F435198

General Info

Members Datasets Scaffolds Average Seq Length
402 227 804 136

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0547477|Ga0496102_0547477_551_1054
Length 167
Sequence MAARTKARKRALDVLYAAEMRGQDPLAELEAAIAAGEGPTNPYTTTLVRGVVDHQPRIDEVLTSYSERWTLDRMPAVDRSALRIGAFELLYSTEVPHAVAVTEAVALVRNLSTDDSPAFVNGVLGSMMRDRDDLVADGGTAAAAAKGATDGVVAEPAEPVEEPHPEV

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2643221641 Nocardioides sp. Root122 Isolate Unclassified
223 2739367898 Nocardioides sp. CF479 Isolate Unclassified
224 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
225 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
226 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
227 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 2.99
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 6.97
Nodule 0.25
Rhizoplane 13.18
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0547477 3300048905 Bacteria 1080
2 JGI24737J22298_10021760 3300001990 Bacteria 2041
3 JGI24737J22298_10216713 3300001990 Bacteria 565
4 JGI24735J21928_10024694 3300002067 Bacteria 1817
5 rootL2_10218065 3300003322 Bacteria 1585
6 rootH1_10013615 3300003323 Bacteria 1521
7 Ga0070658_10084989 3300005327 Bacteria 2602
8 Ga0070658_10197211 3300005327 Bacteria 1698
9 Ga0070683_100004469 3300005329 Bacteria 11540
10 Ga0070683_100094714 3300005329 Bacteria 2807
11 Ga0070683_100662054 3300005329 Bacteria 1000
12 Ga0070690_100350121 3300005330 Bacteria 1072
13 Ga0070680_100032241 3300005336 Bacteria 4217
14 Ga0070682_100001718 3300005337 Bacteria 12174
15 Ga0070682_100367958 3300005337 Bacteria 1077
16 Ga0070682_101328772 3300005337 Bacteria 612
17 Ga0070682_101696685 3300005337 Bacteria 549
18 Ga0068868_101439110 3300005338 Bacteria 644
19 Ga0070689_101107182 3300005340 Bacteria 708
20 Ga0070691_10595085 3300005341 Bacteria 652
21 Ga0070687_100018075 3300005343 Bacteria 3253
22 Ga0070687_101398531 3300005343 Bacteria 523
23 Ga0070675_100127443 3300005354 Bacteria 2167
24 Ga0070674_100406927 3300005356 Bacteria 1113
25 Ga0070674_101041275 3300005356 Bacteria 720
26 Ga0070688_101128201 3300005365 Bacteria 628
27 Ga0070659_100018965 3300005366 Bacteria 5200
28 Ga0070667_100091930 3300005367 Bacteria 2610
29 Ga0070667_101516373 3300005367 Bacteria 630
30 Ga0070701_10149997 3300005438 Bacteria 1341
31 Ga0070701_10214483 3300005438 Bacteria 1145
32 Ga0070705_100090145 3300005440 Bacteria 1908
33 Ga0070700_100123444 3300005441 Bacteria 1738
34 Ga0070678_101224665 3300005456 Bacteria 697
35 Ga0070681_10022291 3300005458 Bacteria 6359
36 Ga0070707_100253117 3300005468 Bacteria 1714
37 Ga0070698_100008270 3300005471 Bacteria 11250
38 Ga0070699_100569206 3300005518 Bacteria 1032
39 Ga0070679_100076506 3300005530 Bacteria 3336
40 Ga0070679_100602515 3300005530 Bacteria 1042
41 Ga0070679_100658435 3300005530 Bacteria 990
42 Ga0070684_100000440 3300005535 Bacteria 28504
43 Ga0070684_100040852 3300005535 Bacteria 3996
44 Ga0070684_102050349 3300005535 Bacteria 540
45 Ga0068853_100700940 3300005539 Bacteria 966
46 Ga0070672_100434398 3300005543 Bacteria 1129
47 Ga0070693_100243136 3300005547 Bacteria 1190
48 Ga0070665_100015009 3300005548 Bacteria 7774
49 Ga0070665_100539264 3300005548 Bacteria 1179
50 Ga0068855_100102296 3300005563 Bacteria 3298
51 Ga0068857_100001660 3300005577 Bacteria 17856
52 Ga0068856_100269994 3300005614 Bacteria 1717
53 Ga0068856_101133828 3300005614 Bacteria 799
54 Ga0068852_100635510 3300005616 Bacteria 1074
55 Ga0068859_100487974 3300005617 Bacteria 1327
56 Ga0068864_100120174 3300005618 Bacteria 2349
57 Ga0068866_10580477 3300005718 Bacteria 754
58 Ga0068861_100226740 3300005719 Bacteria 1582
59 Ga0068861_100840922 3300005719 Bacteria 864
60 Ga0068858_100572746 3300005842 Bacteria 1094
61 Ga0068860_100054893 3300005843 Bacteria 3787
