F435231

General Info

Members Datasets Scaffolds Average Seq Length
402 215 804 150

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_56541_c1|nmdc:mga0k408_56541_c1_107_637
Length 176
Sequence VFTGLPACRRRQDRKFALAIVSGEDHMSGLLRCLVGFAMVVGAVTPVAAQQPAPAGHIKTVSGTAAIVRAGGTVTARPGDPIYATDTLRTSADGSIGVTLRDDTRVSLGPNSEVKVDRYVYSPGEGGLGMVLKFVRGVAVYVSGRMAKIAPDSIRLEAPSAIVGVRGTTVAIRVGD

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.72
Nodule 0
Rhizoplane 1.49
Rhizosphere 92.29
Stem 0
Stem Tuber 0
Unclassified 29.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_56541_c1 3300050493 Bacteria 2277
2 MBSR1b_contig_14037159 2162886012 Unclassified 882
3 Ga0065712_10073771 3300005290 Bacteria 4282
4 Ga0065712_10325866 3300005290 Unclassified 821
5 Ga0065715_10000940 3300005293 Bacteria 7630
6 Ga0065715_10006980 3300005293 Bacteria 2761
7 Ga0065715_10046082 3300005293 Unclassified 800
8 Ga0065715_10146249 3300005293 Unclassified 1785
9 Ga0065715_10379250 3300005293 Unclassified 910
10 Ga0065707_10001980 3300005295 Bacteria 8692
11 Ga0065707_10446892 3300005295 Bacteria 750
12 Ga0065707_10678961 3300005295 Bacteria 649
13 Ga0070676_10075124 3300005328 Bacteria 2037
14 Ga0070676_10346492 3300005328 Unclassified 1020
15 Ga0070690_100347674 3300005330 Bacteria 1075
16 Ga0070670_100006920 3300005331 Bacteria 9614
17 Ga0068869_100000553 3300005334 Bacteria 20938
18 Ga0068869_100012484 3300005334 Bacteria 5617
19 Ga0068869_100016025 3300005334 Bacteria 5045
20 Ga0068869_100508491 3300005334 Bacteria 1007
21 Ga0068869_100891534 3300005334 Unclassified 769
22 Ga0070666_10109514 3300005335 Bacteria 1909
23 Ga0070666_10272556 3300005335 Bacteria 1201
24 Ga0068868_100206599 3300005338 Unclassified 1639
25 Ga0070689_100182953 3300005340 Bacteria 1703
26 Ga0070691_10255329 3300005341 Bacteria 942
27 Ga0070687_100164531 3300005343 Unclassified 1315
28 Ga0070661_100131398 3300005344 Bacteria 1881
29 Ga0070669_100042957 3300005353 Bacteria 3290
30 Ga0070669_100808253 3300005353 Bacteria 797
31 Ga0070675_100001400 3300005354 Bacteria 17695
32 Ga0070675_100197747 3300005354 Bacteria 1744
33 Ga0070675_100405218 3300005354 Bacteria 1217
34 Ga0070675_100929907 3300005354 Unclassified 797
35 Ga0070671_100042439 3300005355 Bacteria 3780
36 Ga0070674_100067664 3300005356 Bacteria 2513
37 Ga0070674_100445867 3300005356 Unclassified 1067
38 Ga0070673_100001168 3300005364 Bacteria 15074
39 Ga0070673_100015538 3300005364 Bacteria 5351
40 Ga0070673_100025011 3300005364 Bacteria 4387
41 Ga0070673_101637764 3300005364 Bacteria 608
42 Ga0070688_101205110 3300005365 Unclassified 608
43 Ga0070659_101290572 3300005366 Unclassified 647
44 Ga0070659_101820394 3300005366 Unclassified 545
45 Ga0070701_10003341 3300005438 Bacteria 6335
46 Ga0070701_10010799 3300005438 Bacteria 4054
47 Ga0070701_10193324 3300005438 Bacteria 1199
48 Ga0070711_100539898 3300005439 Bacteria 966
49 Ga0070705_100017103 3300005440 Bacteria 3780
50 Ga0070705_100100271 3300005440 Unclassified 1827
51 Ga0070705_100716184 3300005440 Bacteria 788
52 Ga0070700_100058053 3300005441 Bacteria 2430
53 Ga0070700_100399492 3300005441 Bacteria 1033
54 Ga0070694_100016075 3300005444 Bacteria 4710
55 Ga0070708_101706335 3300005445 Unclassified 585
56 Ga0070678_100106606 3300005456 Bacteria 2184
57 Ga0070678_100503316 3300005456 Bacteria 1069
58 Ga0070662_100200458 3300005457 Bacteria 1583
59 Ga0070662_101172151 3300005457 Unclassified 660
60 Ga0068867_100012260 3300005459 Bacteria 6059
61 Ga0068867_100013286 3300005459 Bacteria 5833
62 Ga0070685_10819016 3300005466 Bacteria 687
63 Ga0070706_100283519 3300005467 Unclassified 1546
64 Ga0070707_100926029 3300005468 Unclassified 836
65 Ga0070707_101577559 3300005468 Bacteria 623
66 Ga0070697_100778565 3300005536 Unclassified 846
67 Ga0070672_100011092 3300005543 Bacteria 6274
68 Ga0070672_100015934 3300005543 Bacteria 5368
69 Ga0070686_100099252 3300005544 Bacteria 1964
