2933016740|2933021047
Length 107
Sequence IRLPHIRRRRILVIGLVAAAQLILADYAYAQELGQAFAPLQAIFQAIVDFITGPFGRLCAIIAVMSMGFLAWVGRLSWFLAGGIALGIGLVFGGPGIVDSLIAIVGS

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
8 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
13 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
14 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
15 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
16 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
17 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
18 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
19 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
20 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
21 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
22 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
23 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
24 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
25 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
26 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
27 2643221688 Rhizobium sp. Root482 Isolate Unclassified
28 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
29 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
30 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
31 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
32 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
33 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
34 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
35 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
36 2802429637 Rhizobium anhuiense C15 Isolate Nodule
37 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
38 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
39 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
40 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
41 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
42 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
43 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
44 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
45 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
46 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
47 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
48 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
49 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
50 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
51 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
52 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
53 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
54 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
55 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
56 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
57 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
58 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
59 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
60 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
61 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
62 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
63 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
64 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
65 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
66 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
67 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
68 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
69 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
70 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
71 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
72 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
73 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
74 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
75 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
76 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
77 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
78 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
79 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
80 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
81 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
82 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
83 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
84 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
85 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
86 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
87 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
88 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
89 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
90 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
91 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
92 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
93 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
94 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
95 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
96 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
97 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
98 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
99 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
100 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
101 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
102 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
103 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
104 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
105 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
106 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
107 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