62 Ga0081455_10281729 3300005937 Bacteria 1201
63 Ga0075365_10040278 3300006038 Bacteria 3047
64 Ga0075365_10206222 3300006038 Bacteria 1378
65 Ga0075365_10208336 3300006038 Bacteria 1370
66 Ga0075365_10302709 3300006038 Bacteria 1125
67 Ga0075365_10336881 3300006038 Bacteria 1063
68 Ga0075365_10556835 3300006038 Bacteria 811
69 Ga0075368_10000275 3300006042 Bacteria 14747
70 Ga0075363_100172187 3300006048 Bacteria 1229
71 Ga0075364_10107868 3300006051 Bacteria 1857
72 Ga0075364_10173745 3300006051 Bacteria 1457
73 Ga0075364_10363057 3300006051 Bacteria 987
74 Ga0070716_101762452 3300006173 Bacteria 512
75 Ga0075367_10008879 3300006178 Bacteria 5229
76 Ga0075367_10314965 3300006178 Bacteria 986
77 Ga0075367_10339531 3300006178 Bacteria 947
78 Ga0097621_100109398 3300006237 Bacteria 2334
79 Ga0068865_100048997 3300006881 Bacteria 2910
80 Ga0068865_100119247 3300006881 Bacteria 1959
81 Ga0075436_101488152 3300006914 Bacteria 514
82 Ga0097620_100488017 3300006931 Bacteria 1327
83 Ga0111539_11737040 3300009094 Bacteria 724
84 Ga0105245_10008886 3300009098 Bacteria 8768
85 Ga0105245_11591701 3300009098 Bacteria 705
86 Ga0105247_10157037 3300009101 Bacteria 1503
87 Ga0105247_10718797 3300009101 Bacteria 754
88 Ga0105243_10282996 3300009148 Bacteria 1495
89 Ga0105243_11975671 3300009148 Bacteria 617
90 Ga0105241_10077236 3300009174 Bacteria 2599
91 Ga0105242_10426746 3300009176 Bacteria 1244
92 Ga0105248_10393378 3300009177 Bacteria 1561
93 Ga0105237_10445125 3300009545 Bacteria 1301
94 Ga0105239_10043444 3300010375 Bacteria 4926
95 Ga0105246_10008631 3300011119 Bacteria 6268
96 Ga0105246_10646593 3300011119 Bacteria 920
97 Ga0157371_10131594 3300013102 Bacteria 1780
98 Ga0157371_10960627 3300013102 Bacteria 650
99 Ga0157369_10221186 3300013105 Bacteria 1982
100 Ga0157369_11989087 3300013105 Bacteria 590
101 Ga0157374_11628591 3300013296 Bacteria 670
102 Ga0163162_10041882 3300013306 Bacteria 4582
103 Ga0163162_11825192 3300013306 Bacteria 695
104 Ga0157372_10050435 3300013307 Bacteria 4629
105 Ga0157372_10738473 3300013307 Bacteria 1145
106 Ga0157372_10952529 3300013307 Bacteria 995
107 Ga0157372_12723993 3300013307 Bacteria 567
108 Ga0157375_10050382 3300013308 Bacteria 4085
109 Ga0157375_10234502 3300013308 Bacteria 1994
110 Ga0157375_10502765 3300013308 Bacteria 1376
111 Ga0157375_10850476 3300013308 Bacteria 1059
112 Ga0157375_11376953 3300013308 Bacteria 831
113 Ga0157375_11960488 3300013308 Bacteria 696
114 Ga0163163_10106756 3300014325 Bacteria 2826
115 Ga0163163_10809277 3300014325 Bacteria 1000
116 Ga0163163_12103919 3300014325 Bacteria 624
117 Ga0157380_10148529 3300014326 Bacteria 2023
118 Ga0157380_10425976 3300014326 Bacteria 1267
119 Ga0157380_11942120 3300014326 Bacteria 650
120 Ga0157377_10199016 3300014745 Bacteria 1271
121 Ga0157379_11006121 3300014968 Bacteria 795
122 Ga0157376_11616686 3300014969 Bacteria 682
123 Ga0206356_11327010 3300020070 Bacteria 945
124 Ga0206353_10603109 3300020082 Bacteria 2102
125 Ga0206353_10628400 3300020082 Bacteria 1432
126 Ga0206353_11953191 3300020082 Bacteria 1520
127 Ga0207642_10675582 3300025899 Bacteria 649
128 Ga0207688_10533580 3300025901 Bacteria 737
129 Ga0207647_10164852 3300025904 Bacteria 1292
130 Ga0207647_10279169 3300025904 Bacteria 954
131 Ga0207705_10073954 3300025909 Bacteria 2473
132 Ga0207705_10096223 3300025909 Bacteria 2173
133 Ga0207654_10094447 3300025911 Bacteria 1830
134 Ga0207671_10244412 3300025914 Bacteria 1410
135 Ga0207660_10019578 3300025917 Bacteria 4526
136 Ga0207660_10182200 3300025917 Bacteria 1632
137 Ga0207662_10016873 3300025918 Bacteria 4126
138 Ga0207662_10654953 3300025918 Bacteria 734
139 Ga0207657_10131001 3300025919 Bacteria 2055
140 Ga0207649_11087591 3300025920 Bacteria 631
141 Ga0207652_10058298 3300025921 Bacteria 3327
