F435167

General Info

Members Datasets Scaffolds Average Seq Length
402 211 804 379

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0109638|Ga0466967_0109638_11_1285
Length 424
Sequence LIIDTAPGTGEDQTLSARPPGQPLASGKEDVQMKKAIALAIAVLTTSVVAASAQGSQTVAAKATAGYSCSKTISIPFITPITGGAGFLGAEQMSWAKYAAKTLAPGLGLKVKIVGEDTPVEQGATPANAVAQKVIGDSSVLAVLGPSTSGDVAATAKVLYAAHLAHISPSATRTDFTQGANKEEYPTFFRDVPGDYIQGPTDANFMIKSLHVKKVVIMDFQEPYSLGLASSVDAILKKAGVSTTRLSAPNTTTDYSAYVTKVPSDADIVFFPTQKPGDAQTFAQQLIEQGKKAKVFGGDGSNDATQFKQPGSYVSNFAPDITGIAADAKIIAGWKKDNPGKSVGSFGPPSYGATQILLNAIKIACTKGHGTATRQAVLQNVKKVSIKNWILGGSFKWSTKSNDPLNAKFYIFQIQSNGSYKLVG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 7.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 9.2
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0109638 3300045976 Bacteria 2534
2 JGI24738J21930_10004132 3300002075 Bacteria 3579
3 JGI24744J21845_10005489 3300002077 Bacteria 2623
4 JGI25406J46586_10004830 3300003203 Bacteria 6264
5 Ga0058863_11936791 3300004799 Bacteria 1336
6 Ga0070658_10038098 3300005327 Bacteria 3877
7 Ga0070658_10047840 3300005327 Bacteria 3461
8 Ga0070658_10076811 3300005327 Bacteria 2739
9 Ga0070658_10083968 3300005327 Bacteria 2618
10 Ga0070658_10148583 3300005327 Bacteria 1961
11 Ga0070683_100023548 3300005329 Bacteria 5508
12 Ga0070683_100025751 3300005329 Bacteria 5288
13 Ga0070683_100040067 3300005329 Bacteria 4304
14 Ga0070683_100073668 3300005329 Bacteria 3189
15 Ga0070680_100008014 3300005336 Bacteria 8065
16 Ga0070680_100013384 3300005336 Bacteria 6388
17 Ga0070682_100051676 3300005337 Bacteria 2569
18 Ga0070660_100002826 3300005339 Bacteria 11944
19 Ga0070660_100007655 3300005339 Bacteria 7526
20 Ga0070660_100030388 3300005339 Bacteria 4053
21 Ga0070660_100030832 3300005339 Bacteria 4024
22 Ga0070660_100055583 3300005339 Bacteria 3059
23 Ga0070660_100085553 3300005339 Bacteria 2480
24 Ga0070661_100004607 3300005344 Bacteria 9484
25 Ga0070692_10034512 3300005345 Bacteria 2556
26 Ga0070675_100197455 3300005354 Bacteria 1745
27 Ga0070673_100015066 3300005364 Bacteria 5413
28 Ga0070688_100019551 3300005365 Bacteria 3925
29 Ga0070659_100029691 3300005366 Bacteria 4226
30 Ga0070659_100036226 3300005366 Bacteria 3845
31 Ga0070659_100052269 3300005366 Bacteria 3213
32 Ga0070714_100132362 3300005435 Unclassified 2230
33 Ga0070714_100191036 3300005435 Bacteria 1869
34 Ga0070701_10012138 3300005438 Bacteria 3876
35 Ga0070700_100055167 3300005441 Bacteria 2486
36 Ga0070708_100366486 3300005445 Bacteria 1358
37 Ga0070678_100177036 3300005456 Bacteria 1742
38 Ga0070681_10001806 3300005458 Bacteria 19256
39 Ga0070681_10037121 3300005458 Bacteria 4890
40 Ga0070681_10141384 3300005458 Bacteria 2336
41 Ga0070685_10022835 3300005466 Bacteria 3416
42 Ga0070698_100095008 3300005471 Bacteria 2959
43 Ga0070679_100042626 3300005530 Bacteria 4520
44 Ga0070679_100091574 3300005530 Bacteria 3029
45 Ga0070679_100113850 3300005530 Bacteria 2690
46 Ga0070679_100151149 3300005530 Bacteria 2298
47 Ga0070679_100341731 3300005530 Bacteria 1445
48 Ga0070684_100023124 3300005535 Bacteria 5192
49 Ga0070684_100046926 3300005535 Bacteria 3744
50 Ga0070665_100032946 3300005548 Bacteria 5212
51 Ga0068855_100144982 3300005563 Bacteria 2704
52 Ga0068857_100031395 3300005577 Bacteria 4694
53 Ga0068857_100098698 3300005577 Bacteria 2619
54 Ga0068854_100055621 3300005578 Bacteria 2849
55 Ga0068854_100116204 3300005578 Bacteria 2025
56 Ga0068856_100076281 3300005614 Bacteria 3321
57 Ga0068856_100077590 3300005614 Bacteria 3292
58 Ga0068856_100114319 3300005614 Bacteria 2698
59 Ga0068852_100140427 3300005616 Bacteria 2235
60 Ga0068852_100147158 3300005616 Bacteria 2186
61 Ga0068866_10039875 3300005718 Bacteria 2321
62 Ga0081455_10011261 3300005937 Bacteria 9000
63 Ga0081455_10015736 3300005937 Bacteria 7328
64 Ga0081455_10034324 3300005937 Bacteria 4547