108 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
109 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
110 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
111 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
112 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
113 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
114 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
115 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
116 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
117 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
118 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
119 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
120 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
121 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
122 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
123 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
124 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
125 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
126 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
127 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
128 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
129 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
130 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
131 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
132 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
133 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
134 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
135 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
136 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
137 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
138 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
139 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
140 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
141 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
142 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
143 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
144 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
145 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
146 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
147 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
148 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
149 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
150 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
151 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
152 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
153 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
154 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
155 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
156 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
157 2996887358 Rhizobium sp. R711 Isolate Nodule
158 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
159 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
160 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
161 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
162 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
163 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
166 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
167 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
168 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
169 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
170 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
173 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
174 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
175 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
176 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
177 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
178 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
179 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
180 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
181 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
182 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
185 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
188 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
189 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
190 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
191 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
192 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
195 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
196 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
197 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
198 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
199 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
200 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
201 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
202 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
203 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
224 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
298 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
299 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
300 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
301 8005258706 Rhizobium sp. R693 Isolate Nodule
302 8005321885 Rhizobium sp. R72 Isolate Nodule
303 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
304 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
305 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
306 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
307 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.97
Metatranscriptomes 0
Isolates 43.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.92
Nodule 44.53
Rhizoplane 1.49
Rhizosphere 29.1
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC32416_b1 2010549000 Bacteria 796
2 JGI25158J39367_1001570 3300002739 Bacteria 3956
3 JGI25159J45721_1000019 3300002987 Bacteria 127304
4 rootH1_10097410 3300003316 Bacteria 5845
5 rootH1_10113672 3300003323 Bacteria 5892
6 JGI25160J50197_1000054 3300003354 Bacteria 127304
7 JGI25161J50226_1000615 3300003374 Bacteria 14654
8 Ga0055526_1008281 3300003771 Bacteria 5216
9 Ga0055526_1009824 3300003771 Plasmid 4544
10 Ga0055524_1000230 3300003775 Bacteria 59566
11 Ga0055524_1015699 3300003775 Bacteria 2750
12 Ga0055528_1000018 3300003790 Bacteria 155302
13 Ga0055528_1000040 3300003790 Bacteria 112553
14 Ga0055528_1045517 3300003790 Plasmid 934
15 Ga0055530_10027884 3300003791 Bacteria 1534
16 Ga0055531_10015733 3300003794 Bacteria 3310
17 Ga0055531_10031923 3300003794 Bacteria 1732
18 Ga0055531_10040014 3300003794 Bacteria 1381
19 Ga0055543_1000214 3300004625 Bacteria 46687
20 Ga0065165_1000136 3300005262 Bacteria 127754
21 Ga0065165_1008130 3300005262 Bacteria 4991
22 Ga0070658_10982377 3300005327 Bacteria 734
23 Ga0070667_101565335 3300005367 Bacteria 619
24 Ga0068853_100153595 3300005539 Bacteria 2073
25 Ga0068856_100399127 3300005614 Bacteria 1395
26 Ga0068852_100336536 3300005616 Bacteria 1470
27 Ga0081455_10005309 3300005937 Bacteria 14148
28 Ga0081455_10262227 3300005937 Bacteria 1258
29 Ga0081455_10355975 3300005937 Bacteria 1031
30 Ga0081540_1018009 3300005983 Bacteria 4349
31 Ga0075363_100650194 3300006048 Bacteria 634
32 Ga0075364_10184817 3300006051 Bacteria 1411
33 Ga0075370_10120500 3300006353 Bacteria 1527
34 Ga0075370_10890106 3300006353 Bacteria 544
35 Ga0079104_1029122 3300006946 Bacteria 1394
36 Ga0099826_10000073 3300006948 Bacteria 52790
37 Ga0099826_10065159 3300006948 Bacteria 2344
38 Ga0099826_10094481 3300006948 Bacteria 1820
39 Ga0105241_11590021 3300009174 Bacteria 632
40 Ga0105237_10116601 3300009545 Bacteria 2664
41 Ga0105238_10129634 3300009551 Bacteria 2500
42 Ga0123340_1036493 3300009763 Bacteria 2564
43 Ga0123340_1046171 3300009763 Bacteria 1774
44 Ga0123341_1090025 3300009765 Plasmid 1110
45 Ga0123341_1094487 3300009765 Bacteria 1042
46 Ga0123342_1023968 3300009766 Bacteria 3886
47 Ga0105239_10170329 3300010375 Bacteria 2435
48 Ga0157370_10290195 3300013104 Bacteria 1511
49 Ga0157374_10101630 3300013296 Bacteria 2756
50 Ga0163163_10208809 3300014325 Bacteria 2001
51 Ga0163163_10972381 3300014325 Bacteria 912
52 Ga0157380_12972620 3300014326 Bacteria 540
53 Ga0182008_10070430 3300014497 Bacteria 1720
54 Ga0157379_11072769 3300014968 Bacteria 770
55 Ga0182006_1067737 3300015261 Bacteria 1331
56 Ga0182007_10023223 3300015262 Bacteria 2182
57 Ga0228711_1018095 3300022739 Bacteria 6794
58 Ga0228711_1044376 3300022739 Bacteria 1174
59 Ga0228710_1018344 3300022740 Bacteria 6653
60 Ga0228710_1021042 3300022740 Bacteria 5390
61 Ga0228710_1022781 3300022740 Bacteria 4731
62 Ga0228710_1026815 3300022740 Bacteria 3489
63 Ga0228710_1059257 3300022740 Bacteria 606
64 Ga0209436_100174 3300025208 Bacteria 30498
65 Ga0209673_1000055 3300025273 Bacteria 272768
66 Ga0209673_1000222 3300025273 Bacteria 112605
67 Ga0209673_1000647 3300025273 Bacteria 51600
68 Ga0209130_1000120 3300025284 Bacteria 127890
69 Ga0209130_1019606 3300025284 Plasmid 1564
70 Ga0209675_1103328 3300025291 Plasmid 501
71 Ga0209676_1005070 3300025292 Bacteria 7037
72 Ga0209676_1050626 3300025292 Bacteria 1094
73 Ga0209676_1085422 3300025292 Bacteria 707
74 Ga0209025_1004832 3300025294 Bacteria 11384
75 Ga0209564_1000258 3300025295 Bacteria 112586
76 Ga0209564_1000396 3300025295 Bacteria 77945
77 Ga0209564_1052276 3300025295 Bacteria 984
78 Ga0209758_1050519 3300025297 Plasmid 1457
79 Ga0209256_1000147 3300025299 Bacteria 149002
80 Ga0209256_1000202 3300025299 Bacteria 112605
81 Ga0209256_1000217 3300025299 Bacteria 106382
82 Ga0209256_1044020 3300025299 Bacteria 1117
83 Ga0207426_1000206 3300025302 Bacteria 140737
84 Ga0209051_1012135 3300025303 Bacteria 4187
85 Ga0209051_1023713 3300025303 Bacteria 2543
86 Ga0209257_1000528 3300025304 Bacteria 66407
87 Ga0209257_1010440 3300025304 Bacteria 4699
88 Ga0209257_1021418 3300025304 Bacteria 2349
89 Ga0209257_1032540 3300025304 Bacteria 1652
90 Ga0207658_11129974 3300025986 Bacteria 716
91 Ga0209281_1001464 3300027111 Bacteria 13756
92 Ga0209281_1006583 3300027111 Bacteria 3014
93 Ga0209281_1030035 3300027111 Bacteria 977
94 Ga0209282_1000144 3300027666 Bacteria 41703
95 Ga0209282_1001710 3300027666 Bacteria 12252
96 Ga0209282_1028342 3300027666 Bacteria 3471
97 Ga0209282_1029725 3300027666 Bacteria 3370
98 Ga0307408_102202053 3300031548 Bacteria 533
99 Ga0307412_11068202 3300031911 Bacteria 717
100 Ga0315914_1000930 3300031967 Bacteria 41238
101 Ga0315914_1021379 3300031967 Bacteria 5066
102 Ga0315914_1040804 3300031967 Bacteria 1552
103 Ga0307409_101018332 3300031995 Bacteria 847
104 Ga0307414_10441929 3300032004 Plasmid 1139
105 Ga0315913_1000087 3300033430 Bacteria 52029
106 Ga0315913_1036309 3300033430 Bacteria 2988
107 Ga0315915_1004322 3300033464 Bacteria 17983
108 Ga0315915_1017623 3300033464 Bacteria 6473
109 Ga0395899_0179598 3300037312 Bacteria 1487
110 Ga0395901_0277988 3300038443 Bacteria 1740
111 Ga0451843_0199528 3300041509 Bacteria 1721
112 Ga0451853_0919388 3300041512 Bacteria 872
113 Ga0495617_051982 3300046452 Bacteria 1362
114 Ga0495638_0000175 3300046460 Bacteria 100036
115 Ga0495605_0008005 3300046474 Bacteria 5984
116 Ga0495585_0043890 3300046492 Bacteria 2499
117 Ga0495607_0030922 3300046501 Bacteria 3281
118 Ga0495607_0164150 3300046501 Bacteria 1126
119 Ga0495583_0000721 3300046506 Bacteria 42331
120 Ga0495606_0069999 3300046507 Bacteria 2214
