F435168

General Info

Members Datasets Scaffolds Average Seq Length
402 227 804 183

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0259806|Ga0466967_0259806_659_1348
Length 212
Sequence VDARSSVAVHLPKIRWTRGWAEMLEIAVLGLLNDSPMHGYELRKRLANLLGTFRAFSYGSLYPTLRRLSEAGWISEEAPIASTGGVRSRRGKRVYRLTAEGKEHLADLLADVGPDAFEDEGFGARLAFFAQTRSDIRLQILEGRKRRVEEQRDGMRSALARTGERFDRYTRELQEHGLETKDREVRWLAELIEHETSMAAAPPARPTEKEEP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 4.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 7.71
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0259806 3300045976 Bacteria 1661
2 JGI24737J22298_10022743 3300001990 Bacteria 1992
3 JGI24735J21928_10022225 3300002067 Bacteria 1933
4 JGI24735J21928_10061212 3300002067 Bacteria 1081
5 rootH1_10058435 3300003323 Bacteria 1321
6 Ga0070658_10256654 3300005327 Bacteria 1484
7 Ga0070658_10870440 3300005327 Bacteria 783
8 Ga0070683_100217962 3300005329 Bacteria 1813
9 Ga0068869_100096365 3300005334 Bacteria 2233
10 Ga0070666_10006575 3300005335 Bacteria 7143
11 Ga0070666_10032657 3300005335 Bacteria 3439
12 Ga0070682_100055028 3300005337 Bacteria 2498
13 Ga0068868_100019354 3300005338 Bacteria 5100
14 Ga0070660_100021894 3300005339 Bacteria 4720
15 Ga0070660_100250725 3300005339 Bacteria 1443
16 Ga0070689_100021236 3300005340 Bacteria 4829
17 Ga0070691_10030174 3300005341 Bacteria 2539
18 Ga0070661_101101628 3300005344 Bacteria 662
19 Ga0070692_10537351 3300005345 Bacteria 764
20 Ga0070668_100035225 3300005347 Bacteria 3816
21 Ga0070668_100133248 3300005347 Bacteria 1996
22 Ga0070669_100178071 3300005353 Bacteria 1662
23 Ga0070675_100501645 3300005354 Bacteria 1093
24 Ga0070671_100074803 3300005355 Bacteria 2830
25 Ga0070671_100214265 3300005355 Bacteria 1634
26 Ga0070674_100335313 3300005356 Bacteria 1217
27 Ga0070659_100093635 3300005366 Bacteria 2411
28 Ga0070667_100009211 3300005367 Bacteria 8176
29 Ga0070703_10038445 3300005406 Bacteria 1479
30 Ga0070709_10134402 3300005434 Bacteria 1692
31 Ga0070714_100119405 3300005435 Bacteria 2343
32 Ga0070714_100806611 3300005435 Bacteria 909
33 Ga0070714_101050818 3300005435 Bacteria 793
34 Ga0070713_100209380 3300005436 Bacteria 1764
35 Ga0070710_10015759 3300005437 Bacteria 3832
36 Ga0070710_10452169 3300005437 Bacteria 871
37 Ga0070701_10073521 3300005438 Bacteria 1833
38 Ga0070711_100132441 3300005439 Bacteria 1858
39 Ga0070711_100920171 3300005439 Bacteria 747
40 Ga0070705_100018337 3300005440 Bacteria 3668
41 Ga0070700_100000015 3300005441 Bacteria 149873
42 Ga0070700_100125909 3300005441 Bacteria 1723
43 Ga0070694_100081884 3300005444 Bacteria 2246
44 Ga0070708_100283560 3300005445 Bacteria 1559
45 Ga0070663_100076598 3300005455 Bacteria 2446
46 Ga0070663_100098378 3300005455 Bacteria 2179
47 Ga0070678_100095003 3300005456 Bacteria 2296
48 Ga0070662_100079200 3300005457 Bacteria 2443
49 Ga0070681_10664504 3300005458 Bacteria 957
50 Ga0070679_100201256 3300005530 Bacteria 1957
51 Ga0070697_100388191 3300005536 Bacteria 1210
52 Ga0068853_100136604 3300005539 Bacteria 2198
53 Ga0070672_101209924 3300005543 Bacteria 673
54 Ga0070695_100033713 3300005545 Bacteria 3205
55 Ga0070696_100013660 3300005546 Bacteria 5451
56 Ga0070693_100067565 3300005547 Bacteria 2096
57 Ga0070665_100007434 3300005548 Bacteria 11139
58 Ga0070665_100148019 3300005548 Bacteria 2351
59 Ga0070665_100167524 3300005548 Bacteria 2199
60 Ga0070665_100239700 3300005548 Bacteria 1814
61 Ga0070704_100078728 3300005549 Bacteria 2419
62 Ga0068855_100021258 3300005563 Bacteria 7779
63 Ga0068855_100198350 3300005563 Bacteria 2261
64 Ga0068855_100315364 3300005563 Bacteria 1729
65 Ga0068857_100706783 3300005577 Bacteria 958
66 Ga0068854_100031844 3300005578 Bacteria 3666
67 Ga0068854_100477593 3300005578 Bacteria 1046
68 Ga0068856_100062812 3300005614 Bacteria 3669