65 Ga0081539_10002592 3300005985 Bacteria 24830
66 Ga0075433_10090781 3300006852 Bacteria 2700
67 Ga0075433_10154301 3300006852 Bacteria 2043
68 Ga0075434_100095863 3300006871 Bacteria 2972
69 Ga0075436_100201762 3300006914 Bacteria 1409
70 Ga0075435_100065816 3300007076 Bacteria 2947
71 Ga0105240_10057645 3300009093 Bacteria 4851
72 Ga0105240_10199775 3300009093 Bacteria 2344
73 Ga0105240_10300898 3300009093 Bacteria 1835
74 Ga0111539_10065119 3300009094 Bacteria 4308
75 Ga0105245_10063166 3300009098 Bacteria 3343
76 Ga0114129_10405918 3300009147 Bacteria 1795
77 Ga0114129_10511109 3300009147 Bacteria 1567
78 Ga0105237_10087264 3300009545 Bacteria 3109
79 Ga0105238_10056100 3300009551 Bacteria 3952
80 Ga0105239_10011990 3300010375 Bacteria 9666
81 Ga0157373_10117788 3300013100 Bacteria 1867
82 Ga0157371_10030469 3300013102 Bacteria 3892
83 Ga0157371_10107642 3300013102 Bacteria 1978
84 Ga0157370_10014605 3300013104 Bacteria 8024
85 Ga0157370_10029284 3300013104 Bacteria 5407
86 Ga0157370_10046783 3300013104 Bacteria 4148
87 Ga0157370_10149252 3300013104 Bacteria 2176
88 Ga0157370_10168090 3300013104 Bacteria 2039
89 Ga0157370_10297915 3300013104 Unclassified 1489
90 Ga0157369_10004734 3300013105 Bacteria 15988
91 Ga0157369_10020607 3300013105 Bacteria 7372
92 Ga0157369_10037692 3300013105 Bacteria 5291
93 Ga0157369_10083217 3300013105 Bacteria 3423
94 Ga0157374_10064180 3300013296 Bacteria 3445
95 Ga0157374_10224316 3300013296 Bacteria 1845
96 Ga0157372_10101999 3300013307 Bacteria 3277
97 Ga0157372_10152560 3300013307 Bacteria 2667
98 Ga0157372_10356708 3300013307 Bacteria 1704
99 Ga0157375_10298897 3300013308 Bacteria 1773
100 Ga0157377_10071605 3300014745 Bacteria 2005
101 Ga0157379_10178494 3300014968 Bacteria 1918
102 Ga0157376_10091860 3300014969 Bacteria 2630
103 Ga0157376_10193987 3300014969 Bacteria 1864
104 Ga0197907_10244264 3300020069 Bacteria 1994
105 Ga0197907_10430674 3300020069 Bacteria 2721
106 Ga0206356_10377777 3300020070 Bacteria 1305
107 Ga0206356_10737765 3300020070 Bacteria 2672
108 Ga0206356_11101243 3300020070 Bacteria 1326
109 Ga0206356_11238675 3300020070 Bacteria 1707
110 Ga0206355_1026748 3300020076 Bacteria 1523
111 Ga0206355_1214440 3300020076 Bacteria 1314
112 Ga0206351_10230554 3300020077 Bacteria 1415
113 Ga0206352_10084138 3300020078 Bacteria 1263
114 Ga0206352_10632641 3300020078 Bacteria 1381
115 Ga0206352_11092446 3300020078 Bacteria 1278
116 Ga0206350_11320576 3300020080 Bacteria 1398
117 Ga0206354_10760412 3300020081 Bacteria 2747
118 Ga0206354_11365079 3300020081 Bacteria 1280
119 Ga0206354_11686157 3300020081 Bacteria 2184
120 Ga0206353_10260858 3300020082 Bacteria 7633
121 Ga0206353_10337222 3300020082 Bacteria 1263
122 Ga0154015_1594196 3300020610 Bacteria 1413
123 Ga0224712_10079484 3300022467 Bacteria 1350
124 Ga0224712_10083337 3300022467 Unclassified 1325
125 Ga0207656_10064609 3300025321 Bacteria 1613
126 Ga0207680_10046356 3300025903 Bacteria 2569
127 Ga0207647_10024439 3300025904 Bacteria 3983
128 Ga0207645_10022025 3300025907 Bacteria 4150
129 Ga0207705_10024185 3300025909 Bacteria 4335
130 Ga0207705_10119278 3300025909 Bacteria 1956
131 Ga0207705_10131750 3300025909 Bacteria 1861
132 Ga0207705_10174699 3300025909 Bacteria 1619
133 Ga0207707_10004043 3300025912 Bacteria 13003
134 Ga0207707_10018280 3300025912 Bacteria 6112
135 Ga0207707_10022322 3300025912 Bacteria 5533
136 Ga0207707_10095962 3300025912 Bacteria 2591
137 Ga0207695_10285114 3300025913 Bacteria 1545
138 Ga0207671_10063375 3300025914 Bacteria 2747
139 Ga0207660_10051529 3300025917 Bacteria 2926
140 Ga0207657_10001151 3300025919 Bacteria 28127
141 Ga0207657_10061032 3300025919 Bacteria 3235
142 Ga0207657_10087087 3300025919 Bacteria 2613
143 Ga0207649_10075738 3300025920 Bacteria 2163
144 Ga0207652_10001450 3300025921 Bacteria 20983
