F435126

General Info

Members Datasets Scaffolds Average Seq Length
402 195 804 426

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10129942|Ga0307518_101299422
Length 434
Sequence MMAAVNLEIPGSLELIMKKPFYKILYVQVLFAIAVGVLLGIFLPKDAVAMKPLGDGFIKLIKMIIAPVIFCTVVSGIAGMQDIKKIGRVGGKALLYFEVVSTFALVIGLFVANIIKPGAGFNADPATLDTKAIAQYTEKASHQSTIDFVMNIIPNTVVDAFAKGDILQVLLISILFGFALSLLGEKGRPVAKLIDEAGAAIFGMVNIIMKVAPIGAFGAMAFTIGKYGIDSLLPLAKLMGSFYLTCGLFVFIVLGSIAKFTGFSIVRFIAYIKEELLIVLGTSSSESALPSLMTKLQRLGASKPVVGLVVPTGYSFNLDGTNIYMTMAALFVAQATNTELTLMQELTILGVAMLTSKGASGIGMALILGIDRFMSECRALTNFIGNGVAAIVVSKWEGELDMATLKRELSHPGAPHEPLDDVAHGQPVVLPKQA

Samples

Sample ID Description Type Environment
1 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
195 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 1
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307518_10129942 3300031838 Bacteria 1772
2 JGI24746J21847_1001543 3300001977 Bacteria 3672
3 Ga0065712_10079540 3300005290 Bacteria 3198
4 Ga0065712_10082550 3300005290 Bacteria 2907
5 Ga0065715_10006170 3300005293 Bacteria 8502
6 Ga0065715_10096457 3300005293 Bacteria 3874
7 Ga0070676_10007978 3300005328 Bacteria 5693
8 Ga0070690_100001941 3300005330 Bacteria 10998
9 Ga0070690_100004824 3300005330 Bacteria 7524
10 Ga0070690_100149429 3300005330 Bacteria 1593
11 Ga0070670_100001210 3300005331 Bacteria 20494
12 Ga0070677_10004860 3300005333 Bacteria 4411
13 Ga0068869_100003412 3300005334 Bacteria 9706
14 Ga0068869_100030287 3300005334 Bacteria 3797
15 Ga0068869_100052436 3300005334 Bacteria 2962
16 Ga0070666_10007172 3300005335 Bacteria 6871
17 Ga0070666_10079636 3300005335 Bacteria 2238
18 Ga0068868_100002067 3300005338 Bacteria 13803
19 Ga0070689_100016230 3300005340 Bacteria 5446
20 Ga0070689_100035004 3300005340 Bacteria 3834
21 Ga0070661_100015700 3300005344 Bacteria 5346
22 Ga0070668_100033481 3300005347 Bacteria 3913
23 Ga0070669_100003805 3300005353 Bacteria 10904
24 Ga0070669_100048158 3300005353 Bacteria 3111
25 Ga0070675_100000173 3300005354 Bacteria 39883
26 Ga0070675_100000413 3300005354 Bacteria 29141
27 Ga0070675_100000827 3300005354 Bacteria 21861
28 Ga0070671_100002428 3300005355 Bacteria 14404
29 Ga0070671_100012157 3300005355 Bacteria 6928
30 Ga0070671_100110282 3300005355 Bacteria 2311
31 Ga0070674_100042986 3300005356 Bacteria 3072
32 Ga0070673_100007494 3300005364 Bacteria 7205
33 Ga0070673_100019364 3300005364 Bacteria 4884
34 Ga0070673_100029884 3300005364 Bacteria 4069
35 Ga0070673_100063357 3300005364 Bacteria 2942
36 Ga0070688_100012991 3300005365 Bacteria 4685
37 Ga0070659_100095924 3300005366 Bacteria 2382
38 Ga0070667_100003967 3300005367 Bacteria 12550
39 Ga0070667_100008035 3300005367 Bacteria 8752
40 Ga0070710_10046118 3300005437 Bacteria 2425
41 Ga0070701_10018294 3300005438 Bacteria 3290
42 Ga0070701_10024008 3300005438 Bacteria 2945
43 Ga0070700_100023327 3300005441 Bacteria 3617
44 Ga0070700_100047153 3300005441 Bacteria 2666
45 Ga0070663_100085559 3300005455 Bacteria 2327
46 Ga0070663_100129011 3300005455 Bacteria 1918
47 Ga0070678_100004600 3300005456 Bacteria 7837
48 Ga0070678_100037797 3300005456 Bacteria 3393
49 Ga0070662_100003026 3300005457 Bacteria 10453
50 Ga0068867_100002606 3300005459 Bacteria 12715
51 Ga0068867_100015808 3300005459 Bacteria 5357
52 Ga0068867_100146827 3300005459 Bacteria 1849
53 Ga0068867_100205786 3300005459 Bacteria 1577
54 Ga0070685_10008237 3300005466 Bacteria 5346
55 Ga0070685_10009546 3300005466 Bacteria 5017
56 Ga0070685_10033736 3300005466 Bacteria 2878
57 Ga0070707_100003638 3300005468 Bacteria 14537
58 Ga0070698_100123678 3300005471 Bacteria 2545
59 Ga0070672_100002740 3300005543 Bacteria 11282
60 Ga0070672_100017047 3300005543 Bacteria 5218
61 Ga0070672_100022798 3300005543 Bacteria 4606
62 Ga0070686_100005717 3300005544 Bacteria 6891
63 Ga0070686_100014067 3300005544 Unclassified 4601
64 Ga0070686_100021299 3300005544 Bacteria 3851