121 Ga0495606_0070450 3300046507 Bacteria 2205
122 Ga0495606_0128028 3300046507 Bacteria 1512
123 Ga0495606_0591252 3300046507 Plasmid 546
124 Ga0495616_0027526 3300046513 Bacteria 3016
125 Ga0495631_0030780 3300046518 Bacteria 2432
126 Ga0495637_0173125 3300046520 Bacteria 804
127 Ga0495643_0042238 3300046522 Bacteria 2484
128 Ga0495643_0146100 3300046522 Bacteria 1175
129 Ga0495648_0076907 3300046524 Bacteria 1915
130 Ga0495654_0135551 3300046530 Bacteria 1102
131 Ga0495597_0249368 3300046542 Plasmid 698
132 Ga0495622_0064645 3300046557 Plasmid 1692
133 Ga0495668_0105631 3300046616 Bacteria 1540
134 Ga0495611_0155391 3300046648 Bacteria 1068
135 Ga0495625_0061298 3300046660 Bacteria 2662
136 Ga0495625_0732369 3300046660 Bacteria 581
137 Ga0495669_0147486 3300046684 Bacteria 1113
138 Ga0495670_0060244 3300046691 Bacteria 1907
139 Ga0495604_0388382 3300047317 Bacteria 921
140 Ga0495636_0094894 3300047318 Bacteria 1299
141 Ga0496101_0512312 3300048904 Bacteria 948
142 Ga0496106_0090639 3300048909 Bacteria 2360
143 Ga0496112_0842699 3300048915 Bacteria 840
144 Ga0496113_0160535 3300048916 Bacteria 1777
145 Ga0496116_0125766 3300048919 Bacteria 1473
146 Ga0496116_0134169 3300048919 Bacteria 1405
147 Ga0496117_0005675 3300048920 Bacteria 13006
148 Ga0496118_0033219 3300048921 Bacteria 4236
149 Ga0496119_0353444 3300048922 Bacteria 711
150 Ga0496121_0024416 3300048924 Bacteria 5780
151 Ga0496121_0063329 3300048924 Bacteria 3022
152 Ga0496121_0101408 3300048924 Bacteria 2220
153 Ga0496121_0431883 3300048924 Bacteria 854
154 Ga0496122_0131713 3300048925 Bacteria 1587
155 Ga0496123_0055773 3300048926 Bacteria 2589
156 Ga0496124_0000064 3300048927 Bacteria 225176
157 Ga0496124_0000184 3300048927 Bacteria 123894
158 Ga0496125_0148427 3300048928 Bacteria 1616
159 Ga0496126_0217839 3300048929 Plasmid 1605
160 Ga0501300_020760 3300049523 Bacteria 959
161 Ga0501031_0005251 3300049568 Bacteria 8443
162 Ga0501031_0039007 3300049568 Bacteria 3099
163 Ga0501031_0228771 3300049568 Bacteria 1210
164 Ga0501031_0341739 3300049568 Bacteria 969
165 Ga0501032_0000213 3300049569 Bacteria 48075
166 Ga0501032_0001012 3300049569 Bacteria 22698
167 Ga0501032_0018587 3300049569 Bacteria 4867
168 Ga0501032_0161309 3300049569 Bacteria 1472
169 Ga0501033_0002421 3300049570 Bacteria 15873
170 Ga0501033_0011139 3300049570 Bacteria 6889
171 Ga0501033_0717997 3300049570 Bacteria 679
172 Ga0501034_0000318 3300049571 Bacteria 85198
173 Ga0501034_0000569 3300049571 Bacteria 58487
174 Ga0501034_0003407 3300049571 Bacteria 18140
175 Ga0501034_0061140 3300049571 Bacteria 3783
176 Ga0501034_0577303 3300049571 Bacteria 1032
177 Ga0501036_0003423 3300049572 Bacteria 12673
178 Ga0501036_0077670 3300049572 Bacteria 2809
179 Ga0501037_0001683 3300049573 Bacteria 16070
180 Ga0501037_0003007 3300049573 Bacteria 12244
181 Ga0501037_0014210 3300049573 Bacteria 5862
182 Ga0501037_0124358 3300049573 Bacteria 1853
183 Ga0501038_0000021 3300049574 Bacteria 151672
184 Ga0501038_0000124 3300049574 Bacteria 64786
185 Ga0501038_0020710 3300049574 Bacteria 5910
186 Ga0501038_0609844 3300049574 Bacteria 825
187 Ga0501039_0000026 3300049575 Bacteria 150606
188 Ga0501039_0000204 3300049575 Bacteria 43147
189 Ga0501043_0001410 3300049579 Bacteria 21001
190 Ga0501043_0001818 3300049579 Bacteria 18335
191 Ga0501043_0003180 3300049579 Bacteria 13583
192 Ga0501043_0019585 3300049579 Bacteria 5311
193 Ga0501046_0086449 3300049580 Bacteria 2417
194 Ga0501046_0120315 3300049580 Bacteria 1998
195 Ga0501047_0069312 3300049581 Bacteria 3397
196 Ga0501047_0110985 3300049581 Bacteria 2625
197 Ga0501047_0330506 3300049581 Bacteria 1363
198 Ga0501238_001376 3300049671 Plasmid 2812
199 Ga0501083_0908409 3300049744 Bacteria 573
200 Ga0501280_000674 3300049776 Bacteria 7580
201 Ga0501035_0000204 3300049822 Bacteria 72214
202 Ga0501035_0000219 3300049822 Bacteria 68343
203 Ga0501035_0018919 3300049822 Bacteria 6345
204 Ga0501035_0717373 3300049822 Bacteria 805
205 Ga0501035_0826588 3300049822 Bacteria 738
206 Ga0501044_0001770 3300049823 Bacteria 25261
207 Ga0501044_0246930 3300049823 Bacteria 1727
208 Ga0501044_0406404 3300049823 Bacteria 1273
209 Ga0501044_0819029 3300049823 Bacteria 809
210 Ga0501044_0874691 3300049823 Bacteria 774
211 Ga0500578_0053716 3300053086 Bacteria 2579
212 Ga0500643_072085 3300053087 Bacteria 958
213 Ga0500556_0314884 3300053104 Plasmid 610
214 Ga0500557_000547 3300053105 Bacteria 5066
215 Ga0500562_034644 3300053108 Bacteria 1336
216 Ga0500569_007625 3300053109 Bacteria 2438
217 Ga0500594_0000750 3300053118 Bacteria 6911
218 Ga0500618_004847 3300053125 Bacteria 4201
219 Ga0500618_007784 3300053125 Bacteria 3030
220 Ga0500642_0085784 3300053130 Bacteria 1451
221 Ga0500658_0021911 3300053134 Bacteria 2424
222 Ga0500568_0000092 3300053139 Bacteria 84471
223 Ga0500568_0001320 3300053139 Bacteria 16248
224 Ga0500577_0074821 3300053142 Bacteria 1337
225 Ga0500616_0000751 3300053153 Bacteria 37335
226 Ga0500616_0000766 3300053153 Bacteria 37019
227 Ga0500627_0276795 3300053158 Bacteria 737
228 Ga0500627_0361156 3300053158 Plasmid 625
229 Ga0500645_196678 3300053730 Plasmid 545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2924754689 2924762235 78
2 3300006051 Ga0075364_10184817 Ga0075364_101848172 82
3 3300049581 Ga0501047_0069312 Ga0501047_0069312_560_847 83
4 3300049744 Ga0501083_0908409 Ga0501083_0908409_177_515 83
5 3300049822 Ga0501035_0717373 Ga0501035_0717373_301_639 83
6 3300049823 Ga0501044_0406404 Ga0501044_0406404_191_478 83
7 iso_pu_bacteria 2921296804 2921302843 83
8 iso_pu_bacteria 2964670856 2964671643 83
9 3300013104 Ga0157370_10290195 Ga0157370_102901953 84
10 3300041512 Ga0451853_0919388 Ga0451853_0919388_51_344 84