145 Ga0207652_10081350 3300025921 Bacteria 2833
146 Ga0207652_10121479 3300025921 Bacteria 2324
147 Ga0207652_10151441 3300025921 Bacteria 2077
148 Ga0207652_10157883 3300025921 Bacteria 2032
149 Ga0207694_10238399 3300025924 Unclassified 1486
150 Ga0207664_10005211 3300025929 Bacteria 8864
151 Ga0207664_10189415 3300025929 Unclassified 1770
152 Ga0207644_10138841 3300025931 Bacteria 1869
153 Ga0207690_10011553 3300025932 Bacteria 5274
154 Ga0207709_10049021 3300025935 Bacteria 2576
155 Ga0207709_10100844 3300025935 Bacteria 1908
156 Ga0207669_10002637 3300025937 Bacteria 7684
157 Ga0207689_10037947 3300025942 Bacteria 3993
158 Ga0207661_10025262 3300025944 Bacteria 4513
159 Ga0207661_10035207 3300025944 Bacteria 3899
160 Ga0207661_10138093 3300025944 Bacteria 2095
161 Ga0207661_10158717 3300025944 Bacteria 1961
162 Ga0207661_10190520 3300025944 Bacteria 1797
163 Ga0207661_10212621 3300025944 Bacteria 1705
164 Ga0207661_10301462 3300025944 Bacteria 1437
165 Ga0207667_10052763 3300025949 Bacteria 4280
166 Ga0207667_10085275 3300025949 Bacteria 3270
167 Ga0207667_10130456 3300025949 Bacteria 2589
168 Ga0207667_10247387 3300025949 Bacteria 1824
169 Ga0207640_10011096 3300025981 Bacteria 5091
170 Ga0207640_10024516 3300025981 Bacteria 3640
171 Ga0207677_10182098 3300026023 Bacteria 1654
172 Ga0207678_10143613 3300026067 Bacteria 2037
173 Ga0207708_10155679 3300026075 Bacteria 1802
174 Ga0207702_10035121 3300026078 Bacteria 4192
175 Ga0207702_10038215 3300026078 Bacteria 4020
176 Ga0207702_10109408 3300026078 Bacteria 2454
177 Ga0207648_10115517 3300026089 Bacteria 2359
178 Ga0207674_10005625 3300026116 Bacteria 14858
179 Ga0207674_10039975 3300026116 Bacteria 4860
180 Ga0207674_10128213 3300026116 Bacteria 2501
181 Ga0207683_10111615 3300026121 Bacteria 2448
182 Ga0207683_10178482 3300026121 Bacteria 1925
183 Ga0207698_10171840 3300026142 Bacteria 1909
184 Ga0207428_10047712 3300027907 Bacteria 3438
185 Ga0207428_10049785 3300027907 Bacteria 3355
186 Ga0268266_10029800 3300028379 Bacteria 4637
187 Ga0268264_10118124 3300028381 Bacteria 2333
188 Ga0265319_1025601 3300028563 Bacteria 2110
189 Ga0265318_10003907 3300028577 Bacteria 7345
190 Ga0265318_10006487 3300028577 Bacteria 5383
191 Ga0265318_10042130 3300028577 Bacteria 1733
192 Ga0265322_10002883 3300028654 Bacteria 5241
193 Ga0265322_10024941 3300028654 Unclassified 1711
194 Ga0265338_10072328 3300028800 Bacteria 2944
195 Ga0265320_10014804 3300031240 Bacteria 4425
196 Ga0265325_10050496 3300031241 Bacteria 2142
197 Ga0265339_10014529 3300031249 Bacteria 4743
198 Ga0265327_10016698 3300031251 Bacteria 4645
199 Ga0265316_10222409 3300031344 Bacteria 1392
200 Ga0265314_10016668 3300031711 Bacteria 5793
201 Ga0265314_10147896 3300031711 Unclassified 1444
202 Ga0265342_10110589 3300031712 Unclassified 1555
203 Ga0373939_0013172 3300035114 Bacteria 2123
204 Ga0395899_0015762 3300037312 Bacteria 5762
205 Ga0395900_0085134 3300037418 Bacteria 3249
206 Ga0395900_0088488 3300037418 Bacteria 3184
207 Ga0395900_0102884 3300037418 Bacteria 2934
208 Ga0395900_0347698 3300037418 Bacteria 1457
209 Ga0395898_0009383 3300037466 Bacteria 10276
210 Ga0395898_0032239 3300037466 Bacteria 5229
211 Ga0395898_0063303 3300037466 Bacteria 3589
212 Ga0395898_0127425 3300037466 Bacteria 2439
213 Ga0395905_0012290 3300037471 Bacteria 8244
214 Ga0395905_0073594 3300037471 Bacteria 3203
215 Ga0395901_0011415 3300038443 Bacteria 8999
216 Ga0395901_0021598 3300038443 Bacteria 6595
217 Ga0395901_0026324 3300038443 Bacteria 5972
218 Ga0395901_0042760 3300038443 Bacteria 4699
219 Ga0395901_0133311 3300038443 Unclassified 2611
220 Ga0395901_0140387 3300038443 Unclassified 2539
221 Ga0395901_0328640 3300038443 Bacteria 1581
222 Ga0439438_014966 3300041405 Bacteria 2296
223 Ga0439446_0005348 3300042156 Bacteria 3300