65 Ga0070686_100033564 3300005544 Bacteria 3155
66 Ga0070686_100098718 3300005544 Bacteria 1969
67 Ga0070665_100030923 3300005548 Bacteria 5388
68 Ga0070704_100019783 3300005549 Bacteria 4332
69 Ga0068855_100015413 3300005563 Bacteria 9201
70 Ga0070664_100000314 3300005564 Bacteria 35291
71 Ga0070664_100000547 3300005564 Bacteria 28718
72 Ga0070664_100006295 3300005564 Bacteria 9579
73 Ga0068852_100058505 3300005616 Bacteria 3339
74 Ga0068859_100000161 3300005617 Bacteria 65050
75 Ga0068859_100003938 3300005617 Bacteria 15163
76 Ga0068859_100004052 3300005617 Bacteria 14940
77 Ga0068859_100023712 3300005617 Bacteria 6158
78 Ga0068859_100032488 3300005617 Bacteria 5242
79 Ga0068859_100076761 3300005617 Bacteria 3381
80 Ga0068859_100081478 3300005617 Bacteria 3279
81 Ga0068864_100018423 3300005618 Bacteria 5834
82 Ga0068861_100040297 3300005719 Bacteria 3492
83 Ga0068863_100055410 3300005841 Bacteria 3755
84 Ga0068863_100133618 3300005841 Unclassified 2370
85 Ga0068863_100317837 3300005841 Bacteria 1512
86 Ga0068858_100020179 3300005842 Bacteria 6231
87 Ga0068858_100020981 3300005842 Bacteria 6103
88 Ga0068858_100093850 3300005842 Bacteria 2794
89 Ga0068858_100098932 3300005842 Bacteria 2720
90 Ga0068860_100002796 3300005843 Bacteria 18149
91 Ga0068860_100005603 3300005843 Bacteria 12685
92 Ga0068860_100024768 3300005843 Bacteria 5796
93 Ga0068860_100066285 3300005843 Bacteria 3430
94 Ga0068862_100004647 3300005844 Bacteria 11571
95 Ga0068862_100012544 3300005844 Bacteria 7016
96 Ga0068862_100130595 3300005844 Bacteria 2221
97 Ga0075368_10010632 3300006042 Bacteria 3332
98 Ga0075432_10016383 3300006058 Bacteria 2529
99 Ga0070712_100077094 3300006175 Bacteria 2402
100 Ga0075367_10008625 3300006178 Bacteria 5287
101 Ga0075367_10017704 3300006178 Bacteria 3916
102 Ga0075366_10018127 3300006195 Bacteria 4064
103 Ga0075366_10120704 3300006195 Bacteria 1579
104 Ga0097621_100007524 3300006237 Bacteria 7798
105 Ga0097621_100040719 3300006237 Bacteria 3737
106 Ga0097621_100092988 3300006237 Bacteria 2526
107 Ga0097621_100192174 3300006237 Bacteria 1768
108 Ga0075370_10008884 3300006353 Bacteria 5190
109 Ga0068871_100120366 3300006358 Bacteria 2217
110 Ga0068871_100334034 3300006358 Bacteria 1337
111 Ga0075428_100000004 3300006844 Bacteria 326694
112 Ga0075428_100004602 3300006844 Bacteria 15254
113 Ga0075428_100053582 3300006844 Bacteria 4420
114 Ga0075430_100000982 3300006846 Bacteria 22489
115 Ga0075431_100001675 3300006847 Bacteria 20787
116 Ga0075431_100064324 3300006847 Bacteria 3787
117 Ga0075431_100108043 3300006847 Bacteria 2871
118 Ga0075431_100110520 3300006847 Bacteria 2836
119 Ga0075433_10001173 3300006852 Bacteria 19052
120 Ga0075433_10005818 3300006852 Bacteria 9709
121 Ga0075433_10018723 3300006852 Bacteria 5760
122 Ga0075433_10024713 3300006852 Bacteria 5073
123 Ga0075434_100024961 3300006871 Bacteria 5846
124 Ga0075434_100028850 3300006871 Bacteria 5457
125 Ga0075434_100047251 3300006871 Bacteria 4272
126 Ga0075434_100150324 3300006871 Bacteria 2349
127 Ga0075434_100264178 3300006871 Bacteria 1740
128 Ga0075434_100270915 3300006871 Bacteria 1717
129 Ga0075429_100001185 3300006880 Bacteria 21068
130 Ga0075429_100004316 3300006880 Bacteria 12215
131 Ga0075429_100045588 3300006880 Bacteria 3815
132 Ga0068865_100001500 3300006881 Bacteria 13615
133 Ga0097620_100000161 3300006931 Bacteria 65050
134 Ga0097620_100003938 3300006931 Bacteria 15163
135 Ga0097620_100004052 3300006931 Bacteria 14940
136 Ga0097620_100023712 3300006931 Bacteria 6158
137 Ga0097620_100032487 3300006931 Bacteria 5242
138 Ga0097620_100076762 3300006931 Bacteria 3381
139 Ga0097620_100081479 3300006931 Bacteria 3279
140 Ga0105240_10100814 3300009093 Bacteria 3513
141 Ga0111539_10000005 3300009094 Bacteria 467342
142 Ga0111539_10002166 3300009094 Bacteria 26275
143 Ga0111539_10007313 3300009094 Bacteria 14138
144 Ga0111539_10010413 3300009094 Bacteria 11706
145 Ga0111539_10026920 3300009094 Bacteria 7025