11 3300046501 Ga0495607_0164150 Ga0495607_0164150_813_1106 84
12 3300049568 Ga0501031_0228771 Ga0501031_0228771_487_777 84
13 3300053108 Ga0500562_034644 Ga0500562_034644_1028_1321 84
14 3300049568 Ga0501031_0039007 Ga0501031_0039007_1957_2250 85
15 3300049569 Ga0501032_0001012 Ga0501032_0001012_5695_5988 85
16 3300049569 Ga0501032_0018587 Ga0501032_0018587_4314_4607 85
17 3300049570 Ga0501033_0011139 Ga0501033_0011139_2397_2690 85
18 3300049570 Ga0501033_0717997 Ga0501033_0717997_322_615 85
19 3300049571 Ga0501034_0003407 Ga0501034_0003407_16463_16756 85
20 3300049571 Ga0501034_0061140 Ga0501034_0061140_3213_3506 85
21 3300049572 Ga0501036_0077670 Ga0501036_0077670_89_382 85
22 3300049573 Ga0501037_0003007 Ga0501037_0003007_10927_11220 85
23 3300049573 Ga0501037_0014210 Ga0501037_0014210_5358_5651 85
24 3300049574 Ga0501038_0020710 Ga0501038_0020710_3702_3995 85
25 3300049579 Ga0501043_0003180 Ga0501043_0003180_6727_7020 85
26 3300049822 Ga0501035_0000219 Ga0501035_0000219_6137_6430 85
27 3300049823 Ga0501044_0001770 Ga0501044_0001770_22206_22499 85
28 3300049823 Ga0501044_0874691 Ga0501044_0874691_232_525 85
29 3300025304 Ga0209257_1021418 Ga0209257_10214183 88
30 iso_pu_bacteria 2513237351 2514591931 88
31 iso_pu_bacteria 2881147464 2881150239 88
32 3300048904 Ga0496101_0512312 Ga0496101_0512312_630_938 89
33 3300046507 Ga0495606_0128028 Ga0495606_0128028_797_1135 90
34 iso_pu_bacteria 2915650412 2915652182 91
35 iso_pu_bacteria 2512875026 2512974440 92
36 iso_pu_bacteria 8003999396 8004006338 92
37 iso_pu_bacteria 2802428861 2802740430 94
38 iso_pu_bacteria 2915980308 2915984391 94
39 iso_pu_bacteria 2933016740 2933021047 94
40 iso_pu_bacteria 2960680706 2960684031 94
41 iso_pu_bacteria 2989771324 2989775619 94
42 iso_pu_bacteria 8018150411 8018151723 94
43 3300049571 Ga0501034_0577303 Ga0501034_0577303_407_757 95
44 iso_pu_bacteria 2510917028 2511183177 95
45 iso_pu_bacteria 2512047086 2512528659 95
46 iso_pu_bacteria 2513237086 2513586584 95
47 iso_pu_bacteria 2513237089 2513606956 95
48 iso_pu_bacteria 2513237091 2513620374 95
49 iso_pu_bacteria 2513237138 2513869513 95
50 iso_pu_bacteria 2513237140 2513885991 95
51 iso_pu_bacteria 2516653046 2516898447 95
52 iso_pu_bacteria 2517487022 2517564844 95
53 iso_pu_bacteria 2534681796 2535517738 95
54 iso_pu_bacteria 2551306084 2551675687 95
55 iso_pu_bacteria 2551306085 2551684631 95
56 iso_pu_bacteria 2551306087 2551701248 95
57 iso_pu_bacteria 2551306089 2551708524 95
58 iso_pu_bacteria 2551306090 2551721735 95
59 iso_pu_bacteria 2551306092 2551732636 95
60 iso_pu_bacteria 2551306093 2551742563 95
61 iso_pu_bacteria 2582581283 2585168743 95
62 iso_pu_bacteria 2582581299 2585229383 95
63 iso_pu_bacteria 2582581866 2585393401 95
64 iso_pu_bacteria 2585427633 2585993261 95
65 iso_pu_bacteria 2643221688 2644493932 95
66 iso_pu_bacteria 2765235802 2765468190 95
67 iso_pu_bacteria 2791355082 2792579647 95
68 iso_pu_bacteria 2791355092 2792629981 95
69 iso_pu_bacteria 2802428858 2802722018 95
70 iso_pu_bacteria 2802428860 2802734365 95
71 iso_pu_bacteria 2802428862 2802747614 95
72 iso_pu_bacteria 2802429606 2805937063 95
73 iso_pu_bacteria 2802429637 2806077516 95
74 iso_pu_bacteria 2839993093 2839996057 95
75 iso_pu_bacteria 2840764183 2840767273 95
76 iso_pu_bacteria 2842229732 2842236144 95
77 iso_pu_bacteria 2842509118 2842514902 95
78 iso_pu_bacteria 2854896431 2854896577 95
79 iso_pu_bacteria 2854916844 2854922003 95
80 iso_pu_bacteria 2855839649 2855846427 95
81 iso_pu_bacteria 2904578770 2904582972 95
82 iso_pu_bacteria 2913295892 2913301241 95
83 iso_pu_bacteria 2915980308 2915985930 95
84 iso_pu_bacteria 2915986958 2915991848 95
85 iso_pu_bacteria 2916014648 2916020517 95
86 iso_pu_bacteria 2916048683 2916052882 95
87 iso_pu_bacteria 2916061851 2916067435 95
88 iso_pu_bacteria 2920760137 2920767304 95
89 iso_pu_bacteria 2920822456 2920828777 95
90 iso_pu_bacteria 2921237296 2921240974 95
91 iso_pu_bacteria 2921250672 2921255514 95
92 iso_pu_bacteria 2921263974 2921269133 95
93 iso_pu_bacteria 2921289301 2921295380 95
94 iso_pu_bacteria 2923556063 2923559440 95
95 iso_pu_bacteria 2924158325 2924164467 95
96 iso_pu_bacteria 2924165586 2924170851 95
97 iso_pu_bacteria 2924186466 2924191531 95
98 iso_pu_bacteria 2924214083 2924216199 95
99 iso_pu_bacteria 2926754445 2926760295 95
100 iso_pu_bacteria 2937002841 2937008512 95
101 iso_pu_bacteria 2937036028 2937041141 95
102 iso_pu_bacteria 2937049772 2937050013 95
103 iso_pu_bacteria 2937056579 2937062825 95
104 iso_pu_bacteria 2937063883 2937064420 95
105 iso_pu_bacteria 2937071275 2937076360 95
106 iso_pu_bacteria 2937098957 2937106208 95
107 iso_pu_bacteria 2957375807 2957378970 95
108 iso_pu_bacteria 2957415311 2957419384 95
109 iso_pu_bacteria 2957430029 2957435702 95
110 iso_pu_bacteria 2957450854 2957456361 95
111 iso_pu_bacteria 2957457609 2957462149 95
112 iso_pu_bacteria 2957491536 2957493222 95
113 iso_pu_bacteria 2957505466 2957511047 95
114 iso_pu_bacteria 2960597568 2960599137 95
115 iso_pu_bacteria 2960603979 2960605763 95
116 iso_pu_bacteria 2960617483 2960621297 95
117 iso_pu_bacteria 2960624210 2960626379 95
118 iso_pu_bacteria 2960631154 2960635621 95
119 iso_pu_bacteria 2960645483 2960651422 95
120 iso_pu_bacteria 2960660292 2960663414 95
121 iso_pu_bacteria 2960667422 2960671142 95
122 iso_pu_bacteria 2960680706 2960686267 95
123 iso_pu_bacteria 2960687367 2960692660 95
124 iso_pu_bacteria 2964607997 2964614366 95
125 iso_pu_bacteria 2964628898 2964629695 95
126 iso_pu_bacteria 2964643177 2964648204 95
127 iso_pu_bacteria 2964712639 2964717955 95
128 iso_pu_bacteria 2967671571 2967675409 95
129 iso_pu_bacteria 2967678726 2967685722 95
130 iso_pu_bacteria 2967693043 2967696934 95