224 Ga0439434_0014754 3300042435 Bacteria 2326
225 Ga0466966_0024229 3300044684 Bacteria 3971
226 Ga0466963_0001167 3300044694 Bacteria 13776
227 Ga0466963_0086506 3300044694 Bacteria 2130
228 Ga0466964_0072047 3300044706 Unclassified 1463
229 Ga0466971_0044381 3300044719 Bacteria 1996
230 Ga0466957_0118981 3300044842 Bacteria 1682
231 Ga0466967_0000875 3300045976 Bacteria 16035
232 Ga0466967_0004272 3300045976 Bacteria 9602
233 Ga0466967_0016236 3300045976 Bacteria 5863
234 Ga0466967_0024515 3300045976 Bacteria 4961
235 Ga0466967_0107812 3300045976 Bacteria 2555
236 Ga0466967_0147642 3300045976 Bacteria 2194
237 Ga0495592_0151062 3300046454 Unclassified 1606
238 Ga0495651_0003640 3300046462 Bacteria 11802
239 Ga0495639_0039827 3300046475 Bacteria 2114
240 Ga0495664_0250073 3300046477 Bacteria 1072
241 Ga0495584_0118479 3300046491 Bacteria 1341
242 Ga0495608_0010517 3300046511 Bacteria 6457
243 Ga0495618_0083318 3300046514 Bacteria 2043
244 Ga0495628_0020004 3300046516 Bacteria 5528
245 Ga0495652_0163445 3300046529 Bacteria 1725
246 Ga0495640_0140914 3300046533 Bacteria 1554
247 Ga0495667_0001323 3300046559 Bacteria 16271
248 Ga0495667_0133086 3300046559 Unclassified 1604
249 Ga0495634_0048046 3300046642 Bacteria 2874
250 Ga0495634_0086118 3300046642 Bacteria 2047
251 Ga0495635_0031990 3300046663 Bacteria 3651
252 Ga0495613_0078914 3300046689 Bacteria 2394
253 Ga0495624_0072150 3300046690 Bacteria 2148
254 Ga0495604_0023547 3300047317 Bacteria 4913
255 Ga0495674_0004916 3300047319 Bacteria 12850
256 Ga0495676_0106566 3300047321 Bacteria 2065
257 Ga0495680_0001597 3300047322 Bacteria 24161
258 Ga0495684_0068581 3300047471 Bacteria 2697
259 Ga0495602_0037190 3300048088 Bacteria 4521
260 Ga0496100_0020301 3300048903 Bacteria 3980
261 Ga0496100_0064601 3300048903 Bacteria 2422
262 Ga0496101_0002073 3300048904 Bacteria 12209
263 Ga0496101_0009845 3300048904 Bacteria 6296
264 Ga0496102_0022673 3300048905 Bacteria 5564
265 Ga0496102_0092438 3300048905 Bacteria 2801
266 Ga0496104_0024450 3300048907 Bacteria 5556
267 Ga0496105_0036650 3300048908 Bacteria 4041
268 Ga0496105_0042486 3300048908 Bacteria 3747
269 Ga0496105_0052285 3300048908 Bacteria 3374
270 Ga0496105_0070333 3300048908 Bacteria 2893
271 Ga0496105_0178433 3300048908 Bacteria 1740
272 Ga0496106_0028308 3300048909 Bacteria 4173
273 Ga0496107_0045391 3300048910 Bacteria 3161
274 Ga0496108_0000633 3300048911 Bacteria 27456
275 Ga0496108_0033455 3300048911 Bacteria 4271
276 Ga0496109_0019618 3300048912 Bacteria 5965
277 Ga0496109_0075847 3300048912 Bacteria 3091
278 Ga0496110_0024128 3300048913 Bacteria 5181
279 Ga0496110_0068280 3300048913 Bacteria 3146
280 Ga0496110_0108401 3300048913 Bacteria 2493
281 Ga0496110_0219358 3300048913 Bacteria 1729
282 Ga0496111_0009822 3300048914 Bacteria 6396
283 Ga0496111_0092146 3300048914 Bacteria 2221
284 Ga0496111_0128104 3300048914 Bacteria 1877
285 Ga0496112_0019584 3300048915 Bacteria 6390
286 Ga0496112_0040618 3300048915 Bacteria 4549
287 Ga0496112_0136667 3300048915 Bacteria 2421
288 Ga0496112_0303568 3300048915 Bacteria 1542
289 Ga0496113_0002470 3300048916 Bacteria 10768
290 Ga0496113_0032575 3300048916 Bacteria 3788
291 Ga0496114_0032037 3300048917 Bacteria 4325
292 Ga0496114_0047528 3300048917 Bacteria 3569
293 Ga0496114_0119858 3300048917 Bacteria 2262
294 Ga0496114_0276830 3300048917 Bacteria 1479
295 Ga0496114_0329158 3300048917 Bacteria 1350
296 Ga0496115_0159714 3300048918 Bacteria 1863
297 Ga0501031_0001126 3300049568 Bacteria 16256
298 Ga0501031_0009165 3300049568 Bacteria 6435
299 Ga0501031_0016507 3300049568 Bacteria 4796
300 Ga0501032_0034923 3300049569 Bacteria 3438
301 Ga0501033_0020905 3300049570 Bacteria 4940
302 Ga0501034_0141025 3300049571 Bacteria 2390
303 Ga0501036_0034445 3300049572 Bacteria 4283
304 Ga0501036_0034991 3300049572 Bacteria 4248