70 Ga0070686_100120100 3300005544 Bacteria 1803
71 Ga0070686_100163919 3300005544 Unclassified 1567
72 Ga0070695_100010149 3300005545 Bacteria 5616
73 Ga0070695_100192061 3300005545 Unclassified 1454
74 Ga0070695_100577362 3300005545 Bacteria 880
75 Ga0070696_100234697 3300005546 Unclassified 1381
76 Ga0070665_100007329 3300005548 Bacteria 11222
77 Ga0070704_100007833 3300005549 Bacteria 6371
78 Ga0070704_100023307 3300005549 Bacteria 4040
79 Ga0070704_100189238 3300005549 Bacteria 1653
80 Ga0070664_100833584 3300005564 Unclassified 863
81 Ga0068854_100017138 3300005578 Bacteria 4843
82 Ga0068854_100296707 3300005578 Bacteria 1306
83 Ga0068854_100473932 3300005578 Bacteria 1050
84 Ga0070702_100029636 3300005615 Bacteria 2978
85 Ga0068859_100038711 3300005617 Bacteria 4783
86 Ga0068859_100126865 3300005617 Bacteria 2621
87 Ga0068859_100769071 3300005617 Bacteria 1051
88 Ga0068859_101111276 3300005617 Bacteria 869
89 Ga0068866_10006550 3300005718 Bacteria 4856
90 Ga0068866_10147840 3300005718 Bacteria 1357
91 Ga0068866_10250200 3300005718 Bacteria 1084
92 Ga0068861_100055394 3300005719 Bacteria 3023
93 Ga0068861_100202604 3300005719 Bacteria 1667
94 Ga0068861_100817145 3300005719 Unclassified 876
95 Ga0068861_101394691 3300005719 Bacteria 684
96 Ga0068861_101613090 3300005719 Unclassified 639
97 Ga0068851_10181075 3300005834 Bacteria 1167
98 Ga0068870_10627442 3300005840 Unclassified 733
99 Ga0068863_100115458 3300005841 Unclassified 2558
100 Ga0068858_100041092 3300005842 Bacteria 4289
101 Ga0068858_100181437 3300005842 Bacteria 1988
102 Ga0068860_100035822 3300005843 Bacteria 4758
103 Ga0068860_100037830 3300005843 Bacteria 4618
104 Ga0068860_100188178 3300005843 Bacteria 1997
105 Ga0068860_100544531 3300005843 Unclassified 1162
106 Ga0068862_100726150 3300005844 Unclassified 964
107 Ga0068862_100854965 3300005844 Unclassified 892
108 Ga0081539_10086054 3300005985 Bacteria 1637
109 Ga0075365_10008343 3300006038 Bacteria 5874
110 Ga0075365_10025309 3300006038 Bacteria 3755
111 Ga0075368_10000900 3300006042 Bacteria 9217
112 Ga0075368_10325701 3300006042 Unclassified 666
113 Ga0075364_10079502 3300006051 Bacteria 2167
114 Ga0075367_11055860 3300006178 Bacteria 519
115 Ga0075369_10264882 3300006186 Bacteria 799
116 Ga0075366_10002301 3300006195 Bacteria 9757
117 Ga0075366_10579532 3300006195 Unclassified 695
118 Ga0097621_100127658 3300006237 Unclassified 2161
119 Ga0097621_100382073 3300006237 Bacteria 1258
120 Ga0075370_10001069 3300006353 Bacteria 11403
121 Ga0075370_10268708 3300006353 Bacteria 1012
122 Ga0075428_100077769 3300006844 Bacteria 3621
123 Ga0075428_100428030 3300006844 Unclassified 1418
124 Ga0075430_100035106 3300006846 Bacteria 4256
125 Ga0075430_100408429 3300006846 Bacteria 1121
126 Ga0075431_100244714 3300006847 Bacteria 1823
127 Ga0075431_100246975 3300006847 Bacteria 1814
128 Ga0075433_10042086 3300006852 Unclassified 3962
129 Ga0075433_11231058 3300006852 Unclassified 649
130 Ga0075434_100002468 3300006871 Bacteria 16280
131 Ga0075434_100182157 3300006871 Bacteria 2121
132 Ga0075434_100703489 3300006871 Unclassified 1028
133 Ga0075429_100233388 3300006880 Bacteria 1612
134 Ga0075429_100634060 3300006880 Unclassified 936
135 Ga0068865_100023495 3300006881 Bacteria 4037
136 Ga0068865_100231848 3300006881 Bacteria 1449
137 Ga0068865_100237266 3300006881 Bacteria 1433
138 Ga0075436_100126497 3300006914 Bacteria 1791
139 Ga0075436_101103840 3300006914 Unclassified 597
140 Ga0097620_100038712 3300006931 Bacteria 4783
141 Ga0097620_100126854 3300006931 Bacteria 2621
142 Ga0097620_100769064 3300006931 Bacteria 1051
143 Ga0097620_101111290 3300006931 Bacteria 869
144 Ga0075435_100009062 3300007076 Bacteria 7179
145 Ga0075435_100016551 3300007076 Bacteria 5561
146 Ga0075435_100891969 3300007076 Unclassified 775
147 Ga0075435_101579478 3300007076 Unclassified 575
148 Ga0111539_10155941 3300009094 Bacteria 2672
149 Ga0111539_10185346 3300009094 Bacteria 2430