146 Ga0111539_10082893 3300009094 Bacteria 3771
147 Ga0111539_10088192 3300009094 Bacteria 3645
148 Ga0111539_10110308 3300009094 Bacteria 3229
149 Ga0111539_10140340 3300009094 Bacteria 2829
150 Ga0105245_10050590 3300009098 Bacteria 3725
151 Ga0105247_10033837 3300009101 Bacteria 3111
152 Ga0114129_10012155 3300009147 Bacteria 12250
153 Ga0114129_10016047 3300009147 Bacteria 10654
154 Ga0114129_10048184 3300009147 Bacteria 5988
155 Ga0114129_10050346 3300009147 Bacteria 5851
156 Ga0114129_10084183 3300009147 Bacteria 4416
157 Ga0114129_10110700 3300009147 Bacteria 3790
158 Ga0114129_10428375 3300009147 Bacteria 1739
159 Ga0105243_10004789 3300009148 Bacteria 10635
160 Ga0105241_10003325 3300009174 Bacteria 11965
161 Ga0105242_10040222 3300009176 Bacteria 3767
162 Ga0105248_10000511 3300009177 Bacteria 44011
163 Ga0105248_10004064 3300009177 Bacteria 16163
164 Ga0105248_10065697 3300009177 Bacteria 4073
165 Ga0105237_10011444 3300009545 Bacteria 9385
166 Ga0105238_10005967 3300009551 Bacteria 12077
167 Ga0105249_10015102 3300009553 Bacteria 6831
168 Ga0105246_10018944 3300011119 Bacteria 4390
169 Ga0105246_10076368 3300011119 Bacteria 2374
170 Ga0157370_10073956 3300013104 Bacteria 3215
171 Ga0157369_10069266 3300013105 Bacteria 3790
172 Ga0157374_10268274 3300013296 Bacteria 1683
173 Ga0163162_10004091 3300013306 Bacteria 13999
174 Ga0163162_10006404 3300013306 Bacteria 11399
175 Ga0157372_10000289 3300013307 Bacteria 55971
176 Ga0157375_10071413 3300013308 Bacteria 3485
177 Ga0157375_10147416 3300013308 Bacteria 2485
178 Ga0157375_10226981 3300013308 Bacteria 2026
179 Ga0157375_10241766 3300013308 Bacteria 1965
180 Ga0163163_10079853 3300014325 Bacteria 3270
181 Ga0163163_10133201 3300014325 Bacteria 2525
182 Ga0163163_10146456 3300014325 Bacteria 2406
183 Ga0157380_10003336 3300014326 Bacteria 11020
184 Ga0157380_10003906 3300014326 Bacteria 10276
185 Ga0157380_10006885 3300014326 Bacteria 8037
186 Ga0157380_10013591 3300014326 Bacteria 5940
187 Ga0157380_10082540 3300014326 Bacteria 2631
188 Ga0157380_10283416 3300014326 Bacteria 1517
189 Ga0157377_10050168 3300014745 Bacteria 2349
190 Ga0157379_10000414 3300014968 Bacteria 34654
191 Ga0157376_10095238 3300014969 Bacteria 2589
192 Ga0157376_10097982 3300014969 Bacteria 2555
193 Ga0213872_10001546 3300021361 Bacteria 14745
194 Ga0207697_10000291 3300025315 Bacteria 27983
195 Ga0207682_10000749 3300025893 Bacteria 14982
196 Ga0207682_10018769 3300025893 Bacteria 2705
197 Ga0207642_10018845 3300025899 Bacteria 2659
198 Ga0207688_10000459 3300025901 Bacteria 19415
199 Ga0207680_10053356 3300025903 Bacteria 2427
200 Ga0207680_10060060 3300025903 Bacteria 2312
201 Ga0207645_10010114 3300025907 Bacteria 6493
202 Ga0207645_10032414 3300025907 Bacteria 3358
203 Ga0207643_10000653 3300025908 Bacteria 21644
204 Ga0207643_10011375 3300025908 Bacteria 4804
205 Ga0207643_10019474 3300025908 Bacteria 3719
206 Ga0207654_10043651 3300025911 Bacteria 2543
207 Ga0207695_10000750 3300025913 Bacteria 62486
208 Ga0207671_10005138 3300025914 Bacteria 12187
209 Ga0207662_10013546 3300025918 Bacteria 4561
210 Ga0207649_10003523 3300025920 Bacteria 8555
211 Ga0207649_10042462 3300025920 Bacteria 2774
212 Ga0207646_10137001 3300025922 Bacteria 2204
213 Ga0207681_10016240 3300025923 Bacteria 4654
214 Ga0207681_10040067 3300025923 Bacteria 3114
215 Ga0207694_10044611 3300025924 Bacteria 3423
216 Ga0207659_10000463 3300025926 Bacteria 24363
217 Ga0207659_10000932 3300025926 Bacteria 17440
218 Ga0207659_10012136 3300025926 Bacteria 5466
219 Ga0207659_10021519 3300025926 Bacteria 4281
220 Ga0207659_10048651 3300025926 Bacteria 3004
221 Ga0207644_10022682 3300025931 Bacteria 4291
222 Ga0207644_10069901 3300025931 Bacteria 2564
223 Ga0207706_10003389 3300025933 Bacteria 15239
224 Ga0207706_10047091 3300025933 Bacteria 3816
225 Ga0207706_10122830 3300025933 Bacteria 2284
226 Ga0207686_10019905 3300025934 Bacteria 3826