305 Ga0501036_0094426 3300049572 Bacteria 2528
306 Ga0501037_0026818 3300049573 Bacteria 4256
307 Ga0501037_0105668 3300049573 Bacteria 2029
308 Ga0501038_0007582 3300049574 Bacteria 10007
309 Ga0501038_0037945 3300049574 Bacteria 4220
310 Ga0501038_0095428 3300049574 Bacteria 2484
311 Ga0501039_0007527 3300049575 Bacteria 8319
312 Ga0501039_0015878 3300049575 Bacteria 5765
313 Ga0501040_0005992 3300049576 Bacteria 7868
314 Ga0501040_0018067 3300049576 Bacteria 4683
315 Ga0501040_0042109 3300049576 Bacteria 3110
316 Ga0501041_0086893 3300049577 Bacteria 1929
317 Ga0501041_0104772 3300049577 Bacteria 1752
318 Ga0501042_0003081 3300049578 Bacteria 10376
319 Ga0501042_0048802 3300049578 Bacteria 3018
320 Ga0501042_0055683 3300049578 Bacteria 2822
321 Ga0501043_0010181 3300049579 Bacteria 7370
322 Ga0501043_0018305 3300049579 Bacteria 5493
323 Ga0501046_0005113 3300049580 Bacteria 11768
324 Ga0501046_0052737 3300049580 Bacteria 3204
325 Ga0501046_0088627 3300049580 Bacteria 2383
326 Ga0501047_0013261 3300049581 Bacteria 7807
327 Ga0501047_0043265 3300049581 Bacteria 4350
328 Ga0501048_0008622 3300049582 Bacteria 7697
329 Ga0501048_0019014 3300049582 Bacteria 5047
330 Ga0501048_0057177 3300049582 Bacteria 2766
331 Ga0501067_0025086 3300049583 Bacteria 3306
332 Ga0501067_0168485 3300049583 Bacteria 1220
333 Ga0501068_0005792 3300049584 Bacteria 6777
334 Ga0501068_0046882 3300049584 Bacteria 2606
335 Ga0501068_0097056 3300049584 Bacteria 1823
336 Ga0501069_0001599 3300049585 Bacteria 11206
337 Ga0501069_0002349 3300049585 Bacteria 9583
338 Ga0501069_0049680 3300049585 Bacteria 2331
339 Ga0501070_0010373 3300049586 Bacteria 7877
340 Ga0501070_0047040 3300049586 Bacteria 3587
341 Ga0501070_0120656 3300049586 Bacteria 2167
342 Ga0501070_0159825 3300049586 Unclassified 1858
343 Ga0501071_0013380 3300049587 Bacteria 5589
344 Ga0501071_0018331 3300049587 Bacteria 4844
345 Ga0501071_0021078 3300049587 Bacteria 4537
346 Ga0501072_0003294 3300049588 Bacteria 12148
347 Ga0501072_0008781 3300049588 Bacteria 7672
348 Ga0501072_0017584 3300049588 Bacteria 5497
349 Ga0501073_0027837 3300049589 Bacteria 4039
350 Ga0501073_0054600 3300049589 Bacteria 2796
351 Ga0501074_0014134 3300049590 Bacteria 5804
352 Ga0501074_0023703 3300049590 Bacteria 4460
353 Ga0501074_0034871 3300049590 Bacteria 3647
354 Ga0501074_0067196 3300049590 Bacteria 2578
355 Ga0501074_0219689 3300049590 Unclassified 1353
356 Ga0501075_0043678 3300049591 Bacteria 3361
357 Ga0501075_0065396 3300049591 Bacteria 2743
358 Ga0501075_0104535 3300049591 Bacteria 2152
359 Ga0501076_0012182 3300049592 Bacteria 6429
360 Ga0501076_0022319 3300049592 Bacteria 4864
361 Ga0501077_0011884 3300049593 Bacteria 5445
362 Ga0501077_0031601 3300049593 Bacteria 3369
363 Ga0501077_0038054 3300049593 Bacteria 3062
364 Ga0501077_0110607 3300049593 Bacteria 1741
365 Ga0501079_0010867 3300049741 Bacteria 6933
366 Ga0501079_0014488 3300049741 Bacteria 6012
367 Ga0501080_0011982 3300049742 Bacteria 7943
368 Ga0501080_0018562 3300049742 Bacteria 6436
369 Ga0501080_0030219 3300049742 Bacteria 5047
370 Ga0501080_0053240 3300049742 Bacteria 3767
371 Ga0501081_0004739 3300049743 Bacteria 8746
372 Ga0501081_0017079 3300049743 Bacteria 4798
373 Ga0501081_0133302 3300049743 Bacteria 1776
374 Ga0501083_0007452 3300049744 Bacteria 7755
375 Ga0501035_0012352 3300049822 Bacteria 7894
376 Ga0501045_0006143 3300049824 Bacteria 8322
377 Ga0501045_0007953 3300049824 Bacteria 7385
378 nmdc:mga0yw44_35413_c1 3300050492 Bacteria 2933
379 nmdc:mga05p37_389850_c1 3300050507 Bacteria 1629
380 nmdc:mga08y16_56857_c1 3300050511 Bacteria 4088
381 nmdc:mga0rr50_17963_c1 3300050513 Bacteria 4738
382 nmdc:mga08x19_39099_c1 3300050514 Bacteria 3015
383 nmdc:mga0a205_12284_c1 3300050515 Bacteria 7920
384 Ga0495595_0042876 3300053084 Bacteria 2074