150 Ga0105245_10235422 3300009098 Bacteria 1773
151 Ga0114129_10007304 3300009147 Bacteria 15734
152 Ga0114129_10012938 3300009147 Bacteria 11875
153 Ga0114129_10066847 3300009147 Bacteria 5013
154 Ga0114129_10210546 3300009147 Bacteria 2628
155 Ga0114129_10713440 3300009147 Bacteria 1288
156 Ga0114129_11831882 3300009147 Bacteria 737
157 Ga0114129_13142601 3300009147 Bacteria 539
158 Ga0105243_10010769 3300009148 Bacteria 6922
159 Ga0105243_12760752 3300009148 Bacteria 531
160 Ga0105241_11144690 3300009174 Unclassified 735
161 Ga0105242_10003052 3300009176 Bacteria 13085
162 Ga0105242_10005206 3300009176 Bacteria 10039
163 Ga0105242_10786503 3300009176 Bacteria 940
164 Ga0105248_10062023 3300009177 Bacteria 4198
165 Ga0105249_10273028 3300009553 Bacteria 1685
166 Ga0157378_10525153 3300013297 Bacteria 1186
167 Ga0157378_10789919 3300013297 Unclassified 974
168 Ga0163162_10939074 3300013306 Bacteria 976
169 Ga0157380_10014145 3300014326 Bacteria 5835
170 Ga0157380_10064217 3300014326 Bacteria 2946
171 Ga0157377_10238932 3300014745 Bacteria 1172
172 Ga0157379_11039943 3300014968 Bacteria 782
173 Ga0157376_10035846 3300014969 Bacteria 4014
174 Ga0157376_10123057 3300014969 Unclassified 2302
175 Ga0163161_10206966 3300017792 Bacteria 1514
176 Ga0213876_10330624 3300021384 Bacteria 810
177 Ga0207697_10437734 3300025315 Unclassified 580
178 Ga0207642_10008018 3300025899 Bacteria 3600
179 Ga0207642_10218918 3300025899 Bacteria 1063
180 Ga0207688_10059134 3300025901 Bacteria 2158
181 Ga0207680_10091688 3300025903 Bacteria 1934
182 Ga0207680_10095808 3300025903 Bacteria 1897
183 Ga0207647_10310665 3300025904 Bacteria 896
184 Ga0207645_10001856 3300025907 Bacteria 17036
185 Ga0207645_10003917 3300025907 Bacteria 11116
186 Ga0207645_10237384 3300025907 Bacteria 1204
187 Ga0207645_10832231 3300025907 Unclassified 627
188 Ga0207684_10153295 3300025910 Unclassified 1983
189 Ga0207684_11263759 3300025910 Unclassified 609
190 Ga0207695_10680576 3300025913 Unclassified 909
191 Ga0207660_10876582 3300025917 Bacteria 732
192 Ga0207662_10000887 3300025918 Bacteria 13849
193 Ga0207646_10147895 3300025922 Unclassified 2117
194 Ga0207681_10199758 3300025923 Bacteria 1535
195 Ga0207650_10044558 3300025925 Bacteria 3261
196 Ga0207659_10004182 3300025926 Bacteria 8716
197 Ga0207659_10245311 3300025926 Bacteria 1451
198 Ga0207659_10593367 3300025926 Unclassified 944
199 Ga0207644_10129753 3300025931 Bacteria 1928
200 Ga0207706_10035707 3300025933 Bacteria 4418
201 Ga0207706_10167659 3300025933 Bacteria 1930
202 Ga0207686_10008706 3300025934 Bacteria 5482
203 Ga0207686_10038263 3300025934 Bacteria 2901
204 Ga0207709_10006295 3300025935 Bacteria 6665
205 Ga0207670_10143390 3300025936 Bacteria 1763
206 Ga0207670_10762716 3300025936 Unclassified 804
207 Ga0207669_10523596 3300025937 Unclassified 952
208 Ga0207669_10807300 3300025937 Bacteria 778
209 Ga0207704_10006305 3300025938 Bacteria 5521
210 Ga0207691_10055971 3300025940 Bacteria 3594
211 Ga0207691_10070328 3300025940 Bacteria 3160
212 Ga0207711_10008552 3300025941 Bacteria 8561
213 Ga0207711_10017882 3300025941 Bacteria 5890
214 Ga0207711_10144205 3300025941 Bacteria 2144
215 Ga0207689_10000699 3300025942 Bacteria 32122
216 Ga0207689_10043375 3300025942 Bacteria 3718
217 Ga0207689_10057097 3300025942 Bacteria 3211
218 Ga0207689_10269436 3300025942 Unclassified 1410
219 Ga0207689_10316342 3300025942 Bacteria 1295
220 Ga0207689_10821629 3300025942 Unclassified 784
221 Ga0207679_10865831 3300025945 Bacteria 826
222 Ga0207679_11008337 3300025945 Unclassified 763
223 Ga0207651_10004694 3300025960 Bacteria 6932
224 Ga0207651_10008171 3300025960 Bacteria 5634
225 Ga0207651_10011076 3300025960 Bacteria 5030
226 Ga0207651_11494991 3300025960 Bacteria 608
227 Ga0207712_10701952 3300025961 Bacteria 883
228 Ga0207668_10415436 3300025972 Bacteria 1141
229 Ga0207640_10012529 3300025981 Bacteria 4834