131 iso_pu_bacteria 2967714385 2967720111 95
132 iso_pu_bacteria 2967721400 2967728007 95
133 iso_pu_bacteria 2967735183 2967740375 95
134 iso_pu_bacteria 2970019648 2970024408 95
135 iso_pu_bacteria 2970033650 2970040459 95
136 iso_pu_bacteria 2970040964 2970042248 95
137 iso_pu_bacteria 2970047711 2970049720 95
138 iso_pu_bacteria 2970068827 2970075578 95
139 iso_pu_bacteria 2970076120 2970081190 95
140 iso_pu_bacteria 2970129317 2970131865 95
141 iso_pu_bacteria 2970156795 2970157630 95
142 iso_pu_bacteria 2970156795 2970160372 95
143 iso_pu_bacteria 2970170962 2970177386 95
144 iso_pu_bacteria 2970177841 2970178910 95
145 iso_pu_bacteria 2970191845 2970197859 95
146 iso_pu_bacteria 2977516862 2977522936 95
147 iso_pu_bacteria 2977530762 2977536089 95
148 iso_pu_bacteria 2977537788 2977542404 95
149 iso_pu_bacteria 2977544691 2977549333 95
150 iso_pu_bacteria 2977579622 2977582201 95
151 iso_pu_bacteria 2996887358 2996889569 95
152 iso_pu_bacteria 3005409236 3005410004 95
153 iso_pu_bacteria 8003992118 8003998825 95
154 iso_pu_bacteria 8005258706 8005260958 95
155 iso_pu_bacteria 8005321885 8005324096 95
156 iso_pu_bacteria 8018127388 8018130308 95
157 iso_pu_bacteria 8024486573 8024488793 95
158 iso_pu_bacteria 8049293176 8049298827 95
159 3300005937 Ga0081455_10262227 Ga0081455_102622273 96
160 3300005937 Ga0081455_10355975 Ga0081455_103559752 96
161 3300005983 Ga0081540_1018009 Ga0081540_10180092 96
162 3300014326 Ga0157380_12972620 Ga0157380_129726202 96
163 3300025303 Ga0209051_1012135 Ga0209051_10121357 96
164 iso_pu_bacteria 2508501123 2509116425 96
165 iso_pu_bacteria 2599185236 2599723881 96
166 iso_pu_bacteria 2856314179 2856314406 96
167 iso_pu_bacteria 2856342000 2856347145 96
168 iso_pu_bacteria 2871488783 2871490352 96
169 iso_pu_bacteria 2871495908 2871498713 96
170 iso_pu_bacteria 2876392853 2876399722 96
171 iso_pu_bacteria 2878760144 2878762929 96
172 iso_pu_bacteria 2878767105 2878769900 96
173 iso_pu_bacteria 2881853255 2881859950 96
174 iso_pu_bacteria 2882632389 2882635819 96
175 iso_pu_bacteria 2882912400 2882915612 96
176 iso_pu_bacteria 2885305155 2885309065 96
177 iso_pu_bacteria 2903448605 2903448872 96
178 iso_pu_bacteria 2903492973 2903498297 96
179 iso_pu_bacteria 2903540706 2903543513 96
180 iso_pu_bacteria 2904659560 2904666246 96
181 iso_pu_bacteria 2906414383 2906414828 96
182 iso_pu_bacteria 2924784321 2924785455 96
183 iso_pu_bacteria 2937994558 2937997360 96
184 iso_pu_bacteria 2958064165 2958064606 96
185 iso_pu_bacteria 2958165035 2958167832 96
186 iso_pu_bacteria 2961114664 2961114717 96
187 iso_pu_bacteria 2961163497 2961166302 96
188 iso_pu_bacteria 2961170736 2961172146 96
189 iso_pu_bacteria 2965018300 2965021122 96
190 iso_pu_bacteria 2965062239 2965066831 96
191 iso_pu_bacteria 2968003550 2968005348 96
192 iso_pu_bacteria 2968083720 2968085423 96
193 iso_pu_bacteria 2968097103 2968098103 96
194 iso_pu_bacteria 2968110612 2968117745 96
195 iso_pu_bacteria 2968171901 2968174700 96
196 iso_pu_bacteria 2970503327 2970504744 96
197 iso_pu_bacteria 2970554993 2970557793 96
198 iso_pu_bacteria 2977828996 2977835582 96
199 iso_pu_bacteria 2977858184 2977861052 96
200 iso_pu_bacteria 2979779861 2979784001 96
201 iso_pu_bacteria 2979808191 2979809381 96
202 iso_pu_bacteria 2987659509 2987662311 96
203 iso_pu_bacteria 3004188549 3004191362 96
204 iso_pu_bacteria 3004203850 3004211154 96
205 iso_pu_bacteria 8004395343 8004398331 96
206 iso_pu_bacteria 8004445564 8004447106 96
207 iso_pu_bacteria 8055617313 8055624906 96
208 3300003771 Ga0055526_1008281 Ga0055526_10082812 97
209 3300003771 Ga0055526_1009824 Ga0055526_10098241 97
210 3300003775 Ga0055524_1000230 Ga0055524_100023057 97
211 3300003775 Ga0055524_1015699 Ga0055524_10156993 97
212 3300003790 Ga0055528_1000018 Ga0055528_100001810 97
213 3300003790 Ga0055528_1000040 Ga0055528_10000407 97
214 3300003790 Ga0055528_1045517 Ga0055528_10455171 97
215 3300005262 Ga0065165_1008130 Ga0065165_10081303 97
216 3300006948 Ga0099826_10000073 Ga0099826_1000007314 97
217 3300009763 Ga0123340_1036493 Ga0123340_10364933 97
218 3300009763 Ga0123340_1046171 Ga0123340_10461713 97
219 3300009765 Ga0123341_1090025 Ga0123341_10900252 97
220 3300009765 Ga0123341_1094487 Ga0123341_10944872 97
221 3300009766 Ga0123342_1023968 Ga0123342_10239683 97
222 3300014325 Ga0163163_10972381 Ga0163163_109723813 97
223 3300025273 Ga0209673_1000055 Ga0209673_100005510 97
224 3300025273 Ga0209673_1000222 Ga0209673_100022296 97
225 3300025273 Ga0209673_1000647 Ga0209673_100064772 97
226 3300025284 Ga0209130_1019606 Ga0209130_10196061 97
227 3300025291 Ga0209675_1103328 Ga0209675_11033281 97
228 3300025294 Ga0209025_1004832 Ga0209025_10048327 97
229 3300025295 Ga0209564_1000258 Ga0209564_100025896 97
230 3300025295 Ga0209564_1000396 Ga0209564_100039677 97
231 3300025295 Ga0209564_1052276 Ga0209564_10522762 97
232 3300025297 Ga0209758_1050519 Ga0209758_10505193 97
233 3300025299 Ga0209256_1000147 Ga0209256_100014711 97
234 3300025299 Ga0209256_1000202 Ga0209256_100020296 97
235 3300025299 Ga0209256_1000217 Ga0209256_100021718 97
236 3300025299 Ga0209256_1044020 Ga0209256_10440202 97
237 3300027666 Ga0209282_1028342 Ga0209282_10283424 97
238 3300031911 Ga0307412_11068202 Ga0307412_110682022 97
239 3300031995 Ga0307409_101018332 Ga0307409_1010183322 97
240 3300032004 Ga0307414_10441929 Ga0307414_104419292 97
241 3300046507 Ga0495606_0069999 Ga0495606_0069999_343_681 97
242 3300046507 Ga0495606_0070450 Ga0495606_0070450_1043_1381 97
243 3300046557 Ga0495622_0064645 Ga0495622_0064645_898_1236 97
244 3300047317 Ga0495604_0388382 Ga0495604_0388382_518_862 97
245 3300048909 Ga0496106_0090639 Ga0496106_0090639_1473_1823 97