385 Ga0495595_0044483 3300053084 Bacteria 2040
386 Ga0495619_0099879 3300053085 Bacteria 1974
387 Ga0501084_0042517 3300054114 Bacteria 3801
388 Ga0501084_0059982 3300054114 Bacteria 3185
389 Ga0501084_0100116 3300054114 Bacteria 2433
390 Ga0587066_010720 3300059490 Unclassified 1328
391 Ga0587083_0018532 3300059505 Bacteria 1260
392 Ga0587109_017047 3300059624 Unclassified 1252
393 Ga0587062_006968 3300059639 Unclassified 1303
394 Ga0587068_014264 3300059641 Unclassified 1236
395 Ga0587069_008857 3300059642 Bacteria 1284
396 Ga0587079_015786 3300059647 Unclassified 1288
397 Ga0501082_0012712 3300060353 Bacteria 7234
398 Ga0501082_0025388 3300060353 Bacteria 5106
399 Ga0501082_0039184 3300060353 Bacteria 4089
400 Ga0466962_0015609 3300061719 Bacteria 3662
401 Ga0530510_0011463 3300061734 Bacteria 6219
402 Ga0530510_0019701 3300061734 Bacteria 4790
403 Ga0466967_0109638
404 JGI24738J21930_10004132
405 JGI24744J21845_10005489
406 JGI25406J46586_10004830
407 Ga0058863_11936791
408 Ga0070658_10038098
409 Ga0070658_10047840
410 Ga0070658_10076811
411 Ga0070658_10083968
412 Ga0070658_10148583
413 Ga0070683_100023548
414 Ga0070683_100025751
415 Ga0070683_100040067
416 Ga0070683_100073668
417 Ga0070680_100008014
418 Ga0070680_100013384
419 Ga0070682_100051676
420 Ga0070660_100002826
421 Ga0070660_100007655
422 Ga0070660_100030388
423 Ga0070660_100030832
424 Ga0070660_100055583
425 Ga0070660_100085553
426 Ga0070661_100004607
427 Ga0070692_10034512
428 Ga0070675_100197455
429 Ga0070673_100015066
430 Ga0070688_100019551
431 Ga0070659_100029691
432 Ga0070659_100036226
433 Ga0070659_100052269
434 Ga0070714_100132362
435 Ga0070714_100191036
436 Ga0070701_10012138
437 Ga0070700_100055167
438 Ga0070708_100366486
439 Ga0070678_100177036
440 Ga0070681_10001806
441 Ga0070681_10037121
442 Ga0070681_10141384
443 Ga0070685_10022835
444 Ga0070698_100095008
445 Ga0070679_100042626
446 Ga0070679_100091574
447 Ga0070679_100113850
448 Ga0070679_100151149
449 Ga0070679_100341731
450 Ga0070684_100023124
451 Ga0070684_100046926
452 Ga0070665_100032946
453 Ga0068855_100144982
454 Ga0068857_100031395
455 Ga0068857_100098698
456 Ga0068854_100055621
457 Ga0068854_100116204
458 Ga0068856_100076281
459 Ga0068856_100077590
460 Ga0068856_100114319
461 Ga0068852_100140427
462 Ga0068852_100147158
463 Ga0068866_10039875
464 Ga0081455_10011261
465 Ga0081455_10015736
466 Ga0081455_10034324
467 Ga0081539_10002592
468 Ga0075433_10090781
469 Ga0075433_10154301
470 Ga0075434_100095863
471 Ga0075436_100201762
472 Ga0075435_100065816
473 Ga0105240_10057645
474 Ga0105240_10199775
475 Ga0105240_10300898
476 Ga0111539_10065119
477 Ga0105245_10063166
478 Ga0114129_10405918
479 Ga0114129_10511109
480 Ga0105237_10087264
481 Ga0105238_10056100
482 Ga0105239_10011990
483 Ga0157373_10117788
484 Ga0157371_10030469
485 Ga0157371_10107642
486 Ga0157370_10014605
487 Ga0157370_10029284
488 Ga0157370_10046783
489 Ga0157370_10149252
490 Ga0157370_10168090
491 Ga0157370_10297915
492 Ga0157369_10004734
493 Ga0157369_10020607
494 Ga0157369_10037692
495 Ga0157369_10083217
496 Ga0157374_10064180
497 Ga0157374_10224316
498 Ga0157372_10101999
499 Ga0157372_10152560
500 Ga0157372_10356708
501 Ga0157375_10298897
502 Ga0157377_10071605
503 Ga0157379_10178494
504 Ga0157376_10091860
505 Ga0157376_10193987
506 Ga0197907_10244264
507 Ga0197907_10430674
508 Ga0206356_10377777
509 Ga0206356_10737765
510 Ga0206356_11101243
511 Ga0206356_11238675
512 Ga0206355_1026748
513 Ga0206355_1214440
514 Ga0206351_10230554
515 Ga0206352_10084138
516 Ga0206352_10632641
517 Ga0206352_11092446
518 Ga0206350_11320576
519 Ga0206354_10760412
520 Ga0206354_11365079
521 Ga0206354_11686157
522 Ga0206353_10260858
523 Ga0206353_10337222
524 Ga0154015_1594196
525 Ga0224712_10079484
526 Ga0224712_10083337
527 Ga0207656_10064609
528 Ga0207680_10046356