230 Ga0207640_10292253 3300025981 Unclassified 1285
231 Ga0207640_10387677 3300025981 Bacteria 1134
232 Ga0207703_10041459 3300026035 Bacteria 3688
233 Ga0207703_10057414 3300026035 Bacteria 3174
234 Ga0207678_10508605 3300026067 Bacteria 1050
235 Ga0207708_10000952 3300026075 Bacteria 21691
236 Ga0207708_10007509 3300026075 Bacteria 8059
237 Ga0207708_10119050 3300026075 Unclassified 2057
238 Ga0207641_10244103 3300026088 Unclassified 1675
239 Ga0207648_10000406 3300026089 Bacteria 47912
240 Ga0207648_10001926 3300026089 Bacteria 22688
241 Ga0207675_100025025 3300026118 Bacteria 5555
242 Ga0207675_100577089 3300026118 Bacteria 1126
243 Ga0207675_101450236 3300026118 Unclassified 707
244 Ga0207683_10043360 3300026121 Bacteria 3932
245 Ga0207683_10098478 3300026121 Bacteria 2609
246 Ga0207698_12475950 3300026142 Unclassified 529
247 Ga0209813_10083593 3300027866 Bacteria 1060
248 Ga0209813_10256347 3300027866 Unclassified 666
249 Ga0207428_10328028 3300027907 Unclassified 1129
250 Ga0207428_10460487 3300027907 Unclassified 926
251 Ga0207428_11185727 3300027907 Unclassified 531
252 Ga0268266_10460785 3300028379 Bacteria 1209
253 Ga0268265_11087393 3300028380 Bacteria 793
254 Ga0268265_11097088 3300028380 Bacteria 790
255 Ga0268264_10057407 3300028381 Bacteria 3256
256 Ga0268264_10373506 3300028381 Bacteria 1363
257 Ga0268264_10702801 3300028381 Unclassified 1004
258 Ga0307408_100072136 3300031548 Bacteria 2555
259 Ga0307408_100213384 3300031548 Unclassified 1570
260 Ga0307408_100475155 3300031548 Bacteria 1089
261 Ga0307408_101371714 3300031548 Bacteria 665
262 Ga0307405_10024575 3300031731 Unclassified 3444
263 Ga0307410_10055999 3300031852 Bacteria 2679
264 Ga0307410_11779412 3300031852 Bacteria 547
265 Ga0307406_11274914 3300031901 Unclassified 640
266 Ga0307407_10108759 3300031903 Bacteria 1736
267 Ga0307412_10025176 3300031911 Bacteria 3682
268 Ga0307409_100074206 3300031995 Bacteria 2717
269 Ga0307409_100666855 3300031995 Bacteria 1036
270 Ga0307409_102300154 3300031995 Bacteria 568
271 Ga0307416_100128438 3300032002 Bacteria 2275
272 Ga0307416_100229975 3300032002 Unclassified 1787
273 Ga0307416_100347087 3300032002 Unclassified 1500
274 Ga0307416_100749143 3300032002 Unclassified 1069
275 Ga0307411_10051468 3300032005 Bacteria 2687
276 Ga0307415_100011262 3300032126 Bacteria 5110
277 Ga0307415_100189661 3300032126 Bacteria 1621
278 Ga0307415_101436844 3300032126 Unclassified 658
279 Ga0307415_101476295 3300032126 Unclassified 650
280 Ga0373932_0386506 3300035112 Unclassified 539
281 Ga0373954_0337833 3300035118 Unclassified 744
282 Ga0373956_0379935 3300035119 Unclassified 674
283 Ga0373943_0328814 3300035170 Unclassified 873
284 Ga0373924_0323045 3300035410 Bacteria 686
285 Ga0373947_0092108 3300035725 Unclassified 1892
286 Ga0373937_0187320 3300036401 Unclassified 1944
287 Ga0373925_1015689 3300037068 Unclassified 683
288 Ga0436365_0300220 3300039437 Bacteria 2455
289 Ga0439431_0006669 3300041997 Bacteria 2559
290 Ga0439433_0035136 3300041999 Bacteria 1155
291 Ga0439462_0087742 3300042015 Unclassified 852
292 Ga0439446_0070127 3300042156 Unclassified 1071
293 Ga0439434_0007922 3300042435 Bacteria 3115
294 Ga0439434_0168013 3300042435 Unclassified 731
295 Ga0439435_0204121 3300042436 Unclassified 653
296 Ga0451576_1207785 3300045051 Bacteria 789
297 Ga0495603_0200869 3300046455 Bacteria 1152
298 Ga0495658_0053891 3300046683 Unclassified 2286
299 Ga0495600_0343364 3300046809 Bacteria 936
300 Ga0496102_0092221 3300048905 Bacteria 2805
301 Ga0496103_0801143 3300048906 Unclassified 594
302 Ga0496104_1375017 3300048907 Unclassified 609
303 Ga0496109_0214336 3300048912 Bacteria 1811
304 Ga0496112_0338690 3300048915 Bacteria 1448
305 Ga0496114_0720488 3300048917 Bacteria 874
306 Ga0501290_038696 3300049513 Unclassified 708
307 Ga0501031_0360097 3300049568 Bacteria 941
308 Ga0501032_0264873 3300049569 Bacteria 1114
309 Ga0501033_0563005 3300049570 Unclassified 784