227 Ga0207709_10007905 3300025935 Bacteria 5896
228 Ga0207670_10025430 3300025936 Bacteria 3716
229 Ga0207670_10092629 3300025936 Bacteria 2139
230 Ga0207669_10025566 3300025937 Bacteria 3194
231 Ga0207704_10002318 3300025938 Bacteria 8551
232 Ga0207691_10006482 3300025940 Bacteria 11301
233 Ga0207691_10014595 3300025940 Bacteria 7488
234 Ga0207691_10021559 3300025940 Bacteria 6083
235 Ga0207691_10076450 3300025940 Bacteria 3017
236 Ga0207711_10003493 3300025941 Bacteria 13602
237 Ga0207689_10001215 3300025942 Bacteria 24788
238 Ga0207689_10002288 3300025942 Bacteria 17931
239 Ga0207689_10080328 3300025942 Bacteria 2680
240 Ga0207689_10138393 3300025942 Bacteria 2005
241 Ga0207679_10002977 3300025945 Bacteria 10508
242 Ga0207679_10004278 3300025945 Bacteria 8868
243 Ga0207679_10010587 3300025945 Bacteria 5941
244 Ga0207679_10064329 3300025945 Bacteria 2741
245 Ga0207667_10033926 3300025949 Bacteria 5483
246 Ga0207651_10008372 3300025960 Bacteria 5584
247 Ga0207651_10038015 3300025960 Bacteria 3158
248 Ga0207651_10038757 3300025960 Bacteria 3135
249 Ga0207651_10064654 3300025960 Bacteria 2561
250 Ga0207651_10064984 3300025960 Bacteria 2556
251 Ga0207712_10027925 3300025961 Bacteria 3771
252 Ga0207677_10168572 3300026023 Unclassified 1709
253 Ga0207703_10016879 3300026035 Bacteria 5695
254 Ga0207703_10134975 3300026035 Bacteria 2135
255 Ga0207639_10000894 3300026041 Bacteria 20214
256 Ga0207678_10050365 3300026067 Bacteria 3598
257 Ga0207708_10038023 3300026075 Bacteria 3666
258 Ga0207708_10128246 3300026075 Bacteria 1981
259 Ga0207702_10117053 3300026078 Bacteria 2379
260 Ga0207641_10014735 3300026088 Bacteria 6410
261 Ga0207641_10070416 3300026088 Bacteria 3005
262 Ga0207648_10000749 3300026089 Bacteria 36501
263 Ga0207648_10050696 3300026089 Bacteria 3629
264 Ga0207648_10247158 3300026089 Bacteria 1590
265 Ga0207676_10018976 3300026095 Bacteria 5009
266 Ga0207676_10024702 3300026095 Bacteria 4451
267 Ga0207676_10179607 3300026095 Bacteria 1852
268 Ga0207674_10053458 3300026116 Bacteria 4116
269 Ga0207675_100019597 3300026118 Bacteria 6314
270 Ga0207675_100028468 3300026118 Bacteria 5202
271 Ga0207683_10009761 3300026121 Bacteria 8181
272 Ga0207683_10016565 3300026121 Bacteria 6275
273 Ga0207683_10203962 3300026121 Bacteria 1798
274 Ga0207698_10055771 3300026142 Bacteria 3048
275 Ga0207428_10000024 3300027907 Bacteria 265587
276 Ga0207428_10001189 3300027907 Bacteria 28012
277 Ga0207428_10002296 3300027907 Bacteria 19173
278 Ga0207428_10031733 3300027907 Bacteria 4354
279 Ga0207428_10046543 3300027907 Bacteria 3488
280 Ga0207428_10075733 3300027907 Bacteria 2637
281 Ga0268265_10013538 3300028380 Bacteria 5544
282 Ga0268265_10072670 3300028380 Bacteria 2684
283 Ga0268264_10007627 3300028381 Bacteria 9019
284 Ga0268264_10012425 3300028381 Bacteria 7009
285 Ga0268264_10023645 3300028381 Bacteria 5012
286 Ga0268264_10095148 3300028381 Bacteria 2577
287 Ga0268264_10193718 3300028381 Bacteria 1854
288 Ga0265338_10006347 3300028800 Bacteria 15106
289 Ga0265324_10012810 3300029957 Bacteria 3149
290 Ga0265324_10026697 3300029957 Bacteria 2043
291 Ga0265320_10002109 3300031240 Bacteria 13992
292 Ga0265327_10002197 3300031251 Bacteria 21383
293 Ga0265327_10003859 3300031251 Bacteria 13822
294 Ga0265316_10001525 3300031344 Bacteria 24813
295 Ga0307416_100192290 3300032002 Bacteria 1926
296 Ga0373953_0041107 3300035117 Bacteria 1839
297 Ga0373931_0031622 3300035691 Bacteria 2733
298 Ga0373937_0129572 3300036401 Bacteria 2356
299 Ga0395905_0000100 3300037471 Bacteria 144532
300 Ga0395905_0017809 3300037471 Bacteria 6749
301 Ga0451791_1326668 3300041451 Bacteria 1842
302 Ga0451577_0000128 3300042876 Bacteria 167957
303 Ga0451577_0011497 3300042876 Bacteria 8366
304 Ga0451577_0123671 3300042876 Bacteria 2318
305 Ga0453683_0008157 3300044673 Bacteria 7047
306 Ga0453684_0000471 3300044712 Bacteria 159987
307 Ga0453684_0000625 3300044712 Bacteria 128854