529 Ga0207647_10024439
530 Ga0207645_10022025
531 Ga0207705_10024185
532 Ga0207705_10119278
533 Ga0207705_10131750
534 Ga0207705_10174699
535 Ga0207707_10004043
536 Ga0207707_10018280
537 Ga0207707_10022322
538 Ga0207707_10095962
539 Ga0207695_10285114
540 Ga0207671_10063375
541 Ga0207660_10051529
542 Ga0207657_10001151
543 Ga0207657_10061032
544 Ga0207657_10087087
545 Ga0207649_10075738
546 Ga0207652_10001450
547 Ga0207652_10081350
548 Ga0207652_10121479
549 Ga0207652_10151441
550 Ga0207652_10157883
551 Ga0207694_10238399
552 Ga0207664_10005211
553 Ga0207664_10189415
554 Ga0207644_10138841
555 Ga0207690_10011553
556 Ga0207709_10049021
557 Ga0207709_10100844
558 Ga0207669_10002637
559 Ga0207689_10037947
560 Ga0207661_10025262
561 Ga0207661_10035207
562 Ga0207661_10138093
563 Ga0207661_10158717
564 Ga0207661_10190520
565 Ga0207661_10212621
566 Ga0207661_10301462
567 Ga0207667_10052763
568 Ga0207667_10085275
569 Ga0207667_10130456
570 Ga0207667_10247387
571 Ga0207640_10011096
572 Ga0207640_10024516
573 Ga0207677_10182098
574 Ga0207678_10143613
575 Ga0207708_10155679
576 Ga0207702_10035121
577 Ga0207702_10038215
578 Ga0207702_10109408
579 Ga0207648_10115517
580 Ga0207674_10005625
581 Ga0207674_10039975
582 Ga0207674_10128213
583 Ga0207683_10111615
584 Ga0207683_10178482
585 Ga0207698_10171840
586 Ga0207428_10047712
587 Ga0207428_10049785
588 Ga0268266_10029800
589 Ga0268264_10118124
590 Ga0265319_1025601
591 Ga0265318_10003907
592 Ga0265318_10006487
593 Ga0265318_10042130
594 Ga0265322_10002883
595 Ga0265322_10024941
596 Ga0265338_10072328
597 Ga0265320_10014804
598 Ga0265325_10050496
599 Ga0265339_10014529
600 Ga0265327_10016698
601 Ga0265316_10222409
602 Ga0265314_10016668
603 Ga0265314_10147896
604 Ga0265342_10110589
605 Ga0373939_0013172
606 Ga0395899_0015762
607 Ga0395900_0085134
608 Ga0395900_0088488
609 Ga0395900_0102884
610 Ga0395900_0347698
611 Ga0395898_0009383
612 Ga0395898_0032239
613 Ga0395898_0063303
614 Ga0395898_0127425
615 Ga0395905_0012290
616 Ga0395905_0073594
617 Ga0395901_0011415
618 Ga0395901_0021598
619 Ga0395901_0026324
620 Ga0395901_0042760
621 Ga0395901_0133311
622 Ga0395901_0140387
623 Ga0395901_0328640
624 Ga0439438_014966
625 Ga0439446_0005348
626 Ga0439434_0014754
627 Ga0466966_0024229
628 Ga0466963_0001167
629 Ga0466963_0086506
630 Ga0466964_0072047
631 Ga0466971_0044381
632 Ga0466957_0118981
633 Ga0466967_0000875
634 Ga0466967_0004272
635 Ga0466967_0016236
636 Ga0466967_0024515
637 Ga0466967_0107812
638 Ga0466967_0147642
639 Ga0495592_0151062
640 Ga0495651_0003640
641 Ga0495639_0039827
642 Ga0495664_0250073
643 Ga0495584_0118479
644 Ga0495608_0010517
645 Ga0495618_0083318
646 Ga0495628_0020004
647 Ga0495652_0163445
648 Ga0495640_0140914
649 Ga0495667_0001323
650 Ga0495667_0133086
651 Ga0495634_0048046
652 Ga0495634_0086118
653 Ga0495635_0031990
654 Ga0495613_0078914
655 Ga0495624_0072150
656 Ga0495604_0023547
657 Ga0495674_0004916
658 Ga0495676_0106566
659 Ga0495680_0001597
660 Ga0495684_0068581
661 Ga0495602_0037190
662 Ga0496100_0020301
663 Ga0496100_0064601
664 Ga0496101_0002073
665 Ga0496101_0009845
666 Ga0496102_0022673
667 Ga0496102_0092438
668 Ga0496104_0024450
669 Ga0496105_0036650
670 Ga0496105_0042486
671 Ga0496105_0052285
672 Ga0496105_0070333
673 Ga0496105_0178433
674 Ga0496106_0028308
675 Ga0496107_0045391
676 Ga0496108_0000633
677 Ga0496108_0033455
678 Ga0496109_0019618
679 Ga0496109_0075847
680 Ga0496110_0024128
681 Ga0496110_0068280
682 Ga0496110_0108401
683 Ga0496110_0219358
684 Ga0496111_0009822
685 Ga0496111_0092146
686 Ga0496111_0128104
687 Ga0496112_0019584
688 Ga0496112_0040618
689 Ga0496112_0136667
690 Ga0496112_0303568
691 Ga0496113_0002470
692 Ga0496113_0032575
693 Ga0496114_0032037
694 Ga0496114_0047528
695 Ga0496114_0119858
696 Ga0496114_0276830
697 Ga0496114_0329158
698 Ga0496115_0159714