310 Ga0501036_0114436 3300049572 Bacteria 2279
311 Ga0501036_0251734 3300049572 Bacteria 1480
312 Ga0501036_0434745 3300049572 Unclassified 1094
313 Ga0501037_0643816 3300049573 Unclassified 709
314 Ga0501038_0196935 3300049574 Bacteria 1619
315 Ga0501039_0113002 3300049575 Bacteria 2124
316 Ga0501039_0137301 3300049575 Bacteria 1920
317 Ga0501039_1538640 3300049575 Unclassified 511
318 Ga0501040_0218653 3300049576 Bacteria 1355
319 Ga0501041_0053117 3300049577 Bacteria 2471
320 Ga0501041_0098202 3300049577 Bacteria 1811
321 Ga0501041_0148626 3300049577 Bacteria 1462
322 Ga0501042_0069592 3300049578 Bacteria 2517
323 Ga0501042_0270398 3300049578 Bacteria 1227
324 Ga0501042_0612289 3300049578 Unclassified 792
325 Ga0501046_0051808 3300049580 Bacteria 3238
326 Ga0501046_0086908 3300049580 Bacteria 2410
327 Ga0501048_0060946 3300049582 Bacteria 2673
328 Ga0501048_0138589 3300049582 Bacteria 1720
329 Ga0501067_0007508 3300049583 Bacteria 6058
330 Ga0501068_0442778 3300049584 Unclassified 840
331 Ga0501071_0048473 3300049587 Bacteria 3055
332 Ga0501071_0590169 3300049587 Bacteria 854
333 Ga0501071_0713799 3300049587 Unclassified 772
334 Ga0501071_0738137 3300049587 Unclassified 758
335 Ga0501071_1277291 3300049587 Unclassified 567
336 Ga0501072_0041836 3300049588 Bacteria 3599
337 Ga0501072_0279676 3300049588 Bacteria 1327
338 Ga0501072_0308689 3300049588 Bacteria 1258
339 Ga0501072_0312817 3300049588 Bacteria 1248
340 Ga0501072_0851114 3300049588 Bacteria 713
341 Ga0501073_0213342 3300049589 Bacteria 1334
342 Ga0501074_0635854 3300049590 Unclassified 754
343 Ga0501075_0046937 3300049591 Bacteria 3245
344 Ga0501075_0278302 3300049591 Unclassified 1275
345 Ga0501075_0345696 3300049591 Bacteria 1133
346 Ga0501075_0361010 3300049591 Unclassified 1107
347 Ga0501075_0597101 3300049591 Bacteria 842
348 Ga0501076_0095811 3300049592 Bacteria 2390
349 Ga0501076_0278522 3300049592 Bacteria 1370
350 Ga0501076_0544620 3300049592 Unclassified 957
351 Ga0501077_0588062 3300049593 Bacteria 715
352 Ga0501079_0322709 3300049741 Bacteria 1209
353 Ga0501080_1117061 3300049742 Unclassified 680
354 Ga0501081_0021665 3300049743 Bacteria 4290
355 Ga0501081_0147090 3300049743 Bacteria 1691
356 Ga0501081_0243361 3300049743 Unclassified 1312
357 Ga0501035_0240820 3300049822 Bacteria 1539
358 Ga0501035_0297367 3300049822 Bacteria 1361
359 Ga0501044_1183750 3300049823 Unclassified 632
360 Ga0501045_0039011 3300049824 Bacteria 3456
361 Ga0501045_0122239 3300049824 Unclassified 1933
362 Ga0501045_0290950 3300049824 Bacteria 1215
363 nmdc:mga00v17_118135_c1 3300050491 Bacteria 1687
364 nmdc:mga00v17_7769_c1 3300050491 Bacteria 5747
365 nmdc:mga0yw44_22502_c1 3300050492 Bacteria 3536
366 nmdc:mga0yw44_356129_c1 3300050492 Bacteria 986
367 nmdc:mga06z11_45849_c1 3300050494 Bacteria 2212
368 nmdc:mga06z11_536075_c1 3300050494 Bacteria 710
369 nmdc:mga06z11_966297_c1 3300050494 Bacteria 519
370 nmdc:mga04h51_135894_c1 3300050495 Bacteria 929
371 nmdc:mga07m45_272658_c1 3300050496 Bacteria 984
372 nmdc:mga05p37_159337_c1 3300050507 Bacteria 2757
373 nmdc:mga05p37_67028_c1 3300050507 Bacteria 4416
374 nmdc:mga05p37_773442_c1 3300050507 Unclassified 1055
375 nmdc:mga09592_230507_c1 3300050508 Unclassified 1604
376 nmdc:mga0qj67_19626_c1 3300050509 Bacteria 5167
377 nmdc:mga0qj67_384713_c1 3300050509 Bacteria 1133
378 nmdc:mga06r32_1501948_c1 3300050510 Unclassified 614
379 nmdc:mga06r32_1610082_c1 3300050510 Unclassified 588
380 nmdc:mga06r32_176633_c1 3300050510 Bacteria 2120
381 nmdc:mga06r32_294082_c1 3300050510 Unclassified 1611
382 nmdc:mga06r32_406181_c1 3300050510 Unclassified 1344
383 nmdc:mga08y16_135132_c1 3300050511 Bacteria 2563
384 nmdc:mga08y16_331178_c1 3300050511 Unclassified 1566
385 nmdc:mga08y16_89174_c1 3300050511 Bacteria 3214
386 nmdc:mga0rr50_842494_c1 3300050513 Unclassified 782
387 nmdc:mga08x19_160098_c1 3300050514 Bacteria 1528