308 Ga0453684_0000922 3300044712 Bacteria 97471
309 Ga0453684_0034001 3300044712 Bacteria 7089
310 Ga0453684_0040423 3300044712 Bacteria 6333
311 Ga0453684_0081996 3300044712 Bacteria 4020
312 Ga0453684_0217287 3300044712 Bacteria 2217
313 Ga0451576_0002490 3300045051 Bacteria 27346
314 Ga0451576_0024162 3300045051 Bacteria 6567
315 Ga0495618_0059670 3300046514 Bacteria 2418
316 Ga0495630_0137077 3300046517 Bacteria 1860
317 Ga0495598_0010314 3300046537 Bacteria 2236
318 Ga0495622_0000001 3300046557 Bacteria 365248
319 Ga0495667_0005541 3300046559 Bacteria 8532
320 Ga0495657_0000467 3300046675 Bacteria 37857
321 Ga0495613_0010428 3300046689 Bacteria 6901
322 Ga0495613_0018374 3300046689 Bacteria 5215
323 Ga0495674_0026241 3300047319 Bacteria 5333
324 Ga0496102_0196293 3300048905 Bacteria 1902
325 Ga0496109_0126410 3300048912 Bacteria 2384
326 Ga0496113_0066243 3300048916 Bacteria 2735
327 Ga0501033_0015028 3300049570 Bacteria 5876
328 Ga0501034_0013921 3300049571 Bacteria 8281
329 Ga0501034_0051857 3300049571 Bacteria 4135
330 Ga0501036_0020264 3300049572 Bacteria 5585
331 Ga0501036_0084874 3300049572 Bacteria 2677
332 Ga0501038_0030007 3300049574 Bacteria 4813
333 Ga0501039_0013704 3300049575 Bacteria 6200
334 Ga0501043_0013907 3300049579 Bacteria 6297
335 Ga0501043_0111146 3300049579 Bacteria 2151
336 Ga0501046_0024560 3300049580 Bacteria 4942
337 Ga0501046_0171938 3300049580 Bacteria 1625
338 Ga0501047_0002111 3300049581 Bacteria 19026
339 Ga0501047_0003254 3300049581 Bacteria 15404
340 Ga0501047_0031407 3300049581 Bacteria 5122
341 Ga0501047_0266794 3300049581 Bacteria 1558
342 Ga0501067_0009244 3300049583 Bacteria 5458
343 Ga0501069_0052382 3300049585 Bacteria 2272
344 Ga0501071_0095797 3300049587 Bacteria 2184
345 Ga0501072_0032894 3300049588 Bacteria 4062
346 Ga0501072_0051155 3300049588 Bacteria 3253
347 Ga0501072_0054934 3300049588 Bacteria 3139
348 Ga0501073_0013916 3300049589 Bacteria 5847
349 Ga0501073_0079478 3300049589 Bacteria 2282
350 Ga0501076_0023968 3300049592 Bacteria 4710
351 Ga0501076_0085864 3300049592 Bacteria 2529
352 Ga0501076_0123486 3300049592 Bacteria 2097
353 Ga0501079_0059771 3300049741 Bacteria 2940
354 Ga0501080_0005706 3300049742 Bacteria 11134
355 Ga0501080_0052252 3300049742 Bacteria 3803
356 Ga0501081_0097944 3300049743 Bacteria 2070
357 Ga0501083_0011113 3300049744 Bacteria 6322
358 Ga0501283_000871 3300049779 Bacteria 3984
359 Ga0501044_0028581 3300049823 Bacteria 5885
360 Ga0501045_0081300 3300049824 Bacteria 2389
361 nmdc:mga0k408_110994_c1 3300050493 Bacteria 1621
362 nmdc:mga0k408_11166_c1 3300050493 Bacteria 4883
363 nmdc:mga05p37_22942_c1 3300050507 Bacteria 7570
364 nmdc:mga05p37_26445_c1 3300050507 Bacteria 7059
365 nmdc:mga05p37_281480_c1 3300050507 Bacteria 1983
366 nmdc:mga05p37_315146_c1 3300050507 Bacteria 1853
367 nmdc:mga05p37_42178_c1 3300050507 Bacteria 5606
368 nmdc:mga05p37_68521_c1 3300050507 Bacteria 4363
369 nmdc:mga05p37_6872_c2 3300050507 Bacteria 10620
370 nmdc:mga09592_1446_c1 3300050508 Bacteria 19044
371 nmdc:mga09592_15604_c1 3300050508 Bacteria 6206
372 nmdc:mga09592_42393_c1 3300050508 Bacteria 3827
373 nmdc:mga0qj67_3807_c1 3300050509 Bacteria 10897
374 nmdc:mga0qj67_51732_c1 3300050509 Bacteria 3249
375 nmdc:mga06r32_1853_c1 3300050510 Bacteria 18806
376 nmdc:mga08y16_103519_c1 3300050511 Bacteria 2964
377 nmdc:mga08y16_125217_c1 3300050511 Bacteria 2673
378 nmdc:mga08y16_25573_c1 3300050511 Bacteria 6228
379 nmdc:mga08y16_33192_c1 3300050511 Bacteria 5422
380 nmdc:mga08y16_46939_c1 3300050511 Bacteria 4521
381 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
382 nmdc:mga0n895_109296_c1 3300050512 Bacteria 2780
383 nmdc:mga0n895_124195_c1 3300050512 Bacteria 2604
384 nmdc:mga0n895_172463_c1 3300050512 Bacteria 2195
385 nmdc:mga0n895_272187_c1 3300050512 Bacteria 1718
386 nmdc:mga0n895_273037_c1 3300050512 Bacteria 1715
387 nmdc:mga0n895_88349_c2 3300050512 Bacteria 2769