246 3300048919 Ga0496116_0125766 Ga0496116_0125766_313_651 97
247 3300048919 Ga0496116_0134169 Ga0496116_0134169_595_933 97
248 3300048920 Ga0496117_0005675 Ga0496117_0005675_4172_4516 97
249 3300048921 Ga0496118_0033219 Ga0496118_0033219_174_512 97
250 3300048922 Ga0496119_0353444 Ga0496119_0353444_299_637 97
251 3300048924 Ga0496121_0024416 Ga0496121_0024416_5065_5403 97
252 3300048924 Ga0496121_0063329 Ga0496121_0063329_394_744 97
253 3300048924 Ga0496121_0101408 Ga0496121_0101408_726_1064 97
254 3300048924 Ga0496121_0431883 Ga0496121_0431883_305_643 97
255 3300048926 Ga0496123_0055773 Ga0496123_0055773_2131_2469 97
256 3300048927 Ga0496124_0000064 Ga0496124_0000064_176796_177134 97
257 3300048927 Ga0496124_0000184 Ga0496124_0000184_111958_112296 97
258 3300048928 Ga0496125_0148427 Ga0496125_0148427_1022_1360 97
259 3300048929 Ga0496126_0217839 Ga0496126_0217839_1086_1424 97
260 3300053125 Ga0500618_007784 Ga0500618_007784_2166_2504 97
261 3300053153 Ga0500616_0000766 Ga0500616_0000766_5007_5345 97
262 3300053158 Ga0500627_0276795 Ga0500627_0276795_243_581 97
263 3300002739 JGI25158J39367_1001570 JGI25158J39367_10015702 98
264 3300002987 JGI25159J45721_1000019 JGI25159J45721_100001937 98
265 3300003316 rootH1_10097410 rootH1_100974106 98
266 3300003323 rootH1_10113672 rootH1_101136724 98
267 3300003354 JGI25160J50197_1000054 JGI25160J50197_100005437 98
268 3300003374 JGI25161J50226_1000615 JGI25161J50226_10006154 98
269 3300003791 Ga0055530_10027884 Ga0055530_100278843 98
270 3300003794 Ga0055531_10015733 Ga0055531_100157333 98
271 3300003794 Ga0055531_10031923 Ga0055531_100319232 98
272 3300003794 Ga0055531_10040014 Ga0055531_100400142 98
273 3300004625 Ga0055543_1000214 Ga0055543_100021442 98
274 3300005262 Ga0065165_1000136 Ga0065165_100013637 98
275 3300005327 Ga0070658_10982377 Ga0070658_109823772 98
276 3300005367 Ga0070667_101565335 Ga0070667_1015653352 98
277 3300005539 Ga0068853_100153595 Ga0068853_1001535953 98
278 3300005614 Ga0068856_100399127 Ga0068856_1003991273 98
279 3300005616 Ga0068852_100336536 Ga0068852_1003365362 98
280 3300005937 Ga0081455_10005309 Ga0081455_1000530914 98
281 3300006048 Ga0075363_100650194 Ga0075363_1006501941 98
282 3300006353 Ga0075370_10120500 Ga0075370_101205003 98
283 3300006353 Ga0075370_10890106 Ga0075370_108901062 98
284 3300006946 Ga0079104_1029122 Ga0079104_10291222 98
285 3300006948 Ga0099826_10065159 Ga0099826_100651593 98
286 3300006948 Ga0099826_10094481 Ga0099826_100944813 98
287 3300009174 Ga0105241_11590021 Ga0105241_115900212 98
288 3300009545 Ga0105237_10116601 Ga0105237_101166014 98
289 3300009551 Ga0105238_10129634 Ga0105238_101296343 98
290 3300010375 Ga0105239_10170329 Ga0105239_101703292 98
291 3300013296 Ga0157374_10101630 Ga0157374_101016302 98
292 3300014325 Ga0163163_10208809 Ga0163163_102088093 98
293 3300014497 Ga0182008_10070430 Ga0182008_100704303 98
294 3300014968 Ga0157379_11072769 Ga0157379_110727692 98
295 3300015261 Ga0182006_1067737 Ga0182006_10677372 98
296 3300015262 Ga0182007_10023223 Ga0182007_100232233 98
297 3300022739 Ga0228711_1018095 Ga0228711_10180959 98
298 3300022739 Ga0228711_1044376 Ga0228711_10443763 98
299 3300022740 Ga0228710_1018344 Ga0228710_101834411 98
300 3300022740 Ga0228710_1021042 Ga0228710_10210422 98
301 3300022740 Ga0228710_1022781 Ga0228710_10227813 98
302 3300022740 Ga0228710_1026815 Ga0228710_10268152 98
303 3300022740 Ga0228710_1059257 Ga0228710_10592571 98
304 3300025208 Ga0209436_100174 Ga0209436_10017429 98
305 3300025284 Ga0209130_1000120 Ga0209130_100012094 98
306 3300025292 Ga0209676_1005070 Ga0209676_10050703 98
307 3300025292 Ga0209676_1050626 Ga0209676_10506262 98
308 3300025292 Ga0209676_1085422 Ga0209676_10854222 98
309 3300025302 Ga0207426_1000206 Ga0207426_100020694 98
310 3300025303 Ga0209051_1023713 Ga0209051_10237133 98
311 3300025304 Ga0209257_1000528 Ga0209257_100052842 98
312 3300025304 Ga0209257_1010440 Ga0209257_10104404 98
313 3300025304 Ga0209257_1032540 Ga0209257_10325402 98
314 3300025986 Ga0207658_11129974 Ga0207658_111299742 98
315 3300027111 Ga0209281_1001464 Ga0209281_10014645 98
316 3300027111 Ga0209281_1006583 Ga0209281_10065832 98
317 3300027111 Ga0209281_1030035 Ga0209281_10300352 98
318 3300027666 Ga0209282_1000144 Ga0209282_10001441 98
319 3300027666 Ga0209282_1001710 Ga0209282_10017109 98
320 3300027666 Ga0209282_1029725 Ga0209282_10297251 98
321 3300031548 Ga0307408_102202053 Ga0307408_1022020532 98
322 3300031967 Ga0315914_1000930 Ga0315914_100093022 98
323 3300031967 Ga0315914_1021379 Ga0315914_10213793 98
324 3300031967 Ga0315914_1040804 Ga0315914_10408043 98
325 3300033430 Ga0315913_1000087 Ga0315913_100008722 98
326 3300033430 Ga0315913_1036309 Ga0315913_10363093 98
327 3300033464 Ga0315915_1004322 Ga0315915_10043229 98
328 3300033464 Ga0315915_1017623 Ga0315915_10176233 98
329 3300037312 Ga0395899_0179598 Ga0395899_0179598_523_864 98
330 3300038443 Ga0395901_0277988 Ga0395901_0277988_622_963 98
331 3300041509 Ga0451843_0199528 Ga0451843_0199528_1060_1404 98
332 3300046452 Ga0495617_051982 Ga0495617_051982_582_923 98
333 3300046460 Ga0495638_0000175 Ga0495638_0000175_35223_35564 98
334 3300046474 Ga0495605_0008005 Ga0495605_0008005_2516_2857 98
335 3300046492 Ga0495585_0043890 Ga0495585_0043890_1238_1579 98
336 3300046501 Ga0495607_0030922 Ga0495607_0030922_1051_1395 98
337 3300046506 Ga0495583_0000721 Ga0495583_0000721_9543_9881 98
338 3300046507 Ga0495606_0591252 Ga0495606_0591252_100_441 98
339 3300046513 Ga0495616_0027526 Ga0495616_0027526_1527_1868 98
340 3300046518 Ga0495631_0030780 Ga0495631_0030780_1365_1706 98
341 3300046520 Ga0495637_0173125 Ga0495637_0173125_141_485 98
342 3300046522 Ga0495643_0042238 Ga0495643_0042238_1119_1463 98