388 nmdc:mga0a205_474349_c1 3300050515 Bacteria 1110
389 Ga0495619_0750126 3300053085 Bacteria 662
390 Ga0501084_0212366 3300054114 Bacteria 1632
391 Ga0501084_0256847 3300054114 Bacteria 1475
392 Ga0501084_0740707 3300054114 Bacteria 828
393 Ga0501084_0914187 3300054114 Bacteria 738
394 Ga0590071_000238 3300059421 Bacteria 16092
395 Ga0590074_007445 3300059423 Unclassified 1820
396 Ga0590075_001697 3300059424 Bacteria 5417
397 Ga0590077_000780 3300059426 Bacteria 8310
398 Ga0587079_159456 3300059647 Unclassified 589
399 Ga0501082_0400160 3300060353 Bacteria 1198
400 Ga0501082_0433721 3300060353 Bacteria 1148
401 Ga0530510_0341009 3300061734 Unclassified 1125
402 Ga0530510_0650600 3300061734 Unclassified 802
403 nmdc:mga0k408_56541_c1
404 MBSR1b_contig_14037159
405 Ga0065712_10073771
406 Ga0065712_10325866
407 Ga0065715_10000940
408 Ga0065715_10006980
409 Ga0065715_10046082
410 Ga0065715_10146249
411 Ga0065715_10379250
412 Ga0065707_10001980
413 Ga0065707_10446892
414 Ga0065707_10678961
415 Ga0070676_10075124
416 Ga0070676_10346492
417 Ga0070690_100347674
418 Ga0070670_100006920
419 Ga0068869_100000553
420 Ga0068869_100012484
421 Ga0068869_100016025
422 Ga0068869_100508491
423 Ga0068869_100891534
424 Ga0070666_10109514
425 Ga0070666_10272556
426 Ga0068868_100206599
427 Ga0070689_100182953
428 Ga0070691_10255329
429 Ga0070687_100164531
430 Ga0070661_100131398
431 Ga0070669_100042957
432 Ga0070669_100808253
433 Ga0070675_100001400
434 Ga0070675_100197747
435 Ga0070675_100405218
436 Ga0070675_100929907
437 Ga0070671_100042439
438 Ga0070674_100067664
439 Ga0070674_100445867
440 Ga0070673_100001168
441 Ga0070673_100015538
442 Ga0070673_100025011
443 Ga0070673_101637764
444 Ga0070688_101205110
445 Ga0070659_101290572
446 Ga0070659_101820394
447 Ga0070701_10003341
448 Ga0070701_10010799
449 Ga0070701_10193324
450 Ga0070711_100539898
451 Ga0070705_100017103
452 Ga0070705_100100271
453 Ga0070705_100716184
454 Ga0070700_100058053
455 Ga0070700_100399492
456 Ga0070694_100016075
457 Ga0070708_101706335
458 Ga0070678_100106606
459 Ga0070678_100503316
460 Ga0070662_100200458
461 Ga0070662_101172151
462 Ga0068867_100012260
463 Ga0068867_100013286
464 Ga0070685_10819016
465 Ga0070706_100283519
466 Ga0070707_100926029
467 Ga0070707_101577559
468 Ga0070697_100778565
469 Ga0070672_100011092
470 Ga0070672_100015934
471 Ga0070686_100099252
472 Ga0070686_100120100
473 Ga0070686_100163919
474 Ga0070695_100010149
475 Ga0070695_100192061
476 Ga0070695_100577362
477 Ga0070696_100234697
478 Ga0070665_100007329
479 Ga0070704_100007833
480 Ga0070704_100023307
481 Ga0070704_100189238
482 Ga0070664_100833584
483 Ga0068854_100017138
484 Ga0068854_100296707
485 Ga0068854_100473932
486 Ga0070702_100029636
487 Ga0068859_100038711
488 Ga0068859_100126865
489 Ga0068859_100769071
490 Ga0068859_101111276
491 Ga0068866_10006550
492 Ga0068866_10147840
493 Ga0068866_10250200
494 Ga0068861_100055394
495 Ga0068861_100202604
496 Ga0068861_100817145
497 Ga0068861_101394691
498 Ga0068861_101613090
499 Ga0068851_10181075
500 Ga0068870_10627442
501 Ga0068863_100115458
502 Ga0068858_100041092
503 Ga0068858_100181437
504 Ga0068860_100035822
505 Ga0068860_100037830
506 Ga0068860_100188178
507 Ga0068860_100544531
508 Ga0068862_100726150
509 Ga0068862_100854965
510 Ga0081539_10086054
511 Ga0075365_10008343
512 Ga0075365_10025309
513 Ga0075368_10000900
514 Ga0075368_10325701
515 Ga0075364_10079502
516 Ga0075367_11055860
517 Ga0075369_10264882
518 Ga0075366_10002301
519 Ga0075366_10579532
520 Ga0097621_100127658
521 Ga0097621_100382073
522 Ga0075370_10001069
523 Ga0075370_10268708
524 Ga0075428_100077769
525 Ga0075428_100428030
526 Ga0075430_100035106
527 Ga0075430_100408429
528 Ga0075431_100244714
529 Ga0075431_100246975
530 Ga0075433_10042086
531 Ga0075433_11231058
532 Ga0075434_100002468
533 Ga0075434_100182157
534 Ga0075434_100703489
535 Ga0075429_100233388
536 Ga0075429_100634060
537 Ga0068865_100023495