388 nmdc:mga0a205_108198_c1 3300050515 Bacteria 2678
389 nmdc:mga0a205_1172_c1 3300050515 Bacteria 21855
390 nmdc:mga0a205_4054_c1 3300050515 Bacteria 13094
391 nmdc:mga0a205_80346_c1 3300050515 Bacteria 3151
392 nmdc:mga0a205_9105_c1 3300050515 Bacteria 9060
393 Ga0500646_0010768 3300053090 Bacteria 2348
394 Ga0500555_032324 3300053103 Bacteria 1479
395 Ga0500645_009730 3300053730 Bacteria 3219
396 Ga0501084_0011751 3300054114 Bacteria 7249
397 Ga0501084_0011999 3300054114 Bacteria 7174
398 Ga0501082_0016683 3300060353 Bacteria 6324
399 Ga0501082_0055974 3300060353 Bacteria 3397
400 Ga0501082_0065016 3300060353 Bacteria 3141
401 2894514782 2894510363 Bacteria 5121143
402 8055591881 8055588893 Bacteria 3619545
403 Ga0307518_10129942
404 JGI24746J21847_1001543
405 Ga0065712_10079540
406 Ga0065712_10082550
407 Ga0065715_10006170
408 Ga0065715_10096457
409 Ga0070676_10007978
410 Ga0070690_100001941
411 Ga0070690_100004824
412 Ga0070690_100149429
413 Ga0070670_100001210
414 Ga0070677_10004860
415 Ga0068869_100003412
416 Ga0068869_100030287
417 Ga0068869_100052436
418 Ga0070666_10007172
419 Ga0070666_10079636
420 Ga0068868_100002067
421 Ga0070689_100016230
422 Ga0070689_100035004
423 Ga0070661_100015700
424 Ga0070668_100033481
425 Ga0070669_100003805
426 Ga0070669_100048158
427 Ga0070675_100000173
428 Ga0070675_100000413
429 Ga0070675_100000827
430 Ga0070671_100002428
431 Ga0070671_100012157
432 Ga0070671_100110282
433 Ga0070674_100042986
434 Ga0070673_100007494
435 Ga0070673_100019364
436 Ga0070673_100029884
437 Ga0070673_100063357
438 Ga0070688_100012991
439 Ga0070659_100095924
440 Ga0070667_100003967
441 Ga0070667_100008035
442 Ga0070710_10046118
443 Ga0070701_10018294
444 Ga0070701_10024008
445 Ga0070700_100023327
446 Ga0070700_100047153
447 Ga0070663_100085559
448 Ga0070663_100129011
449 Ga0070678_100004600
450 Ga0070678_100037797
451 Ga0070662_100003026
452 Ga0068867_100002606
453 Ga0068867_100015808
454 Ga0068867_100146827
455 Ga0068867_100205786
456 Ga0070685_10008237
457 Ga0070685_10009546
458 Ga0070685_10033736
459 Ga0070707_100003638
460 Ga0070698_100123678
461 Ga0070672_100002740
462 Ga0070672_100017047
463 Ga0070672_100022798
464 Ga0070686_100005717
465 Ga0070686_100014067
466 Ga0070686_100021299
467 Ga0070686_100033564
468 Ga0070686_100098718
469 Ga0070665_100030923
470 Ga0070704_100019783
471 Ga0068855_100015413
472 Ga0070664_100000314
473 Ga0070664_100000547
474 Ga0070664_100006295
475 Ga0068852_100058505
476 Ga0068859_100000161
477 Ga0068859_100003938
478 Ga0068859_100004052
479 Ga0068859_100023712
480 Ga0068859_100032488
481 Ga0068859_100076761
482 Ga0068859_100081478
483 Ga0068864_100018423
484 Ga0068861_100040297
485 Ga0068863_100055410
486 Ga0068863_100133618
487 Ga0068863_100317837
488 Ga0068858_100020179
489 Ga0068858_100020981
490 Ga0068858_100093850
491 Ga0068858_100098932
492 Ga0068860_100002796
493 Ga0068860_100005603
494 Ga0068860_100024768
495 Ga0068860_100066285
496 Ga0068862_100004647
497 Ga0068862_100012544
498 Ga0068862_100130595
499 Ga0075368_10010632
500 Ga0075432_10016383
501 Ga0070712_100077094
502 Ga0075367_10008625
503 Ga0075367_10017704
504 Ga0075366_10018127
505 Ga0075366_10120704
506 Ga0097621_100007524
507 Ga0097621_100040719
508 Ga0097621_100092988
509 Ga0097621_100192174
510 Ga0075370_10008884
511 Ga0068871_100120366
512 Ga0068871_100334034
513 Ga0075428_100000004
514 Ga0075428_100004602
515 Ga0075428_100053582
516 Ga0075430_100000982
517 Ga0075431_100001675
518 Ga0075431_100064324
519 Ga0075431_100108043
520 Ga0075431_100110520
521 Ga0075433_10001173
522 Ga0075433_10005818
523 Ga0075433_10018723
524 Ga0075433_10024713
525 Ga0075434_100024961
526 Ga0075434_100028850
527 Ga0075434_100047251
528 Ga0075434_100150324
529 Ga0075434_100264178
530 Ga0075434_100270915
531 Ga0075429_100001185
532 Ga0075429_100004316
533 Ga0075429_100045588
534 Ga0068865_100001500
535 Ga0097620_100000161
536 Ga0097620_100003938