69 Ga0068856_100136584 3300005614 Bacteria 2457
70 Ga0068856_100140345 3300005614 Bacteria 2424
71 Ga0068856_100258538 3300005614 Bacteria 1756
72 Ga0070702_100020036 3300005615 Bacteria 3498
73 Ga0068852_100134474 3300005616 Bacteria 2282
74 Ga0068859_100000488 3300005617 Bacteria 39249
75 Ga0068861_100035101 3300005719 Bacteria 3713
76 Ga0068851_10379274 3300005834 Bacteria 828
77 Ga0068863_100003128 3300005841 Bacteria 16335
78 Ga0068863_100057684 3300005841 Bacteria 3674
79 Ga0068858_100015331 3300005842 Bacteria 7211
80 Ga0068858_100212802 3300005842 Bacteria 1829
81 Ga0068860_100000147 3300005843 Bacteria 115672
82 Ga0068860_100436289 3300005843 Bacteria 1300
83 Ga0068862_100952911 3300005844 Bacteria 846
84 Ga0081455_10013393 3300005937 Bacteria 8111
85 Ga0081540_1003735 3300005983 Bacteria 11927
86 Ga0070717_10305662 3300006028 Bacteria 1414
87 Ga0070715_10097379 3300006163 Bacteria 1366
88 Ga0070716_100057701 3300006173 Bacteria 2232
89 Ga0070712_100065080 3300006175 Bacteria 2586
90 Ga0068871_100372490 3300006358 Bacteria 1267
91 Ga0075434_100011139 3300006871 Bacteria 8461
92 Ga0068865_100074590 3300006881 Bacteria 2416
93 Ga0075436_100012136 3300006914 Bacteria 5902
94 Ga0097620_100000488 3300006931 Bacteria 39249
95 Ga0075435_100184484 3300007076 Bacteria 1764
96 Ga0105240_10039976 3300009093 Bacteria 6004
97 Ga0105240_10055581 3300009093 Bacteria 4956
98 Ga0105240_10138430 3300009093 Bacteria 2913
99 Ga0105240_10240304 3300009093 Bacteria 2100
100 Ga0105240_10623653 3300009093 Bacteria 1185
101 Ga0111539_10276041 3300009094 Bacteria 1956
102 Ga0105245_10042406 3300009098 Bacteria 4060
103 Ga0105245_10248388 3300009098 Bacteria 1727
104 Ga0105247_10005816 3300009101 Bacteria 7715
105 Ga0105247_10012300 3300009101 Bacteria 5141
106 Ga0114129_12389661 3300009147 Bacteria 633
107 Ga0105243_10089630 3300009148 Bacteria 2529
108 Ga0105241_10083159 3300009174 Bacteria 2511
109 Ga0105241_10178703 3300009174 Bacteria 1758
110 Ga0105241_10437989 3300009174 Bacteria 1154
111 Ga0105242_10070548 3300009176 Bacteria 2897
112 Ga0105248_10081848 3300009177 Bacteria 3629
113 Ga0105248_10741595 3300009177 Bacteria 1108
114 Ga0105237_10009303 3300009545 Bacteria 10528
115 Ga0105237_10054314 3300009545 Bacteria 4014
116 Ga0105238_10152233 3300009551 Bacteria 2288
117 Ga0105238_10327156 3300009551 Bacteria 1519
118 Ga0105238_11365234 3300009551 Bacteria 735
119 Ga0105249_10006212 3300009553 Bacteria 10375
120 Ga0105239_10004882 3300010375 Bacteria 15872
121 Ga0105239_10047165 3300010375 Bacteria 4721
122 Ga0105246_10040026 3300011119 Bacteria 3161
123 Ga0157373_10208833 3300013100 Bacteria 1377
124 Ga0157371_10010404 3300013102 Bacteria 7251
125 Ga0157370_10075803 3300013104 Bacteria 3170
126 Ga0157369_10090160 3300013105 Bacteria 3273
127 Ga0157369_10186841 3300013105 Bacteria 2179
128 Ga0157374_10039858 3300013296 Bacteria 4324
129 Ga0157378_10186832 3300013297 Bacteria 1952
130 Ga0163162_10049437 3300013306 Bacteria 4214
131 Ga0157372_10831236 3300013307 Bacteria 1072
132 Ga0163163_10020487 3300014325 Bacteria 6228
133 Ga0157380_10022768 3300014326 Bacteria 4723
134 Ga0157377_10059341 3300014745 Bacteria 2180
135 Ga0157379_10013473 3300014968 Bacteria 7165
136 Ga0157379_10023389 3300014968 Bacteria 5484
137 Ga0157376_10264701 3300014969 Bacteria 1612
138 Ga0163161_10020419 3300017792 Bacteria 4649
139 Ga0197907_10722304 3300020069 Bacteria 726
140 Ga0197907_11018042 3300020069 Bacteria 923
141 Ga0206356_10772927 3300020070 Bacteria 1827
142 Ga0206356_10817731 3300020070 Bacteria 837
143 Ga0206356_11459916 3300020070 Bacteria 1302
144 Ga0206349_1046875 3300020075 Bacteria 1469
145 Ga0206349_1947930 3300020075 Bacteria 587
146 Ga0206355_1006685 3300020076 Bacteria 1410
147 Ga0206352_10629310 3300020078 Bacteria 889