538 Ga0068865_100231848
539 Ga0068865_100237266
540 Ga0075436_100126497
541 Ga0075436_101103840
542 Ga0097620_100038712
543 Ga0097620_100126854
544 Ga0097620_100769064
545 Ga0097620_101111290
546 Ga0075435_100009062
547 Ga0075435_100016551
548 Ga0075435_100891969
549 Ga0075435_101579478
550 Ga0111539_10155941
551 Ga0111539_10185346
552 Ga0105245_10235422
553 Ga0114129_10007304
554 Ga0114129_10012938
555 Ga0114129_10066847
556 Ga0114129_10210546
557 Ga0114129_10713440
558 Ga0114129_11831882
559 Ga0114129_13142601
560 Ga0105243_10010769
561 Ga0105243_12760752
562 Ga0105241_11144690
563 Ga0105242_10003052
564 Ga0105242_10005206
565 Ga0105242_10786503
566 Ga0105248_10062023
567 Ga0105249_10273028
568 Ga0157378_10525153
569 Ga0157378_10789919
570 Ga0163162_10939074
571 Ga0157380_10014145
572 Ga0157380_10064217
573 Ga0157377_10238932
574 Ga0157379_11039943
575 Ga0157376_10035846
576 Ga0157376_10123057
577 Ga0163161_10206966
578 Ga0213876_10330624
579 Ga0207697_10437734
580 Ga0207642_10008018
581 Ga0207642_10218918
582 Ga0207688_10059134
583 Ga0207680_10091688
584 Ga0207680_10095808
585 Ga0207647_10310665
586 Ga0207645_10001856
587 Ga0207645_10003917
588 Ga0207645_10237384
589 Ga0207645_10832231
590 Ga0207684_10153295
591 Ga0207684_11263759
592 Ga0207695_10680576
593 Ga0207660_10876582
594 Ga0207662_10000887
595 Ga0207646_10147895
596 Ga0207681_10199758
597 Ga0207650_10044558
598 Ga0207659_10004182
599 Ga0207659_10245311
600 Ga0207659_10593367
601 Ga0207644_10129753
602 Ga0207706_10035707
603 Ga0207706_10167659
604 Ga0207686_10008706
605 Ga0207686_10038263
606 Ga0207709_10006295
607 Ga0207670_10143390
608 Ga0207670_10762716
609 Ga0207669_10523596
610 Ga0207669_10807300
611 Ga0207704_10006305
612 Ga0207691_10055971
613 Ga0207691_10070328
614 Ga0207711_10008552
615 Ga0207711_10017882
616 Ga0207711_10144205
617 Ga0207689_10000699
618 Ga0207689_10043375
619 Ga0207689_10057097
620 Ga0207689_10269436
621 Ga0207689_10316342
622 Ga0207689_10821629
623 Ga0207679_10865831
624 Ga0207679_11008337
625 Ga0207651_10004694
626 Ga0207651_10008171
627 Ga0207651_10011076
628 Ga0207651_11494991
629 Ga0207712_10701952
630 Ga0207668_10415436
631 Ga0207640_10012529
632 Ga0207640_10292253
633 Ga0207640_10387677
634 Ga0207703_10041459
635 Ga0207703_10057414
636 Ga0207678_10508605
637 Ga0207708_10000952
638 Ga0207708_10007509
639 Ga0207708_10119050
640 Ga0207641_10244103
641 Ga0207648_10000406
642 Ga0207648_10001926
643 Ga0207675_100025025
644 Ga0207675_100577089
645 Ga0207675_101450236
646 Ga0207683_10043360
647 Ga0207683_10098478
648 Ga0207698_12475950
649 Ga0209813_10083593
650 Ga0209813_10256347
651 Ga0207428_10328028
652 Ga0207428_10460487
653 Ga0207428_11185727
654 Ga0268266_10460785
655 Ga0268265_11087393
656 Ga0268265_11097088
657 Ga0268264_10057407
658 Ga0268264_10373506
659 Ga0268264_10702801
660 Ga0307408_100072136
661 Ga0307408_100213384
662 Ga0307408_100475155
663 Ga0307408_101371714
664 Ga0307405_10024575
665 Ga0307410_10055999
666 Ga0307410_11779412
667 Ga0307406_11274914
668 Ga0307407_10108759
669 Ga0307412_10025176
670 Ga0307409_100074206
671 Ga0307409_100666855
672 Ga0307409_102300154
673 Ga0307416_100128438
674 Ga0307416_100229975
675 Ga0307416_100347087
676 Ga0307416_100749143
677 Ga0307411_10051468
678 Ga0307415_100011262
679 Ga0307415_100189661
680 Ga0307415_101436844
681 Ga0307415_101476295
682 Ga0373932_0386506
683 Ga0373954_0337833
684 Ga0373956_0379935
685 Ga0373943_0328814
686 Ga0373924_0323045
687 Ga0373947_0092108
688 Ga0373937_0187320
689 Ga0373925_1015689
690 Ga0436365_0300220
691 Ga0439431_0006669
692 Ga0439433_0035136
693 Ga0439462_0087742
694 Ga0439446_0070127
695 Ga0439434_0007922
696 Ga0439434_0168013
697 Ga0439435_0204121
698 Ga0451576_1207785
699 Ga0495603_0200869
700 Ga0495658_0053891
701 Ga0495600_0343364
702 Ga0496102_0092221
703 Ga0496103_0801143
704 Ga0496104_1375017
705 Ga0496109_0214336
706 Ga0496112_0338690