699 Ga0501031_0001126
700 Ga0501031_0009165
701 Ga0501031_0016507
702 Ga0501032_0034923
703 Ga0501033_0020905
704 Ga0501034_0141025
705 Ga0501036_0034445
706 Ga0501036_0034991
707 Ga0501036_0094426
708 Ga0501037_0026818
709 Ga0501037_0105668
710 Ga0501038_0007582
711 Ga0501038_0037945
712 Ga0501038_0095428
713 Ga0501039_0007527
714 Ga0501039_0015878
715 Ga0501040_0005992
716 Ga0501040_0018067
717 Ga0501040_0042109
718 Ga0501041_0086893
719 Ga0501041_0104772
720 Ga0501042_0003081
721 Ga0501042_0048802
722 Ga0501042_0055683
723 Ga0501043_0010181
724 Ga0501043_0018305
725 Ga0501046_0005113
726 Ga0501046_0052737
727 Ga0501046_0088627
728 Ga0501047_0013261
729 Ga0501047_0043265
730 Ga0501048_0008622
731 Ga0501048_0019014
732 Ga0501048_0057177
733 Ga0501067_0025086
734 Ga0501067_0168485
735 Ga0501068_0005792
736 Ga0501068_0046882
737 Ga0501068_0097056
738 Ga0501069_0001599
739 Ga0501069_0002349
740 Ga0501069_0049680
741 Ga0501070_0010373
742 Ga0501070_0047040
743 Ga0501070_0120656
744 Ga0501070_0159825
745 Ga0501071_0013380
746 Ga0501071_0018331
747 Ga0501071_0021078
748 Ga0501072_0003294
749 Ga0501072_0008781
750 Ga0501072_0017584
751 Ga0501073_0027837
752 Ga0501073_0054600
753 Ga0501074_0014134
754 Ga0501074_0023703
755 Ga0501074_0034871
756 Ga0501074_0067196
757 Ga0501074_0219689
758 Ga0501075_0043678
759 Ga0501075_0065396
760 Ga0501075_0104535
761 Ga0501076_0012182
762 Ga0501076_0022319
763 Ga0501077_0011884
764 Ga0501077_0031601
765 Ga0501077_0038054
766 Ga0501077_0110607
767 Ga0501079_0010867
768 Ga0501079_0014488
769 Ga0501080_0011982
770 Ga0501080_0018562
771 Ga0501080_0030219
772 Ga0501080_0053240
773 Ga0501081_0004739
774 Ga0501081_0017079
775 Ga0501081_0133302
776 Ga0501083_0007452
777 Ga0501035_0012352
778 Ga0501045_0006143
779 Ga0501045_0007953
780 nmdc:mga0yw44_35413_c1
781 nmdc:mga05p37_389850_c1
782 nmdc:mga08y16_56857_c1
783 nmdc:mga0rr50_17963_c1
784 nmdc:mga08x19_39099_c1
785 nmdc:mga0a205_12284_c1
786 Ga0495595_0042876
787 Ga0495595_0044483
788 Ga0495619_0099879
789 Ga0501084_0042517
790 Ga0501084_0059982
791 Ga0501084_0100116
792 Ga0587066_010720
793 Ga0587083_0018532
794 Ga0587109_017047
795 Ga0587062_006968
796 Ga0587068_014264
797 Ga0587069_008857
798 Ga0587079_015786
799 Ga0501082_0012712
800 Ga0501082_0025388
801 Ga0501082_0039184
802 Ga0466962_0015609
803 Ga0530510_0011463
804 Ga0530510_0019701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

72

419

0.88

PF01094

ANF_receptor

Receptor family ligand binding region

96

417

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.8573 28 357
4obb-assembly2.cif.gz_B the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. 0.8283 26 357
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8228 26 357
3sg0-assembly1.cif.gz_A the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.8208 26 356
4f8j-assembly1.cif.gz_A the structure of an aromatic compound transport protein from rhodopseudomonas palustris in complex with p-coumarate 0.8197 27 357
ID Description Score Start End Superfamily
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9142 130 246 3.40.50.2300
4gnrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8776 128 246 3.40.50.2300
3hutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8598 131 249 3.40.50.2300
3h5lB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.858 131 246 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8338 130 248 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6J7SQW9-F1-model_v4 Unannotated protein 0.9513 99 357
AF-A0A6J7SQW9-F1-model_v4 Unannotated protein 0.9476 99 357
AF-A0A538L6X9-F1-model_v4 Leucine-binding protein domain-containing protein 0.9339 1 357
AF-A0A538L6X9-F1-model_v4 Leucine-binding protein domain-containing protein 0.9314 1 357
AF-A0A7W0GB04-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9299 1 315

Map