142 Ga0207652_10093442 3300025921 Bacteria 2647
143 Ga0207646_10830400 3300025922 Bacteria 822
144 Ga0207687_10041302 3300025927 Bacteria 3166
145 Ga0207690_10326451 3300025932 Bacteria 1207
146 Ga0207706_11288853 3300025933 Bacteria 604
147 Ga0207686_10577686 3300025934 Bacteria 882
148 Ga0207709_10313370 3300025935 Bacteria 1171
149 Ga0207709_10500724 3300025935 Bacteria 948
150 Ga0207669_11449500 3300025937 Bacteria 585
151 Ga0207704_10497807 3300025938 Bacteria 982
152 Ga0207711_10144866 3300025941 Bacteria 2140
153 Ga0207661_10048902 3300025944 Bacteria 3363
154 Ga0207661_10068120 3300025944 Bacteria 2897
155 Ga0207679_11142826 3300025945 Bacteria 715
156 Ga0207667_10123116 3300025949 Bacteria 2672
157 Ga0207640_11887194 3300025981 Bacteria 541
158 Ga0207658_10208479 3300025986 Bacteria 1636
159 Ga0207677_11295451 3300026023 Bacteria 669
160 Ga0207677_11524958 3300026023 Bacteria 618
161 Ga0207703_10175519 3300026035 Bacteria 1888
162 Ga0207639_10238600 3300026041 Bacteria 1579
163 Ga0207639_11337587 3300026041 Bacteria 672
164 Ga0207702_10239998 3300026078 Bacteria 1697
165 Ga0207641_10356752 3300026088 Bacteria 1395
166 Ga0207676_10331085 3300026095 Bacteria 1401
167 Ga0207674_10007318 3300026116 Bacteria 12859
168 Ga0207674_10905731 3300026116 Bacteria 850
169 Ga0207675_100245848 3300026118 Bacteria 1730
170 Ga0207683_10320410 3300026121 Bacteria 1420
171 Ga0207683_10723632 3300026121 Bacteria 923
172 Ga0207683_10767846 3300026121 Bacteria 894
173 Ga0207683_11426330 3300026121 Bacteria 640
174 Ga0207698_10210839 3300026142 Bacteria 1748
175 Ga0209813_10001318 3300027866 Bacteria 5554
176 Ga0268266_10004826 3300028379 Bacteria 12801
177 Ga0268266_10666984 3300028379 Bacteria 1001
178 Ga0268264_10770393 3300028381 Bacteria 960
179 Ga0316183_1005226 3300030742 Bacteria 697
180 Ga0316182_1329595 3300030745 Bacteria 730
181 Ga0307410_10673772 3300031852 Bacteria 869
182 Ga0307407_10208288 3300031903 Bacteria 1315
183 Ga0307407_10367749 3300031903 Bacteria 1023
184 Ga0307409_100215169 3300031995 Bacteria 1730
185 Ga0307416_100437472 3300032002 Bacteria 1357
186 Ga0307416_102063481 3300032002 Bacteria 672
187 Ga0307416_103628451 3300032002 Bacteria 517
188 Ga0307414_11771943 3300032004 Bacteria 576
189 Ga0307411_10445009 3300032005 Bacteria 1082
190 Ga0307411_10968888 3300032005 Bacteria 760
191 Ga0439465_0038589 3300041413 Bacteria 1539
192 Ga0451791_0148708 3300041451 Bacteria 1218
193 Ga0451791_1701293 3300041451 Bacteria 531
194 Ga0451797_1180106 3300041453 Bacteria 684
195 Ga0451800_0179445 3300041459 Bacteria 930
196 Ga0451806_338466 3300041462 Bacteria 502
197 Ga0451804_0722187 3300041463 Bacteria 546
198 Ga0451804_0898106 3300041463 Bacteria 680
199 Ga0451835_0907654 3300041492 Bacteria 668
200 Ga0451835_0979967 3300041492 Bacteria 753
201 Ga0451837_0390383 3300041494 Bacteria 870
202 Ga0451837_0680710 3300041494 Bacteria 958
203 Ga0451849_0780370 3300041505 Bacteria 643
204 Ga0451843_0258885 3300041509 Bacteria 811
205 Ga0451843_0954926 3300041509 Bacteria 630
206 Ga0451843_1646176 3300041509 Bacteria 698
207 Ga0451853_1616566 3300041512 Bacteria 612
208 Ga0451853_3267367 3300041512 Bacteria 517
209 Ga0439442_017236 3300042002 Bacteria 1491
210 Ga0439459_0240169 3300042438 Bacteria 508
211 Ga0466972_0258989 3300044658 Bacteria 813
212 Ga0466961_0134812 3300044693 Bacteria 1547
213 Ga0466963_0019825 3300044694 Bacteria 4223
214 Ga0466963_0075789 3300044694 Bacteria 2271
215 Ga0466964_0063538 3300044706 Bacteria 1542
216 Ga0466964_0498757 3300044706 Bacteria 653
217 Ga0466971_0132889 3300044719 Bacteria 1156
218 Ga0466968_0033075 3300044735 Bacteria 2154
219 Ga0466970_0079537 3300044765 Bacteria 1770
220 Ga0466970_0691942 3300044765 Bacteria 594
221 Ga0466957_0009450 3300044842 Bacteria 5566
222 Ga0466960_0000241 3300044901 Bacteria 18889