148 Ga0206350_10564664 3300020080 Bacteria 1453
149 Ga0206354_10621990 3300020081 Bacteria 1125
150 Ga0206353_10867485 3300020082 Bacteria 1657
151 Ga0206353_11299336 3300020082 Bacteria 1436
152 Ga0154015_1465447 3300020610 Bacteria 1453
153 Ga0213876_10066773 3300021384 Bacteria 1899
154 Ga0224712_10039509 3300022467 Bacteria 1769
155 Ga0224712_10059594 3300022467 Bacteria 1516
156 Ga0207656_10164600 3300025321 Bacteria 1057
157 Ga0207653_10029817 3300025885 Bacteria 1758
158 Ga0207692_10134858 3300025898 Bacteria 1398
159 Ga0207692_10164726 3300025898 Bacteria 1280
160 Ga0207710_10009267 3300025900 Bacteria 4140
161 Ga0207710_10075312 3300025900 Bacteria 1555
162 Ga0207688_10000847 3300025901 Bacteria 15401
163 Ga0207680_10003613 3300025903 Bacteria 7264
164 Ga0207680_10052896 3300025903 Bacteria 2435
165 Ga0207647_10008440 3300025904 Bacteria 7389
166 Ga0207647_10023530 3300025904 Bacteria 4073
167 Ga0207699_10160449 3300025906 Bacteria 1496
168 Ga0207643_10271120 3300025908 Bacteria 1050
169 Ga0207654_10237391 3300025911 Bacteria 1217
170 Ga0207695_10056226 3300025913 Bacteria 4095
171 Ga0207695_10110817 3300025913 Bacteria 2724
172 Ga0207695_10419210 3300025913 Bacteria 1223
173 Ga0207671_10232816 3300025914 Bacteria 1445
174 Ga0207693_10018805 3300025915 Bacteria 5498
175 Ga0207663_10085899 3300025916 Bacteria 2073
176 Ga0207657_10017862 3300025919 Bacteria 6788
177 Ga0207681_10038387 3300025923 Bacteria 3173
178 Ga0207694_10097128 3300025924 Bacteria 2330
179 Ga0207694_10490591 3300025924 Bacteria 1028
180 Ga0207687_10014843 3300025927 Bacteria 5101
181 Ga0207687_10082159 3300025927 Bacteria 2330
182 Ga0207700_10045910 3300025928 Bacteria 3227
183 Ga0207700_10341712 3300025928 Bacteria 1301
184 Ga0207664_10307625 3300025929 Bacteria 1396
185 Ga0207664_10311732 3300025929 Bacteria 1386
186 Ga0207664_10578539 3300025929 Bacteria 1008
187 Ga0207644_10061943 3300025931 Bacteria 2711
188 Ga0207706_10031325 3300025933 Bacteria 4739
189 Ga0207669_10285910 3300025937 Bacteria 1246
190 Ga0207665_10019603 3300025939 Bacteria 4447
191 Ga0207691_10126747 3300025940 Bacteria 2258
192 Ga0207711_10316537 3300025941 Bacteria 1441
193 Ga0207711_10523261 3300025941 Bacteria 1106
194 Ga0207689_10010779 3300025942 Bacteria 7865
195 Ga0207661_10115729 3300025944 Bacteria 2275
196 Ga0207661_10392985 3300025944 Bacteria 1257
197 Ga0207679_10314280 3300025945 Bacteria 1354
198 Ga0207667_10062633 3300025949 Bacteria 3888
199 Ga0207667_10198479 3300025949 Bacteria 2058
200 Ga0207651_10039582 3300025960 Bacteria 3110
201 Ga0207712_10276709 3300025961 Bacteria 1368
202 Ga0207668_10067641 3300025972 Bacteria 2537
203 Ga0207640_10186920 3300025981 Bacteria 1558
204 Ga0207640_10406589 3300025981 Bacteria 1110
205 Ga0207658_10004382 3300025986 Bacteria 9817
206 Ga0207658_10008389 3300025986 Bacteria 7032
207 Ga0207658_10184097 3300025986 Bacteria 1731
208 Ga0207677_10038475 3300026023 Bacteria 3137
209 Ga0207703_10017686 3300026035 Bacteria 5566
210 Ga0207703_10083287 3300026035 Bacteria 2672
211 Ga0207639_10029509 3300026041 Bacteria 4016
212 Ga0207678_10003745 3300026067 Bacteria 13684
213 Ga0207708_10000004 3300026075 Bacteria 293087
214 Ga0207708_10122428 3300026075 Bacteria 2028
215 Ga0207702_10010793 3300026078 Bacteria 7623
216 Ga0207702_10013808 3300026078 Bacteria 6709
217 Ga0207702_10041867 3300026078 Bacteria 3841
218 Ga0207702_10403190 3300026078 Bacteria 1319
219 Ga0207641_10000451 3300026088 Bacteria 46849
220 Ga0207641_10197576 3300026088 Bacteria 1852
221 Ga0207648_10224826 3300026089 Bacteria 1669
222 Ga0207676_10243562 3300026095 Bacteria 1614
223 Ga0207675_100028728 3300026118 Bacteria 5180
224 Ga0207683_10000940 3300026121 Bacteria 26716
225 Ga0268266_10015394 3300028379 Bacteria 6562