707 Ga0496114_0720488
708 Ga0501290_038696
709 Ga0501031_0360097
710 Ga0501032_0264873
711 Ga0501033_0563005
712 Ga0501036_0114436
713 Ga0501036_0251734
714 Ga0501036_0434745
715 Ga0501037_0643816
716 Ga0501038_0196935
717 Ga0501039_0113002
718 Ga0501039_0137301
719 Ga0501039_1538640
720 Ga0501040_0218653
721 Ga0501041_0053117
722 Ga0501041_0098202
723 Ga0501041_0148626
724 Ga0501042_0069592
725 Ga0501042_0270398
726 Ga0501042_0612289
727 Ga0501046_0051808
728 Ga0501046_0086908
729 Ga0501048_0060946
730 Ga0501048_0138589
731 Ga0501067_0007508
732 Ga0501068_0442778
733 Ga0501071_0048473
734 Ga0501071_0590169
735 Ga0501071_0713799
736 Ga0501071_0738137
737 Ga0501071_1277291
738 Ga0501072_0041836
739 Ga0501072_0279676
740 Ga0501072_0308689
741 Ga0501072_0312817
742 Ga0501072_0851114
743 Ga0501073_0213342
744 Ga0501074_0635854
745 Ga0501075_0046937
746 Ga0501075_0278302
747 Ga0501075_0345696
748 Ga0501075_0361010
749 Ga0501075_0597101
750 Ga0501076_0095811
751 Ga0501076_0278522
752 Ga0501076_0544620
753 Ga0501077_0588062
754 Ga0501079_0322709
755 Ga0501080_1117061
756 Ga0501081_0021665
757 Ga0501081_0147090
758 Ga0501081_0243361
759 Ga0501035_0240820
760 Ga0501035_0297367
761 Ga0501044_1183750
762 Ga0501045_0039011
763 Ga0501045_0122239
764 Ga0501045_0290950
765 nmdc:mga00v17_118135_c1
766 nmdc:mga00v17_7769_c1
767 nmdc:mga0yw44_22502_c1
768 nmdc:mga0yw44_356129_c1
769 nmdc:mga06z11_45849_c1
770 nmdc:mga06z11_536075_c1
771 nmdc:mga06z11_966297_c1
772 nmdc:mga04h51_135894_c1
773 nmdc:mga07m45_272658_c1
774 nmdc:mga05p37_159337_c1
775 nmdc:mga05p37_67028_c1
776 nmdc:mga05p37_773442_c1
777 nmdc:mga09592_230507_c1
778 nmdc:mga0qj67_19626_c1
779 nmdc:mga0qj67_384713_c1
780 nmdc:mga06r32_1501948_c1
781 nmdc:mga06r32_1610082_c1
782 nmdc:mga06r32_176633_c1
783 nmdc:mga06r32_294082_c1
784 nmdc:mga06r32_406181_c1
785 nmdc:mga08y16_135132_c1
786 nmdc:mga08y16_331178_c1
787 nmdc:mga08y16_89174_c1
788 nmdc:mga0rr50_842494_c1
789 nmdc:mga08x19_160098_c1
790 nmdc:mga0a205_474349_c1
791 Ga0495619_0750126
792 Ga0501084_0212366
793 Ga0501084_0256847
794 Ga0501084_0740707
795 Ga0501084_0914187
796 Ga0590071_000238
797 Ga0590074_007445
798 Ga0590075_001697
799 Ga0590077_000780
800 Ga0587079_159456
801 Ga0501082_0400160
802 Ga0501082_0433721
803 Ga0530510_0341009
804 Ga0530510_0650600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04773

FecR

FecR protein

86

176

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ix9-assembly1.cif.gz_A cell surface anchoring domain 0.9215 27 89
6ovm-assembly1.cif.gz_R crystal structure of the pseudomonas capeferrum anti-sigma regulator pupr c-terminal cell-surface signaling domain in complex with the outer membrane transporter pupb n-terminal signaling domain (semet) 0.8576 61 149
4m0h-assembly2.cif.gz_B crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution 0.8015 61 148
5ix9-assembly1.cif.gz_A cell surface anchoring domain 0.7654 27 89
5k36-assembly1.cif.gz_E structure of an eleven component nuclear rna exosome complex bound to rna 0.6333 66 88
ID Description Score Start End Superfamily
af_P23485_97_238_2.60.120.1440 Mainly Beta;Sandwich;Jelly Rolls; 0.898 63 149 2.60.120.1440
5f29A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.7859 37 62 3.30.70.1450
4m0hB01 Mainly Beta;Sandwich;Jelly Rolls; 0.7228 61 148 2.60.120.1440
5okzi00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.6454 66 88 3.30.230.70
af_Q4DEB8_265_347_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5578 58 147 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V8FQ87-F1-model_v4 FecR protein domain-containing protein 0.9821 23 150
AF-A0A7Y3AH10-F1-model_v4 FecR domain-containing protein 0.9777 27 147
AF-A0A1E7HYZ9-F1-model_v4 FecR protein domain-containing protein 0.9692 30 149
AF-A0A2N9M0Y2-F1-model_v4 FecR protein domain-containing protein 0.9682 54 150
AF-A0A2V8FQ87-F1-model_v4 FecR protein domain-containing protein 0.9672 23 150

Map