537 Ga0097620_100004052
538 Ga0097620_100023712
539 Ga0097620_100032487
540 Ga0097620_100076762
541 Ga0097620_100081479
542 Ga0105240_10100814
543 Ga0111539_10000005
544 Ga0111539_10002166
545 Ga0111539_10007313
546 Ga0111539_10010413
547 Ga0111539_10026920
548 Ga0111539_10082893
549 Ga0111539_10088192
550 Ga0111539_10110308
551 Ga0111539_10140340
552 Ga0105245_10050590
553 Ga0105247_10033837
554 Ga0114129_10012155
555 Ga0114129_10016047
556 Ga0114129_10048184
557 Ga0114129_10050346
558 Ga0114129_10084183
559 Ga0114129_10110700
560 Ga0114129_10428375
561 Ga0105243_10004789
562 Ga0105241_10003325
563 Ga0105242_10040222
564 Ga0105248_10000511
565 Ga0105248_10004064
566 Ga0105248_10065697
567 Ga0105237_10011444
568 Ga0105238_10005967
569 Ga0105249_10015102
570 Ga0105246_10018944
571 Ga0105246_10076368
572 Ga0157370_10073956
573 Ga0157369_10069266
574 Ga0157374_10268274
575 Ga0163162_10004091
576 Ga0163162_10006404
577 Ga0157372_10000289
578 Ga0157375_10071413
579 Ga0157375_10147416
580 Ga0157375_10226981
581 Ga0157375_10241766
582 Ga0163163_10079853
583 Ga0163163_10133201
584 Ga0163163_10146456
585 Ga0157380_10003336
586 Ga0157380_10003906
587 Ga0157380_10006885
588 Ga0157380_10013591
589 Ga0157380_10082540
590 Ga0157380_10283416
591 Ga0157377_10050168
592 Ga0157379_10000414
593 Ga0157376_10095238
594 Ga0157376_10097982
595 Ga0213872_10001546
596 Ga0207697_10000291
597 Ga0207682_10000749
598 Ga0207682_10018769
599 Ga0207642_10018845
600 Ga0207688_10000459
601 Ga0207680_10053356
602 Ga0207680_10060060
603 Ga0207645_10010114
604 Ga0207645_10032414
605 Ga0207643_10000653
606 Ga0207643_10011375
607 Ga0207643_10019474
608 Ga0207654_10043651
609 Ga0207695_10000750
610 Ga0207671_10005138
611 Ga0207662_10013546
612 Ga0207649_10003523
613 Ga0207649_10042462
614 Ga0207646_10137001
615 Ga0207681_10016240
616 Ga0207681_10040067
617 Ga0207694_10044611
618 Ga0207659_10000463
619 Ga0207659_10000932
620 Ga0207659_10012136
621 Ga0207659_10021519
622 Ga0207659_10048651
623 Ga0207644_10022682
624 Ga0207644_10069901
625 Ga0207706_10003389
626 Ga0207706_10047091
627 Ga0207706_10122830
628 Ga0207686_10019905
629 Ga0207709_10007905
630 Ga0207670_10025430
631 Ga0207670_10092629
632 Ga0207669_10025566
633 Ga0207704_10002318
634 Ga0207691_10006482
635 Ga0207691_10014595
636 Ga0207691_10021559
637 Ga0207691_10076450
638 Ga0207711_10003493
639 Ga0207689_10001215
640 Ga0207689_10002288
641 Ga0207689_10080328
642 Ga0207689_10138393
643 Ga0207679_10002977
644 Ga0207679_10004278
645 Ga0207679_10010587
646 Ga0207679_10064329
647 Ga0207667_10033926
648 Ga0207651_10008372
649 Ga0207651_10038015
650 Ga0207651_10038757
651 Ga0207651_10064654
652 Ga0207651_10064984
653 Ga0207712_10027925
654 Ga0207677_10168572
655 Ga0207703_10016879
656 Ga0207703_10134975
657 Ga0207639_10000894
658 Ga0207678_10050365
659 Ga0207708_10038023
660 Ga0207708_10128246
661 Ga0207702_10117053
662 Ga0207641_10014735
663 Ga0207641_10070416
664 Ga0207648_10000749
665 Ga0207648_10050696
666 Ga0207648_10247158
667 Ga0207676_10018976
668 Ga0207676_10024702
669 Ga0207676_10179607
670 Ga0207674_10053458
671 Ga0207675_100019597
672 Ga0207675_100028468
673 Ga0207683_10009761
674 Ga0207683_10016565
675 Ga0207683_10203962
676 Ga0207698_10055771
677 Ga0207428_10000024
678 Ga0207428_10001189
679 Ga0207428_10002296
680 Ga0207428_10031733
681 Ga0207428_10046543
682 Ga0207428_10075733
683 Ga0268265_10013538
684 Ga0268265_10072670
685 Ga0268264_10007627
686 Ga0268264_10012425
687 Ga0268264_10023645
688 Ga0268264_10095148
689 Ga0268264_10193718
690 Ga0265338_10006347
691 Ga0265324_10012810
692 Ga0265324_10026697
693 Ga0265320_10002109
694 Ga0265327_10002197
695 Ga0265327_10003859
696 Ga0265316_10001525
697 Ga0307416_100192290
698 Ga0373953_0041107
699 Ga0373931_0031622
700 Ga0373937_0129572
701 Ga0395905_0000100
702 Ga0395905_0017809
703 Ga0451791_1326668
704 Ga0451577_0000128
705 Ga0451577_0011497
706 Ga0451577_0123671
707 Ga0453683_0008157