226 Ga0268266_10182456 3300028379 Bacteria 1912
227 Ga0268266_10210532 3300028379 Bacteria 1783
228 Ga0268264_10000033 3300028381 Bacteria 404123
229 Ga0268264_10000138 3300028381 Bacteria 172597
230 Ga0268264_10075979 3300028381 Bacteria 2857
231 Ga0373930_0019581 3300034816 Bacteria 1311
232 Ga0373938_0015474 3300034957 Bacteria 1478
233 Ga0373929_0019078 3300035085 Bacteria 1369
234 Ga0373951_0014286 3300035091 Bacteria 1784
235 Ga0373939_0011568 3300035114 Bacteria 2231
236 Ga0373962_0006932 3300035242 Bacteria 2760
237 Ga0373931_0041166 3300035691 Bacteria 2426
238 Ga0436365_0937630 3300039437 Bacteria 2571
239 Ga0466972_0019561 3300044658 Bacteria 3385
240 Ga0466972_0054870 3300044658 Bacteria 1917
241 Ga0466972_0086069 3300044658 Bacteria 1494
242 Ga0466972_0087831 3300044658 Bacteria 1476
243 Ga0466972_0161246 3300044658 Bacteria 1053
244 Ga0466965_0024085 3300044683 Bacteria 2943
245 Ga0466966_0010299 3300044684 Bacteria 6204
246 Ga0466966_0021816 3300044684 Bacteria 4204
247 Ga0466966_0061483 3300044684 Bacteria 2369
248 Ga0466966_0068420 3300044684 Bacteria 2229
249 Ga0466966_0101599 3300044684 Bacteria 1778
250 Ga0466966_0183460 3300044684 Bacteria 1269
251 Ga0466961_0015345 3300044693 Bacteria 4919
252 Ga0466961_0033635 3300044693 Bacteria 3293
253 Ga0466961_0041757 3300044693 Bacteria 2940
254 Ga0466961_0056593 3300044693 Bacteria 2499
255 Ga0466961_0080949 3300044693 Bacteria 2055
256 Ga0466961_0130055 3300044693 Bacteria 1578
257 Ga0466961_0136834 3300044693 Bacteria 1534
258 Ga0466961_0192158 3300044693 Bacteria 1265
259 Ga0466961_0231125 3300044693 Bacteria 1138
260 Ga0466961_0339381 3300044693 Bacteria 915
261 Ga0466961_0350144 3300044693 Bacteria 899
262 Ga0466963_0006583 3300044694 Bacteria 6887
263 Ga0466963_0017115 3300044694 Bacteria 4515
264 Ga0466963_0063806 3300044694 Bacteria 2466
265 Ga0466963_0076352 3300044694 Bacteria 2262
266 Ga0466963_0110293 3300044694 Bacteria 1888
267 Ga0466963_0170981 3300044694 Bacteria 1515
268 Ga0466963_0276398 3300044694 Bacteria 1180
269 Ga0466963_0340277 3300044694 Bacteria 1056
270 Ga0466964_0011246 3300044706 Bacteria 3380
271 Ga0466971_0009008 3300044719 Bacteria 4360
272 Ga0466971_0028315 3300044719 Bacteria 2507
273 Ga0466971_0035398 3300044719 Bacteria 2238
274 Ga0466971_0285890 3300044719 Bacteria 790
275 Ga0466971_0299349 3300044719 Bacteria 772
276 Ga0466971_0383078 3300044719 Bacteria 684
277 Ga0466968_0100756 3300044735 Bacteria 1289
278 Ga0466968_0343695 3300044735 Bacteria 724
279 Ga0466970_0031276 3300044765 Bacteria 2811
280 Ga0466970_0038223 3300044765 Bacteria 2545
281 Ga0466970_0114878 3300044765 Bacteria 1471
282 Ga0466970_0142553 3300044765 Bacteria 1320
283 Ga0466970_0635351 3300044765 Bacteria 620
284 Ga0466957_0014501 3300044842 Bacteria 4589
285 Ga0466957_0018785 3300044842 Bacteria 4062
286 Ga0466957_0047297 3300044842 Bacteria 2614
287 Ga0466957_0177781 3300044842 Bacteria 1389
288 Ga0466957_0244845 3300044842 Bacteria 1191
289 Ga0466957_0311340 3300044842 Bacteria 1060
290 Ga0466957_0354273 3300044842 Bacteria 996
291 Ga0466957_0541143 3300044842 Bacteria 811
292 Ga0466957_0949199 3300044842 Bacteria 616
293 Ga0466960_0012065 3300044901 Bacteria 3636
294 Ga0466960_0092481 3300044901 Bacteria 1544
295 Ga0466960_0130256 3300044901 Bacteria 1327
296 Ga0466960_0460370 3300044901 Unclassified 740
297 Ga0466959_0050654 3300045049 Bacteria 3048
298 Ga0466959_0051742 3300045049 Bacteria 3010
299 Ga0466959_0052064 3300045049 Bacteria 3000
300 Ga0466959_0145983 3300045049 Bacteria 1669
301 Ga0466959_0169589 3300045049 Bacteria 1531
302 Ga0466959_0208267 3300045049 Bacteria 1359
303 Ga0466959_0210802 3300045049 Bacteria 1350
304 Ga0466959_0272463 3300045049 Bacteria 1163
305 Ga0466959_0278265 3300045049 Bacteria 1149
306 Ga0466959_0289527 3300045049 Bacteria 1123