223 Ga0466960_0114942 3300044901 Bacteria 1403
224 Ga0466960_0839221 3300044901 Bacteria 558
225 Ga0466959_0714578 3300045049 Bacteria 671
226 Ga0451576_0419807 3300045051 Bacteria 1403
227 Ga0466967_0083084 3300045976 Bacteria 2895
228 Ga0466967_0083209 3300045976 Bacteria 2893
229 Ga0466967_0093322 3300045976 Bacteria 2738
230 Ga0466967_0119848 3300045976 Bacteria 2429
231 Ga0466967_0168808 3300045976 Bacteria 2057
232 Ga0466967_0339499 3300045976 Bacteria 1452
233 Ga0466967_0352585 3300045976 Bacteria 1424
234 Ga0466967_0830140 3300045976 Bacteria 918
235 Ga0495603_0303373 3300046455 Bacteria 917
236 Ga0495653_0566805 3300046463 Bacteria 701
237 Ga0495608_0149539 3300046511 Bacteria 1489
238 Ga0495620_0037783 3300046515 Bacteria 2148
239 Ga0495630_0455257 3300046517 Bacteria 981
240 Ga0495667_0340602 3300046559 Bacteria 948
241 Ga0495634_0246986 3300046642 Bacteria 1093
242 Ga0495635_0673019 3300046663 Bacteria 672
243 Ga0495613_0343358 3300046689 Bacteria 1027
244 Ga0495624_0845018 3300046690 Bacteria 540
245 Ga0495674_0676071 3300047319 Bacteria 812
246 Ga0495680_0475850 3300047322 Bacteria 851
247 Ga0496100_0147389 3300048903 Bacteria 1675
248 Ga0496100_1498404 3300048903 Bacteria 533
249 Ga0496101_0179620 3300048904 Bacteria 1629
250 Ga0496101_0247509 3300048904 Bacteria 1388
251 Ga0496101_0452455 3300048904 Bacteria 1013
252 Ga0496102_0148233 3300048905 Bacteria 2203
253 Ga0496102_0239655 3300048905 Bacteria 1710
254 Ga0496102_0480820 3300048905 Bacteria 1163
255 Ga0496103_0084085 3300048906 Bacteria 2004
256 Ga0496103_0116198 3300048906 Bacteria 1702
257 Ga0496103_0346563 3300048906 Bacteria 955
258 Ga0496103_0440530 3300048906 Bacteria 836
259 Ga0496104_1082166 3300048907 Bacteria 705
260 Ga0496105_0001223 3300048908 Bacteria 17907
261 Ga0496105_0757454 3300048908 Bacteria 741
262 Ga0496107_0146040 3300048910 Bacteria 1749
263 Ga0496107_0359999 3300048910 Bacteria 1082
264 Ga0496107_1251177 3300048910 Bacteria 532
265 Ga0496108_0021344 3300048911 Bacteria 5322
266 Ga0496108_0027253 3300048911 Bacteria 4716
267 Ga0496108_0049385 3300048911 Bacteria 3519
268 Ga0496108_0199366 3300048911 Bacteria 1737
269 Ga0496108_0251276 3300048911 Bacteria 1538
270 Ga0496109_0017988 3300048912 Bacteria 6205
271 Ga0496109_0030734 3300048912 Bacteria 4814
272 Ga0496109_0040098 3300048912 Bacteria 4241
273 Ga0496109_0702276 3300048912 Bacteria 949
274 Ga0496110_0083471 3300048913 Bacteria 2850
275 Ga0496110_0917174 3300048913 Bacteria 782
276 Ga0496111_0043129 3300048914 Bacteria 3241
277 Ga0496111_0375025 3300048914 Bacteria 1052
278 Ga0496112_0991144 3300048915 Bacteria 760
279 Ga0496112_1765896 3300048915 Bacteria 531
280 Ga0496113_0236944 3300048916 Bacteria 1456
281 Ga0496113_0294407 3300048916 Bacteria 1299
282 Ga0496113_0320182 3300048916 Bacteria 1243
283 Ga0496114_0042993 3300048917 Bacteria 3746
284 Ga0496114_0058140 3300048917 Bacteria 3228
285 Ga0496114_0256281 3300048917 Bacteria 1540
286 Ga0496114_0421739 3300048917 Bacteria 1182
287 Ga0496114_0536505 3300048917 Bacteria 1034
288 Ga0496114_0827065 3300048917 Bacteria 805
289 Ga0496114_0966660 3300048917 Bacteria 734
290 Ga0496115_0008274 3300048918 Bacteria 7689
291 Ga0496115_0083601 3300048918 Bacteria 2602
292 Ga0501306_011421 3300049127 Bacteria 1132
293 Ga0501305_074390 3300049161 Bacteria 602
294 Ga0501307_028770 3300049162 Bacteria 761
295 Ga0501311_042009 3300049527 Bacteria 696
296 Ga0501317_038164 3300049533 Bacteria 724
297 Ga0501317_045719 3300049533 Bacteria 682
298 Ga0501031_0005204 3300049568 Bacteria 8478
299 Ga0501031_0014748 3300049568 Bacteria 5080
300 Ga0501032_0015752 3300049569 Bacteria 5331
301 Ga0501032_0159578 3300049569 Bacteria 1481
302 Ga0501033_0219621 3300049570 Bacteria 1353
303 Ga0501034_0903586 3300049571 Bacteria 771
304 Ga0501036_0021757 3300049572 Bacteria 5391