708 Ga0453684_0000471
709 Ga0453684_0000625
710 Ga0453684_0000922
711 Ga0453684_0034001
712 Ga0453684_0040423
713 Ga0453684_0081996
714 Ga0453684_0217287
715 Ga0451576_0002490
716 Ga0451576_0024162
717 Ga0495618_0059670
718 Ga0495630_0137077
719 Ga0495598_0010314
720 Ga0495622_0000001
721 Ga0495667_0005541
722 Ga0495657_0000467
723 Ga0495613_0010428
724 Ga0495613_0018374
725 Ga0495674_0026241
726 Ga0496102_0196293
727 Ga0496109_0126410
728 Ga0496113_0066243
729 Ga0501033_0015028
730 Ga0501034_0013921
731 Ga0501034_0051857
732 Ga0501036_0020264
733 Ga0501036_0084874
734 Ga0501038_0030007
735 Ga0501039_0013704
736 Ga0501043_0013907
737 Ga0501043_0111146
738 Ga0501046_0024560
739 Ga0501046_0171938
740 Ga0501047_0002111
741 Ga0501047_0003254
742 Ga0501047_0031407
743 Ga0501047_0266794
744 Ga0501067_0009244
745 Ga0501069_0052382
746 Ga0501071_0095797
747 Ga0501072_0032894
748 Ga0501072_0051155
749 Ga0501072_0054934
750 Ga0501073_0013916
751 Ga0501073_0079478
752 Ga0501076_0023968
753 Ga0501076_0085864
754 Ga0501076_0123486
755 Ga0501079_0059771
756 Ga0501080_0005706
757 Ga0501080_0052252
758 Ga0501081_0097944
759 Ga0501083_0011113
760 Ga0501283_000871
761 Ga0501044_0028581
762 Ga0501045_0081300
763 nmdc:mga0k408_110994_c1
764 nmdc:mga0k408_11166_c1
765 nmdc:mga05p37_22942_c1
766 nmdc:mga05p37_26445_c1
767 nmdc:mga05p37_281480_c1
768 nmdc:mga05p37_315146_c1
769 nmdc:mga05p37_42178_c1
770 nmdc:mga05p37_68521_c1
771 nmdc:mga05p37_6872_c2
772 nmdc:mga09592_1446_c1
773 nmdc:mga09592_15604_c1
774 nmdc:mga09592_42393_c1
775 nmdc:mga0qj67_3807_c1
776 nmdc:mga0qj67_51732_c1
777 nmdc:mga06r32_1853_c1
778 nmdc:mga08y16_103519_c1
779 nmdc:mga08y16_125217_c1
780 nmdc:mga08y16_25573_c1
781 nmdc:mga08y16_33192_c1
782 nmdc:mga08y16_46939_c1
783 nmdc:mga08y16_6_c1
784 nmdc:mga0n895_109296_c1
785 nmdc:mga0n895_124195_c1
786 nmdc:mga0n895_172463_c1
787 nmdc:mga0n895_272187_c1
788 nmdc:mga0n895_273037_c1
789 nmdc:mga0n895_88349_c2
790 nmdc:mga0a205_108198_c1
791 nmdc:mga0a205_1172_c1
792 nmdc:mga0a205_4054_c1
793 nmdc:mga0a205_80346_c1
794 nmdc:mga0a205_9105_c1
795 Ga0500646_0010768
796 Ga0500555_032324
797 Ga0500645_009730
798 Ga0501084_0011751
799 Ga0501084_0011999
800 Ga0501082_0016683
801 Ga0501082_0055974
802 Ga0501082_0065016
803 2894514782
804 8055591881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

25

365

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfh-assembly1.cif.gz_A structure of glutamate transporter homolog from pyrococcus horikoshii 0.8734 6 400
2nwl-assembly1.cif.gz_A crystal structure of gltph in complex with l-asp 0.8636 9 401
2nwl-assembly1.cif.gz_C crystal structure of gltph in complex with l-asp 0.863 9 401
2nwx-assembly1.cif.gz_A crystal structure of gltph in complex with l-aspartate and sodium ions 0.8592 11 401
2nwl-assembly1.cif.gz_B crystal structure of gltph in complex with l-asp 0.8588 9 401
ID Description Score Start End Superfamily
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.958 8 406 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9406 5 406 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9331 8 406 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9295 5 406 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9231 4 406 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A839P4Q8-F1-model_v4 Aerobic C4-dicarboxylate transport protein 0.9706 8 416 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A098LKM9-F1-model_v4 C4-dicarboxylate transport protein 0.9701 8 406 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A2V9FLG8-F1-model_v4 C4-dicarboxylate transporter DctA 0.9687 8 414 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A562LDA0-F1-model_v4 Aerobic C4-dicarboxylate transport protein 0.9682 8 416 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A537UEW1-F1-model_v4 C4-dicarboxylate transport protein 0.9679 8 416 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778

Map