307 Ga0466958_0008435 3300045836 Bacteria 5716
308 Ga0466958_0013836 3300045836 Bacteria 4601
309 Ga0466958_0062762 3300045836 Bacteria 2265
310 Ga0466958_0160001 3300045836 Bacteria 1422
311 Ga0466958_0187085 3300045836 Bacteria 1315
312 Ga0466958_0206719 3300045836 Bacteria 1250
313 Ga0466967_0000506 3300045976 Bacteria 19040
314 Ga0466967_0004805 3300045976 Bacteria 9207
315 Ga0466967_0007054 3300045976 Bacteria 8049
316 Ga0466967_0010956 3300045976 Bacteria 6835
317 Ga0466967_0022203 3300045976 Bacteria 5172
318 Ga0466967_0041369 3300045976 Bacteria 3973
319 Ga0466967_0105131 3300045976 Bacteria 2586
320 Ga0466967_0157740 3300045976 Bacteria 2127
321 Ga0466967_0162177 3300045976 Bacteria 2099
322 Ga0466967_0224179 3300045976 Bacteria 1787
323 Ga0466967_0227902 3300045976 Bacteria 1773
324 Ga0466967_0281763 3300045976 Bacteria 1595
325 Ga0466967_0301266 3300045976 Bacteria 1542
326 Ga0466967_0326802 3300045976 Bacteria 1480
327 Ga0466967_0330819 3300045976 Bacteria 1471
328 Ga0466967_0493793 3300045976 Bacteria 1200
329 Ga0466967_0697443 3300045976 Bacteria 1005
330 Ga0466967_0865364 3300045976 Bacteria 898
331 Ga0466967_0874360 3300045976 Bacteria 893
332 Ga0466967_0977931 3300045976 Bacteria 842
333 Ga0466967_1310350 3300045976 Bacteria 721
334 Ga0495603_0045049 3300046455 Bacteria 2632
335 Ga0495641_0192581 3300046461 Bacteria 914
336 Ga0495653_0216229 3300046463 Bacteria 1291
337 Ga0495647_0126137 3300046681 Bacteria 1081
338 Ga0495624_0113974 3300046690 Bacteria 1662
339 Ga0496100_0133389 3300048903 Bacteria 1752
340 Ga0496101_0347402 3300048904 Bacteria 1165
341 Ga0496102_0000013 3300048905 Bacteria 311668
342 Ga0496102_0000558 3300048905 Bacteria 39827
343 Ga0496102_0166172 3300048905 Bacteria 2076
344 Ga0496102_0234604 3300048905 Bacteria 1729
345 Ga0496103_0001975 3300048906 Bacteria 13260
346 Ga0496103_0033008 3300048906 Bacteria 3162
347 Ga0496103_0070745 3300048906 Bacteria 2183
348 Ga0496104_0248284 3300048907 Bacteria 1692
349 Ga0496104_0316719 3300048907 Bacteria 1473
350 Ga0496105_0064573 3300048908 Bacteria 3020
351 Ga0496105_0104714 3300048908 Bacteria 2336
352 Ga0496106_0214383 3300048909 Bacteria 1534
353 Ga0496107_0074083 3300048910 Bacteria 2477
354 Ga0496108_0061132 3300048911 Bacteria 3169
355 Ga0496108_0553528 3300048911 Bacteria 1003
356 Ga0496108_0739873 3300048911 Bacteria 851
357 Ga0496109_0006408 3300048912 Bacteria 9908
358 Ga0496109_0032793 3300048912 Bacteria 4671
359 Ga0496110_0011028 3300048913 Bacteria 7376
360 Ga0496110_0037212 3300048913 Bacteria 4229
361 Ga0496112_0133982 3300048915 Bacteria 2448
362 Ga0496112_0139474 3300048915 Bacteria 2394
363 Ga0496112_0561763 3300048915 Bacteria 1075
364 Ga0496113_0103388 3300048916 Bacteria 2209
365 Ga0496113_0183876 3300048916 Bacteria 1657
366 Ga0496114_0035270 3300048917 Bacteria 4130
367 Ga0496114_0479824 3300048917 Bacteria 1100
368 Ga0496115_0121627 3300048918 Bacteria 2148
369 Ga0496115_0346437 3300048918 Bacteria 1212
370 Ga0496117_0109883 3300048920 Bacteria 1720
371 Ga0496118_0015526 3300048921 Bacteria 7045
372 Ga0496119_0000022 3300048922 Bacteria 269878
373 Ga0496119_0082164 3300048922 Bacteria 1853
374 Ga0496119_0269612 3300048922 Bacteria 851
375 Ga0496120_0001243 3300048923 Bacteria 32177
376 Ga0496121_0019256 3300048924 Bacteria 6835
377 Ga0496126_0932694 3300048929 Bacteria 656
378 Ga0501031_0027431 3300049568 Bacteria 3713
379 Ga0501033_0159125 3300049570 Bacteria 1626
380 Ga0501034_0134483 3300049571 Bacteria 2454
381 Ga0501036_0191871 3300049572 Bacteria 1719
382 Ga0501037_0083068 3300049573 Bacteria 2320
383 Ga0501038_0001534 3300049574 Bacteria 21319
384 Ga0501039_1028759 3300049575 Bacteria 639
385 Ga0501043_0007513 3300049579 Bacteria 8657
386 Ga0501047_0127012 3300049581 Bacteria 2430
387 Ga0501048_0000557 3300049582 Bacteria 26386