305 Ga0501036_0038100 3300049572 Bacteria 4068
306 Ga0501036_0198466 3300049572 Bacteria 1688
307 Ga0501036_0609783 3300049572 Bacteria 905
308 Ga0501037_0095218 3300049573 Bacteria 2152
309 Ga0501038_0063062 3300049574 Bacteria 3165
310 Ga0501038_0424744 3300049574 Bacteria 1025
311 Ga0501038_0447183 3300049574 Bacteria 994
312 Ga0501039_0093526 3300049575 Bacteria 2343
313 Ga0501039_0098802 3300049575 Bacteria 2277
314 Ga0501040_0204275 3300049576 Bacteria 1403
315 Ga0501040_0409654 3300049576 Bacteria 974
316 Ga0501041_0016939 3300049577 Bacteria 4335
317 Ga0501041_0265355 3300049577 Bacteria 1080
318 Ga0501042_0008725 3300049578 Bacteria 6723
319 Ga0501042_0197949 3300049578 Bacteria 1449
320 Ga0501043_0229773 3300049579 Bacteria 1433
321 Ga0501048_0154346 3300049582 Bacteria 1624
322 Ga0501048_0209230 3300049582 Bacteria 1383
323 Ga0501067_0000434 3300049583 Bacteria 22861
324 Ga0501067_0019587 3300049583 Bacteria 3747
325 Ga0501067_0173247 3300049583 Bacteria 1202
326 Ga0501067_0292540 3300049583 Bacteria 907
327 Ga0501068_0004332 3300049584 Bacteria 7715
328 Ga0501068_0165557 3300049584 Bacteria 1394
329 Ga0501069_0026853 3300049585 Bacteria 3154
330 Ga0501069_0037624 3300049585 Bacteria 2670
331 Ga0501069_0120199 3300049585 Bacteria 1500
332 Ga0501069_0282108 3300049585 Bacteria 972
333 Ga0501069_0337173 3300049585 Bacteria 887
334 Ga0501070_0004706 3300049586 Bacteria 11694
335 Ga0501070_0062892 3300049586 Bacteria 3075
336 Ga0501070_0205212 3300049586 Bacteria 1618
337 Ga0501071_0001534 3300049587 Bacteria 13476
338 Ga0501071_0004791 3300049587 Bacteria 8616
339 Ga0501071_0064833 3300049587 Bacteria 2651
340 Ga0501071_0575133 3300049587 Bacteria 866
341 Ga0501071_1489559 3300049587 Bacteria 522
342 Ga0501072_0000849 3300049588 Bacteria 22417
343 Ga0501072_0010594 3300049588 Bacteria 7022
344 Ga0501072_0492385 3300049588 Bacteria 970
345 Ga0501072_0732525 3300049588 Bacteria 776
346 Ga0501073_0004915 3300049589 Bacteria 10032
347 Ga0501074_0000659 3300049590 Bacteria 21547
348 Ga0501074_0021752 3300049590 Bacteria 4657
349 Ga0501075_0146280 3300049591 Bacteria 1801
350 Ga0501075_0219497 3300049591 Bacteria 1450
351 Ga0501075_1005692 3300049591 Bacteria 634
352 Ga0501075_1544911 3300049591 Bacteria 502
353 Ga0501076_0032477 3300049592 Bacteria 4074
354 Ga0501076_0221765 3300049592 Bacteria 1545
355 Ga0501076_0840822 3300049592 Bacteria 757
356 Ga0501077_0055494 3300049593 Bacteria 2515
357 Ga0501077_0188806 3300049593 Bacteria 1309
358 Ga0501077_0259254 3300049593 Bacteria 1106
359 Ga0501208_062947 3300049655 Bacteria 731
360 Ga0501079_0153727 3300049741 Bacteria 1793
361 Ga0501079_0279767 3300049741 Bacteria 1305
362 Ga0501080_0004024 3300049742 Bacteria 13020
363 Ga0501080_0111243 3300049742 Bacteria 2539
364 Ga0501080_0132026 3300049742 Bacteria 2312
365 Ga0501081_0101090 3300049743 Bacteria 2038
366 Ga0501035_0148160 3300049822 Bacteria 2038
367 Ga0501035_1022531 3300049822 Bacteria 649
368 Ga0501044_1546668 3300049823 Bacteria 528
369 Ga0501045_0017393 3300049824 Bacteria 5104
370 Ga0501045_0047717 3300049824 Bacteria 3121
371 Ga0501045_0141029 3300049824 Bacteria 1792
372 nmdc:mga03n38_126782_c1 3300050490 Bacteria 1261
373 nmdc:mga03n38_152988_c1 3300050490 Bacteria 1162
374 nmdc:mga00v17_191179_c1 3300050491 Bacteria 1322
375 nmdc:mga00v17_371449_c1 3300050491 Bacteria 930
376 nmdc:mga00v17_59443_c1 3300050491 Bacteria 2345
377 nmdc:mga0yw44_13716_c1 3300050492 Bacteria 4277
378 nmdc:mga0yw44_235222_c1 3300050492 Bacteria 1217
379 nmdc:mga0yw44_340348_c1 3300050492 Bacteria 1009
380 nmdc:mga0yw44_535298_c1 3300050492 Bacteria 795
381 nmdc:mga0yw44_55557_c1 3300050492 Bacteria 2409
382 nmdc:mga0yw44_76986_c1 3300050492 Bacteria 2083
383 nmdc:mga0yw44_880541_c1 3300050492 Bacteria 607