343 3300046522 Ga0495643_0146100 Ga0495643_0146100_99_440 98
344 3300046524 Ga0495648_0076907 Ga0495648_0076907_215_559 98
345 3300046530 Ga0495654_0135551 Ga0495654_0135551_55_396 98
346 3300046542 Ga0495597_0249368 Ga0495597_0249368_103_444 98
347 3300046616 Ga0495668_0105631 Ga0495668_0105631_159_500 98
348 3300046648 Ga0495611_0155391 Ga0495611_0155391_347_688 98
349 3300046660 Ga0495625_0061298 Ga0495625_0061298_1198_1539 98
350 3300046660 Ga0495625_0732369 Ga0495625_0732369_78_428 98
351 3300046684 Ga0495669_0147486 Ga0495669_0147486_554_895 98
352 3300046691 Ga0495670_0060244 Ga0495670_0060244_1270_1611 98
353 3300047318 Ga0495636_0094894 Ga0495636_0094894_660_1001 98
354 3300048915 Ga0496112_0842699 Ga0496112_0842699_283_624 98
355 3300048916 Ga0496113_0160535 Ga0496113_0160535_627_968 98
356 3300048925 Ga0496122_0131713 Ga0496122_0131713_166_510 98
357 3300049523 Ga0501300_020760 Ga0501300_020760_557_904 98
358 3300049568 Ga0501031_0005251 Ga0501031_0005251_4271_4615 98
359 3300049568 Ga0501031_0341739 Ga0501031_0341739_351_698 98
360 3300049569 Ga0501032_0000213 Ga0501032_0000213_36226_36570 98
361 3300049569 Ga0501032_0161309 Ga0501032_0161309_846_1193 98
362 3300049570 Ga0501033_0002421 Ga0501033_0002421_11527_11871 98
363 3300049571 Ga0501034_0000318 Ga0501034_0000318_79945_80280 98
364 3300049571 Ga0501034_0000569 Ga0501034_0000569_11528_11872 98
365 3300049572 Ga0501036_0003423 Ga0501036_0003423_4018_4362 98
366 3300049573 Ga0501037_0001683 Ga0501037_0001683_11506_11850 98
367 3300049573 Ga0501037_0124358 Ga0501037_0124358_1183_1518 98
368 3300049574 Ga0501038_0000021 Ga0501038_0000021_145368_145703 98
369 3300049574 Ga0501038_0000124 Ga0501038_0000124_36244_36588 98
370 3300049574 Ga0501038_0609844 Ga0501038_0609844_138_485 98
371 3300049575 Ga0501039_0000026 Ga0501039_0000026_145352_145687 98
372 3300049575 Ga0501039_0000204 Ga0501039_0000204_35539_35883 98
373 3300049579 Ga0501043_0001410 Ga0501043_0001410_15777_16112 98
374 3300049579 Ga0501043_0001818 Ga0501043_0001818_11521_11865 98
375 3300049579 Ga0501043_0019585 Ga0501043_0019585_4499_4846 98
376 3300049580 Ga0501046_0086449 Ga0501046_0086449_619_963 98
377 3300049580 Ga0501046_0120315 Ga0501046_0120315_1120_1455 98
378 3300049581 Ga0501047_0110985 Ga0501047_0110985_133_477 98
379 3300049581 Ga0501047_0330506 Ga0501047_0330506_926_1261 98
380 3300049671 Ga0501238_001376 Ga0501238_001376_96_446 98
381 3300049776 Ga0501280_000674 Ga0501280_000674_4468_4815 98
382 3300049822 Ga0501035_0000204 Ga0501035_0000204_47805_48149 98
383 3300049822 Ga0501035_0018919 Ga0501035_0018919_1316_1651 98
384 3300049822 Ga0501035_0826588 Ga0501035_0826588_364_699 98
385 3300049823 Ga0501044_0246930 Ga0501044_0246930_480_824 98
386 3300049823 Ga0501044_0819029 Ga0501044_0819029_169_504 98
387 3300053086 Ga0500578_0053716 Ga0500578_0053716_1644_1985 98
388 3300053087 Ga0500643_072085 Ga0500643_072085_295_636 98
389 3300053104 Ga0500556_0314884 Ga0500556_0314884_158_499 98
390 3300053105 Ga0500557_000547 Ga0500557_000547_1406_1747 98
391 3300053109 Ga0500569_007625 Ga0500569_007625_542_883 98
392 3300053118 Ga0500594_0000750 Ga0500594_0000750_4868_5209 98
393 3300053125 Ga0500618_004847 Ga0500618_004847_2382_2726 98
394 3300053130 Ga0500642_0085784 Ga0500642_0085784_516_851 98
395 3300053134 Ga0500658_0021911 Ga0500658_0021911_2052_2393 98
396 3300053139 Ga0500568_0000092 Ga0500568_0000092_59499_59840 98
397 3300053139 Ga0500568_0001320 Ga0500568_0001320_10163_10498 98
398 3300053142 Ga0500577_0074821 Ga0500577_0074821_870_1211 98
399 3300053153 Ga0500616_0000751 Ga0500616_0000751_11654_11995 98
400 3300053158 Ga0500627_0361156 Ga0500627_0361156_86_427 98
401 3300053730 Ga0500645_196678 Ga0500645_196678_88_429 98
402 2010549000 RicEn_FSXC32416_b1 RicEn_348560 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

3

101

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r0e-assembly1.cif.gz_B early transcription elongation state of influenza a/h7n9 polymerase backtracked due to double incoproation of nucleotide analogue t1106 and with singly incoporated t1106 at the +1 position 0.9036 52 90
1wqf-assembly1.cif.gz_A crystal structure of ribosome recycling factor from mycobacterium tuberculosis 0.866 56 90
4gfq-assembly1.cif.gz_A 2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis 0.8539 56 89
5u96-assembly3.cif.gz_F crystal structure of the coiled-coil domain from listeria innocua (tetragonal form) 0.8351 58 92
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.8157 56 90
ID Description Score Start End Superfamily
af_Q9ZUB5_14_76_1.20.1160.11 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat);Paired amphipathic helix 0.8844 58 89 1.20.1160.11
af_Q9FZK9_176_240_1.20.1160.11 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat);Paired amphipathic helix 0.8712 52 87 1.20.1160.11
af_Q9VLG9_11_109_1.10.275.10 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.869 59 90 1.10.275.10
af_O01976_1_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8624 57 90 3.40.50.300
4kb2A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.8579 56 90 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A7W6G2V1-F1-model_v4 Type IV secretory pathway VirB2 component (Pilin) 0.9009 43 93 GO:0016020
AF-A0A176F838-F1-model_v4 VIRB2 type IV secretion 0.8809 36 93 GO:0016020
AF-A0A5C4R3Y1-F1-model_v4 TrbC/VirB2 family protein 0.8682 36 93 GO:0016020
AF-A0A1F2ZJV3-F1-model_v4 Type IV secretion system protein VirB2 0.8682 39 93 GO:0016020
AF-A0A7T4TCR9-F1-model_v4 Mating pair formation protein 0.8662 36 92 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.77 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map