388 Ga0501067_0193608 3300049583 Bacteria 1133
389 Ga0501070_0032772 3300049586 Bacteria 4347
390 Ga0501074_0598779 3300049590 Bacteria 779
391 Ga0501081_0113210 3300049743 Bacteria 1927
392 Ga0501035_0020003 3300049822 Bacteria 6149
393 Ga0501044_0104114 3300049823 Bacteria 2852
394 nmdc:mga08y16_384187_c1 3300050511 Bacteria 1439
395 Ga0500658_0334799 3300053134 Bacteria 695
396 Ga0587083_0011971 3300059505 Bacteria 1445
397 Ga0587106_022349 3300059605 Bacteria 950
398 Ga0587071_042996 3300060344 Bacteria 912
399 Ga0466962_0025120 3300061719 Bacteria 2860
400 Ga0466962_0050075 3300061719 Bacteria 1997
401 Ga0466962_0075806 3300061719 Bacteria 1607
402 Ga0466962_0108529 3300061719 Bacteria 1335
403 Ga0466967_0259806
404 JGI24737J22298_10022743
405 JGI24735J21928_10022225
406 JGI24735J21928_10061212
407 rootH1_10058435
408 Ga0070658_10256654
409 Ga0070658_10870440
410 Ga0070683_100217962
411 Ga0068869_100096365
412 Ga0070666_10006575
413 Ga0070666_10032657
414 Ga0070682_100055028
415 Ga0068868_100019354
416 Ga0070660_100021894
417 Ga0070660_100250725
418 Ga0070689_100021236
419 Ga0070691_10030174
420 Ga0070661_101101628
421 Ga0070692_10537351
422 Ga0070668_100035225
423 Ga0070668_100133248
424 Ga0070669_100178071
425 Ga0070675_100501645
426 Ga0070671_100074803
427 Ga0070671_100214265
428 Ga0070674_100335313
429 Ga0070659_100093635
430 Ga0070667_100009211
431 Ga0070703_10038445
432 Ga0070709_10134402
433 Ga0070714_100119405
434 Ga0070714_100806611
435 Ga0070714_101050818
436 Ga0070713_100209380
437 Ga0070710_10015759
438 Ga0070710_10452169
439 Ga0070701_10073521
440 Ga0070711_100132441
441 Ga0070711_100920171
442 Ga0070705_100018337
443 Ga0070700_100000015
444 Ga0070700_100125909
445 Ga0070694_100081884
446 Ga0070708_100283560
447 Ga0070663_100076598
448 Ga0070663_100098378
449 Ga0070678_100095003
450 Ga0070662_100079200
451 Ga0070681_10664504
452 Ga0070679_100201256
453 Ga0070697_100388191
454 Ga0068853_100136604
455 Ga0070672_101209924
456 Ga0070695_100033713
457 Ga0070696_100013660
458 Ga0070693_100067565
459 Ga0070665_100007434
460 Ga0070665_100148019
461 Ga0070665_100167524
462 Ga0070665_100239700
463 Ga0070704_100078728
464 Ga0068855_100021258
465 Ga0068855_100198350
466 Ga0068855_100315364
467 Ga0068857_100706783
468 Ga0068854_100031844
469 Ga0068854_100477593
470 Ga0068856_100062812
471 Ga0068856_100136584
472 Ga0068856_100140345
473 Ga0068856_100258538
474 Ga0070702_100020036
475 Ga0068852_100134474
476 Ga0068859_100000488
477 Ga0068861_100035101
478 Ga0068851_10379274
479 Ga0068863_100003128
480 Ga0068863_100057684
481 Ga0068858_100015331
482 Ga0068858_100212802
483 Ga0068860_100000147
484 Ga0068860_100436289
485 Ga0068862_100952911
486 Ga0081455_10013393
487 Ga0081540_1003735
488 Ga0070717_10305662
489 Ga0070715_10097379
490 Ga0070716_100057701
491 Ga0070712_100065080
492 Ga0068871_100372490
493 Ga0075434_100011139
494 Ga0068865_100074590
495 Ga0075436_100012136
496 Ga0097620_100000488
497 Ga0075435_100184484
498 Ga0105240_10039976
499 Ga0105240_10055581
500 Ga0105240_10138430
501 Ga0105240_10240304
502 Ga0105240_10623653
503 Ga0111539_10276041
504 Ga0105245_10042406
505 Ga0105245_10248388
506 Ga0105247_10005816
507 Ga0105247_10012300
508 Ga0114129_12389661
509 Ga0105243_10089630
510 Ga0105241_10083159
511 Ga0105241_10178703
512 Ga0105241_10437989
513 Ga0105242_10070548
514 Ga0105248_10081848
515 Ga0105248_10741595
516 Ga0105237_10009303
517 Ga0105237_10054314
518 Ga0105238_10152233
519 Ga0105238_10327156
520 Ga0105238_11365234
521 Ga0105249_10006212
522 Ga0105239_10004882
523 Ga0105239_10047165
524 Ga0105246_10040026
525 Ga0157373_10208833
526 Ga0157371_10010404
527 Ga0157370_10075803
528 Ga0157369_10090160
529 Ga0157369_10186841
530 Ga0157374_10039858
531 Ga0157378_10186832