384 nmdc:mga04h51_11098_c1 3300050495 Bacteria 2492
385 Ga0495655_0039926 3300053083 Bacteria 1192
386 Ga0495619_0311025 3300053085 Bacteria 1091
387 Ga0501084_0025645 3300054114 Bacteria 4916
388 Ga0501084_0032836 3300054114 Bacteria 4343
389 Ga0501084_0565310 3300054114 Bacteria 961
390 Ga0501084_1385187 3300054114 Bacteria 589
391 Ga0587098_042109 3300059604 Bacteria 668
392 Ga0587119_031418 3300059658 Bacteria 728
393 Ga0501082_0123980 3300060353 Bacteria 2240
394 Ga0530510_0190988 3300061734 Bacteria 1520
395 Ga0530510_0600786 3300061734 Bacteria 837
396 Ga0530510_1313233 3300061734 Bacteria 555
397 2644229325 2643221641 Bacteria 4490190
398 2740169476 2739367898 Bacteria 4367674
399 2857484642 2857481737 Bacteria 4761446
400 2984579950 2984576629 Bacteria 4248407
401 2990260371 2990256926 Bacteria 4252839
402 8054612853 8054609563 Bacteria 5170090
403 Ga0496102_0547477
404 JGI24737J22298_10021760
405 JGI24737J22298_10216713
406 JGI24735J21928_10024694
407 rootL2_10218065
408 rootH1_10013615
409 Ga0070658_10084989
410 Ga0070658_10197211
411 Ga0070683_100004469
412 Ga0070683_100094714
413 Ga0070683_100662054
414 Ga0070690_100350121
415 Ga0070680_100032241
416 Ga0070682_100001718
417 Ga0070682_100367958
418 Ga0070682_101328772
419 Ga0070682_101696685
420 Ga0068868_101439110
421 Ga0070689_101107182
422 Ga0070691_10595085
423 Ga0070687_100018075
424 Ga0070687_101398531
425 Ga0070675_100127443
426 Ga0070674_100406927
427 Ga0070674_101041275
428 Ga0070688_101128201
429 Ga0070659_100018965
430 Ga0070667_100091930
431 Ga0070667_101516373
432 Ga0070701_10149997
433 Ga0070701_10214483
434 Ga0070705_100090145
435 Ga0070700_100123444
436 Ga0070678_101224665
437 Ga0070681_10022291
438 Ga0070707_100253117
439 Ga0070698_100008270
440 Ga0070699_100569206
441 Ga0070679_100076506
442 Ga0070679_100602515
443 Ga0070679_100658435
444 Ga0070684_100000440
445 Ga0070684_100040852
446 Ga0070684_102050349
447 Ga0068853_100700940
448 Ga0070672_100434398
449 Ga0070693_100243136
450 Ga0070665_100015009
451 Ga0070665_100539264
452 Ga0068855_100102296
453 Ga0068857_100001660
454 Ga0068856_100269994
455 Ga0068856_101133828
456 Ga0068852_100635510
457 Ga0068859_100487974
458 Ga0068864_100120174
459 Ga0068866_10580477
460 Ga0068861_100226740
461 Ga0068861_100840922
462 Ga0068858_100572746
463 Ga0068860_100054893
464 Ga0081455_10281729
465 Ga0075365_10040278
466 Ga0075365_10206222
467 Ga0075365_10208336
468 Ga0075365_10302709
469 Ga0075365_10336881
470 Ga0075365_10556835
471 Ga0075368_10000275
472 Ga0075363_100172187
473 Ga0075364_10107868
474 Ga0075364_10173745
475 Ga0075364_10363057
476 Ga0070716_101762452
477 Ga0075367_10008879
478 Ga0075367_10314965
479 Ga0075367_10339531
480 Ga0097621_100109398
481 Ga0068865_100048997
482 Ga0068865_100119247
483 Ga0075436_101488152
484 Ga0097620_100488017
485 Ga0111539_11737040
486 Ga0105245_10008886
487 Ga0105245_11591701
488 Ga0105247_10157037
489 Ga0105247_10718797
490 Ga0105243_10282996
491 Ga0105243_11975671
492 Ga0105241_10077236
493 Ga0105242_10426746
494 Ga0105248_10393378
495 Ga0105237_10445125
496 Ga0105239_10043444
497 Ga0105246_10008631
498 Ga0105246_10646593
499 Ga0157371_10131594
500 Ga0157371_10960627
501 Ga0157369_10221186
502 Ga0157369_11989087
503 Ga0157374_11628591
504 Ga0163162_10041882
505 Ga0163162_11825192
506 Ga0157372_10050435
507 Ga0157372_10738473
508 Ga0157372_10952529
509 Ga0157372_12723993
510 Ga0157375_10050382
511 Ga0157375_10234502
512 Ga0157375_10502765
513 Ga0157375_10850476
514 Ga0157375_11376953
515 Ga0157375_11960488
516 Ga0163163_10106756
517 Ga0163163_10809277
518 Ga0163163_12103919
519 Ga0157380_10148529
520 Ga0157380_10425976
521 Ga0157380_11942120
522 Ga0157377_10199016
523 Ga0157379_11006121
524 Ga0157376_11616686
525 Ga0206356_11327010
526 Ga0206353_10603109
527 Ga0206353_10628400
528 Ga0206353_11953191