532 Ga0163162_10049437
533 Ga0157372_10831236
534 Ga0163163_10020487
535 Ga0157380_10022768
536 Ga0157377_10059341
537 Ga0157379_10013473
538 Ga0157379_10023389
539 Ga0157376_10264701
540 Ga0163161_10020419
541 Ga0197907_10722304
542 Ga0197907_11018042
543 Ga0206356_10772927
544 Ga0206356_10817731
545 Ga0206356_11459916
546 Ga0206349_1046875
547 Ga0206349_1947930
548 Ga0206355_1006685
549 Ga0206352_10629310
550 Ga0206350_10564664
551 Ga0206354_10621990
552 Ga0206353_10867485
553 Ga0206353_11299336
554 Ga0154015_1465447
555 Ga0213876_10066773
556 Ga0224712_10039509
557 Ga0224712_10059594
558 Ga0207656_10164600
559 Ga0207653_10029817
560 Ga0207692_10134858
561 Ga0207692_10164726
562 Ga0207710_10009267
563 Ga0207710_10075312
564 Ga0207688_10000847
565 Ga0207680_10003613
566 Ga0207680_10052896
567 Ga0207647_10008440
568 Ga0207647_10023530
569 Ga0207699_10160449
570 Ga0207643_10271120
571 Ga0207654_10237391
572 Ga0207695_10056226
573 Ga0207695_10110817
574 Ga0207695_10419210
575 Ga0207671_10232816
576 Ga0207693_10018805
577 Ga0207663_10085899
578 Ga0207657_10017862
579 Ga0207681_10038387
580 Ga0207694_10097128
581 Ga0207694_10490591
582 Ga0207687_10014843
583 Ga0207687_10082159
584 Ga0207700_10045910
585 Ga0207700_10341712
586 Ga0207664_10307625
587 Ga0207664_10311732
588 Ga0207664_10578539
589 Ga0207644_10061943
590 Ga0207706_10031325
591 Ga0207669_10285910
592 Ga0207665_10019603
593 Ga0207691_10126747
594 Ga0207711_10316537
595 Ga0207711_10523261
596 Ga0207689_10010779
597 Ga0207661_10115729
598 Ga0207661_10392985
599 Ga0207679_10314280
600 Ga0207667_10062633
601 Ga0207667_10198479
602 Ga0207651_10039582
603 Ga0207712_10276709
604 Ga0207668_10067641
605 Ga0207640_10186920
606 Ga0207640_10406589
607 Ga0207658_10004382
608 Ga0207658_10008389
609 Ga0207658_10184097
610 Ga0207677_10038475
611 Ga0207703_10017686
612 Ga0207703_10083287
613 Ga0207639_10029509
614 Ga0207678_10003745
615 Ga0207708_10000004
616 Ga0207708_10122428
617 Ga0207702_10010793
618 Ga0207702_10013808
619 Ga0207702_10041867
620 Ga0207702_10403190
621 Ga0207641_10000451
622 Ga0207641_10197576
623 Ga0207648_10224826
624 Ga0207676_10243562
625 Ga0207675_100028728
626 Ga0207683_10000940
627 Ga0268266_10015394
628 Ga0268266_10182456
629 Ga0268266_10210532
630 Ga0268264_10000033
631 Ga0268264_10000138
632 Ga0268264_10075979
633 Ga0373930_0019581
634 Ga0373938_0015474
635 Ga0373929_0019078
636 Ga0373951_0014286
637 Ga0373939_0011568
638 Ga0373962_0006932
639 Ga0373931_0041166
640 Ga0436365_0937630
641 Ga0466972_0019561
642 Ga0466972_0054870
643 Ga0466972_0086069
644 Ga0466972_0087831
645 Ga0466972_0161246
646 Ga0466965_0024085
647 Ga0466966_0010299
648 Ga0466966_0021816
649 Ga0466966_0061483
650 Ga0466966_0068420
651 Ga0466966_0101599
652 Ga0466966_0183460
653 Ga0466961_0015345
654 Ga0466961_0033635
655 Ga0466961_0041757
656 Ga0466961_0056593
657 Ga0466961_0080949
658 Ga0466961_0130055
659 Ga0466961_0136834
660 Ga0466961_0192158
661 Ga0466961_0231125
662 Ga0466961_0339381
663 Ga0466961_0350144
664 Ga0466963_0006583
665 Ga0466963_0017115
666 Ga0466963_0063806
667 Ga0466963_0076352
668 Ga0466963_0110293
669 Ga0466963_0170981
670 Ga0466963_0276398
671 Ga0466963_0340277
672 Ga0466964_0011246
673 Ga0466971_0009008
674 Ga0466971_0028315
675 Ga0466971_0035398
676 Ga0466971_0285890
677 Ga0466971_0299349
678 Ga0466971_0383078
679 Ga0466968_0100756
680 Ga0466968_0343695
681 Ga0466970_0031276
682 Ga0466970_0038223
683 Ga0466970_0114878
684 Ga0466970_0142553
685 Ga0466970_0635351
686 Ga0466957_0014501
687 Ga0466957_0018785
688 Ga0466957_0047297
689 Ga0466957_0177781
690 Ga0466957_0244845
691 Ga0466957_0311340
692 Ga0466957_0354273
693 Ga0466957_0541143
694 Ga0466957_0949199
695 Ga0466960_0012065
696 Ga0466960_0092481
697 Ga0466960_0130256
698 Ga0466960_0460370
699 Ga0466959_0050654