529 Ga0207642_10675582
530 Ga0207688_10533580
531 Ga0207647_10164852
532 Ga0207647_10279169
533 Ga0207705_10073954
534 Ga0207705_10096223
535 Ga0207654_10094447
536 Ga0207671_10244412
537 Ga0207660_10019578
538 Ga0207660_10182200
539 Ga0207662_10016873
540 Ga0207662_10654953
541 Ga0207657_10131001
542 Ga0207649_11087591
543 Ga0207652_10058298
544 Ga0207652_10093442
545 Ga0207646_10830400
546 Ga0207687_10041302
547 Ga0207690_10326451
548 Ga0207706_11288853
549 Ga0207686_10577686
550 Ga0207709_10313370
551 Ga0207709_10500724
552 Ga0207669_11449500
553 Ga0207704_10497807
554 Ga0207711_10144866
555 Ga0207661_10048902
556 Ga0207661_10068120
557 Ga0207679_11142826
558 Ga0207667_10123116
559 Ga0207640_11887194
560 Ga0207658_10208479
561 Ga0207677_11295451
562 Ga0207677_11524958
563 Ga0207703_10175519
564 Ga0207639_10238600
565 Ga0207639_11337587
566 Ga0207702_10239998
567 Ga0207641_10356752
568 Ga0207676_10331085
569 Ga0207674_10007318
570 Ga0207674_10905731
571 Ga0207675_100245848
572 Ga0207683_10320410
573 Ga0207683_10723632
574 Ga0207683_10767846
575 Ga0207683_11426330
576 Ga0207698_10210839
577 Ga0209813_10001318
578 Ga0268266_10004826
579 Ga0268266_10666984
580 Ga0268264_10770393
581 Ga0316183_1005226
582 Ga0316182_1329595
583 Ga0307410_10673772
584 Ga0307407_10208288
585 Ga0307407_10367749
586 Ga0307409_100215169
587 Ga0307416_100437472
588 Ga0307416_102063481
589 Ga0307416_103628451
590 Ga0307414_11771943
591 Ga0307411_10445009
592 Ga0307411_10968888
593 Ga0439465_0038589
594 Ga0451791_0148708
595 Ga0451791_1701293
596 Ga0451797_1180106
597 Ga0451800_0179445
598 Ga0451806_338466
599 Ga0451804_0722187
600 Ga0451804_0898106
601 Ga0451835_0907654
602 Ga0451835_0979967
603 Ga0451837_0390383
604 Ga0451837_0680710
605 Ga0451849_0780370
606 Ga0451843_0258885
607 Ga0451843_0954926
608 Ga0451843_1646176
609 Ga0451853_1616566
610 Ga0451853_3267367
611 Ga0439442_017236
612 Ga0439459_0240169
613 Ga0466972_0258989
614 Ga0466961_0134812
615 Ga0466963_0019825
616 Ga0466963_0075789
617 Ga0466964_0063538
618 Ga0466964_0498757
619 Ga0466971_0132889
620 Ga0466968_0033075
621 Ga0466970_0079537
622 Ga0466970_0691942
623 Ga0466957_0009450
624 Ga0466960_0000241
625 Ga0466960_0114942
626 Ga0466960_0839221
627 Ga0466959_0714578
628 Ga0451576_0419807
629 Ga0466967_0083084
630 Ga0466967_0083209
631 Ga0466967_0093322
632 Ga0466967_0119848
633 Ga0466967_0168808
634 Ga0466967_0339499
635 Ga0466967_0352585
636 Ga0466967_0830140
637 Ga0495603_0303373
638 Ga0495653_0566805
639 Ga0495608_0149539
640 Ga0495620_0037783
641 Ga0495630_0455257
642 Ga0495667_0340602
643 Ga0495634_0246986
644 Ga0495635_0673019
645 Ga0495613_0343358
646 Ga0495624_0845018
647 Ga0495674_0676071
648 Ga0495680_0475850
649 Ga0496100_0147389
650 Ga0496100_1498404
651 Ga0496101_0179620
652 Ga0496101_0247509
653 Ga0496101_0452455
654 Ga0496102_0148233
655 Ga0496102_0239655
656 Ga0496102_0480820
657 Ga0496103_0084085
658 Ga0496103_0116198
659 Ga0496103_0346563
660 Ga0496103_0440530
661 Ga0496104_1082166
662 Ga0496105_0001223
663 Ga0496105_0757454
664 Ga0496107_0146040
665 Ga0496107_0359999
666 Ga0496107_1251177
667 Ga0496108_0021344
668 Ga0496108_0027253
669 Ga0496108_0049385
670 Ga0496108_0199366
671 Ga0496108_0251276
672 Ga0496109_0017988
673 Ga0496109_0030734
674 Ga0496109_0040098
675 Ga0496109_0702276
676 Ga0496110_0083471
677 Ga0496110_0917174
678 Ga0496111_0043129
679 Ga0496111_0375025
680 Ga0496112_0991144
681 Ga0496112_1765896
682 Ga0496113_0236944
683 Ga0496113_0294407
684 Ga0496113_0320182
685 Ga0496114_0042993
686 Ga0496114_0058140
687 Ga0496114_0256281
688 Ga0496114_0421739
689 Ga0496114_0536505
690 Ga0496114_0827065
691 Ga0496114_0966660
692 Ga0496115_0008274
693 Ga0496115_0083601
694 Ga0501306_011421
695 Ga0501305_074390
696 Ga0501307_028770
697 Ga0501311_042009
698 Ga0501317_038164