700 Ga0466959_0051742
701 Ga0466959_0052064
702 Ga0466959_0145983
703 Ga0466959_0169589
704 Ga0466959_0208267
705 Ga0466959_0210802
706 Ga0466959_0272463
707 Ga0466959_0278265
708 Ga0466959_0289527
709 Ga0466958_0008435
710 Ga0466958_0013836
711 Ga0466958_0062762
712 Ga0466958_0160001
713 Ga0466958_0187085
714 Ga0466958_0206719
715 Ga0466967_0000506
716 Ga0466967_0004805
717 Ga0466967_0007054
718 Ga0466967_0010956
719 Ga0466967_0022203
720 Ga0466967_0041369
721 Ga0466967_0105131
722 Ga0466967_0157740
723 Ga0466967_0162177
724 Ga0466967_0224179
725 Ga0466967_0227902
726 Ga0466967_0281763
727 Ga0466967_0301266
728 Ga0466967_0326802
729 Ga0466967_0330819
730 Ga0466967_0493793
731 Ga0466967_0697443
732 Ga0466967_0865364
733 Ga0466967_0874360
734 Ga0466967_0977931
735 Ga0466967_1310350
736 Ga0495603_0045049
737 Ga0495641_0192581
738 Ga0495653_0216229
739 Ga0495647_0126137
740 Ga0495624_0113974
741 Ga0496100_0133389
742 Ga0496101_0347402
743 Ga0496102_0000013
744 Ga0496102_0000558
745 Ga0496102_0166172
746 Ga0496102_0234604
747 Ga0496103_0001975
748 Ga0496103_0033008
749 Ga0496103_0070745
750 Ga0496104_0248284
751 Ga0496104_0316719
752 Ga0496105_0064573
753 Ga0496105_0104714
754 Ga0496106_0214383
755 Ga0496107_0074083
756 Ga0496108_0061132
757 Ga0496108_0553528
758 Ga0496108_0739873
759 Ga0496109_0006408
760 Ga0496109_0032793
761 Ga0496110_0011028
762 Ga0496110_0037212
763 Ga0496112_0133982
764 Ga0496112_0139474
765 Ga0496112_0561763
766 Ga0496113_0103388
767 Ga0496113_0183876
768 Ga0496114_0035270
769 Ga0496114_0479824
770 Ga0496115_0121627
771 Ga0496115_0346437
772 Ga0496117_0109883
773 Ga0496118_0015526
774 Ga0496119_0000022
775 Ga0496119_0082164
776 Ga0496119_0269612
777 Ga0496120_0001243
778 Ga0496121_0019256
779 Ga0496126_0932694
780 Ga0501031_0027431
781 Ga0501033_0159125
782 Ga0501034_0134483
783 Ga0501036_0191871
784 Ga0501037_0083068
785 Ga0501038_0001534
786 Ga0501039_1028759
787 Ga0501043_0007513
788 Ga0501047_0127012
789 Ga0501048_0000557
790 Ga0501067_0193608
791 Ga0501070_0032772
792 Ga0501074_0598779
793 Ga0501081_0113210
794 Ga0501035_0020003
795 Ga0501044_0104114
796 nmdc:mga08y16_384187_c1
797 Ga0500658_0334799
798 Ga0587083_0011971
799 Ga0587106_022349
800 Ga0587071_042996
801 Ga0466962_0025120
802 Ga0466962_0050075
803 Ga0466962_0075806
804 Ga0466962_0108529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

28

107

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zs8-assembly1.cif.gz_C s. cerevisiae get3 complexed with a cytosolic get1 fragment 0.9343 119 179
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9312 112 175
2r9i-assembly1.cif.gz_A crystal structure of putative phage capsid protein domain from corynebacterium diphtheriae 0.9305 116 179
4l0r-assembly1.cif.gz_A crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a. 0.9284 112 179
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9261 112 180
ID Description Score Start End Superfamily
af_O14147_194_423_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9976 123 164 3.40.50.300
af_P22516_200_453_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9715 126 163 3.40.50.300
af_B5DEF8_24_120_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9459 112 176 1.10.287.1060
af_Q86KU2_937_1072_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9432 110 177 3.30.300.20
af_Q9H160_25_121_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9391 112 176 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A6P1P1L4-F1-model_v4 Uncharacterized protein 0.963 110 183
AF-A0A6P1P1L4-F1-model_v4 Uncharacterized protein 0.9506 110 183
AF-A0A2B7X0A8-F1-model_v4 Uncharacterized protein 0.9309 112 187
AF-A0A364L1Z0-F1-model_v4 Uncharacterized protein 0.9248 112 188
AF-A0A2A5DYA8-F1-model_v4 PadR family transcriptional regulator 0.9098 2 85

Map