699 Ga0501317_045719
700 Ga0501031_0005204
701 Ga0501031_0014748
702 Ga0501032_0015752
703 Ga0501032_0159578
704 Ga0501033_0219621
705 Ga0501034_0903586
706 Ga0501036_0021757
707 Ga0501036_0038100
708 Ga0501036_0198466
709 Ga0501036_0609783
710 Ga0501037_0095218
711 Ga0501038_0063062
712 Ga0501038_0424744
713 Ga0501038_0447183
714 Ga0501039_0093526
715 Ga0501039_0098802
716 Ga0501040_0204275
717 Ga0501040_0409654
718 Ga0501041_0016939
719 Ga0501041_0265355
720 Ga0501042_0008725
721 Ga0501042_0197949
722 Ga0501043_0229773
723 Ga0501048_0154346
724 Ga0501048_0209230
725 Ga0501067_0000434
726 Ga0501067_0019587
727 Ga0501067_0173247
728 Ga0501067_0292540
729 Ga0501068_0004332
730 Ga0501068_0165557
731 Ga0501069_0026853
732 Ga0501069_0037624
733 Ga0501069_0120199
734 Ga0501069_0282108
735 Ga0501069_0337173
736 Ga0501070_0004706
737 Ga0501070_0062892
738 Ga0501070_0205212
739 Ga0501071_0001534
740 Ga0501071_0004791
741 Ga0501071_0064833
742 Ga0501071_0575133
743 Ga0501071_1489559
744 Ga0501072_0000849
745 Ga0501072_0010594
746 Ga0501072_0492385
747 Ga0501072_0732525
748 Ga0501073_0004915
749 Ga0501074_0000659
750 Ga0501074_0021752
751 Ga0501075_0146280
752 Ga0501075_0219497
753 Ga0501075_1005692
754 Ga0501075_1544911
755 Ga0501076_0032477
756 Ga0501076_0221765
757 Ga0501076_0840822
758 Ga0501077_0055494
759 Ga0501077_0188806
760 Ga0501077_0259254
761 Ga0501208_062947
762 Ga0501079_0153727
763 Ga0501079_0279767
764 Ga0501080_0004024
765 Ga0501080_0111243
766 Ga0501080_0132026
767 Ga0501081_0101090
768 Ga0501035_0148160
769 Ga0501035_1022531
770 Ga0501044_1546668
771 Ga0501045_0017393
772 Ga0501045_0047717
773 Ga0501045_0141029
774 nmdc:mga03n38_126782_c1
775 nmdc:mga03n38_152988_c1
776 nmdc:mga00v17_191179_c1
777 nmdc:mga00v17_371449_c1
778 nmdc:mga00v17_59443_c1
779 nmdc:mga0yw44_13716_c1
780 nmdc:mga0yw44_235222_c1
781 nmdc:mga0yw44_340348_c1
782 nmdc:mga0yw44_535298_c1
783 nmdc:mga0yw44_55557_c1
784 nmdc:mga0yw44_76986_c1
785 nmdc:mga0yw44_880541_c1
786 nmdc:mga04h51_11098_c1
787 Ga0495655_0039926
788 Ga0495619_0311025
789 Ga0501084_0025645
790 Ga0501084_0032836
791 Ga0501084_0565310
792 Ga0501084_1385187
793 Ga0587098_042109
794 Ga0587119_031418
795 Ga0501082_0123980
796 Ga0530510_0190988
797 Ga0530510_0600786
798 Ga0530510_1313233
799 2644229325
800 2740169476
801 2857484642
802 2984579950
803 2990260371
804 8054612853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

5

129

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.945 4 125
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.8756 4 125
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8652 1 135
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.8628 1 128
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8591 1 135
ID Description Score Start End Superfamily
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.945 4 125 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9381 1 125 1.10.940.10
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8776 1 132 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8756 4 125 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8648 1 125 1.10.940.10
ID Description Score Start End GO Terms
AF-A1SJD8-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9947 1 134 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A562C9A1-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9884 1 134 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A0Q8PL16-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9817 1 134 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A840NC15-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9816 1 133 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A2S3ZWZ9-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9776 1 133 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Map