F434995

General Info

Members Datasets Scaffolds Average Seq Length
401 249 390 314

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055066027|8055070223
Length 334
Sequence VNAAVVGSFDHPPRYEPFDLPAPVDEDQVVVDVLAVGLHPRVRTGASGRHYTSTGKLPMVPGVDGVGRLEDGRLVYFVADDELTGPMATRTVVDARRCVPLPEGADVVKIAAAMNPAMSSWVALRRRVPIRPGQSVLVLGATGNAGQMAIQVAKRLGAGRVVGAGRDPGRLALLPGIGADATVALTGTAEATGAALAEAAAEVDLVIDYLWGVPAAAAIMSLLLGRADRGRELNWIQIGSVAGPVIELPSVALRSANFRLQGNGQGAVSTRAYLEELPALMDEIDHGGIAIAARALPLADVESVWTAPETPGVRTVLVTTESCLDQAGVPRPAE

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
6 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
7 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
8 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
9 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
10 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
235 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
238 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
239 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
247 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 8.48
Rhizosphere 72.07
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10052341 3300003320 Bacteria 4344
2 Ga0068869_100190704 3300005334 Bacteria 1611
3 Ga0070666_10234801 3300005335 Bacteria 1296
4 Ga0068868_100071934 3300005338 Bacteria 2758
5 Ga0070660_100226452 3300005339 Bacteria 1520
6 Ga0070689_100359053 3300005340 Bacteria 1224
7 Ga0070691_10162086 3300005341 Bacteria 1153
8 Ga0070659_100344837 3300005366 Bacteria 1249
9 Ga0070667_100211191 3300005367 Bacteria 1725
10 Ga0070709_10015264 3300005434 Bacteria 4366
11 Ga0070709_10076222 3300005434 Bacteria 2177
12 Ga0070714_100045862 3300005435 Bacteria 3706
13 Ga0070713_100027357 3300005436 Bacteria 4488
14 Ga0070713_100075972 3300005436 Bacteria 2851
15 Ga0070713_100269913 3300005436 Bacteria 1557
16 Ga0070711_100201157 3300005439 Bacteria 1537
17 Ga0070705_100090190 3300005440 Bacteria 1907
18 Ga0070708_100400935 3300005445 Bacteria 1293
19 Ga0070681_10050387 3300005458 Bacteria 4154
20 Ga0070679_100361512 3300005530 Bacteria 1399
21 Ga0068853_100066398 3300005539 Bacteria 3132
22 Ga0070693_100253027 3300005547 Bacteria 1168
23 Ga0070665_100012808 3300005548 Bacteria 8447
24 Ga0070704_100153849 3300005549 Bacteria 1811
25 Ga0070664_100291379 3300005564 Bacteria 1474
26 Ga0068854_100033931 3300005578 Bacteria 3560
27 Ga0070702_100158707 3300005615 Bacteria 1460
28 Ga0068860_100450442 3300005843 Bacteria 1280
29 Ga0081540_1018353 3300005983 Bacteria 4294
30 Ga0070717_10072154 3300006028 Bacteria 2882
31 Ga0070715_10022616 3300006163 Bacteria 2453
32 Ga0070716_100004817 3300006173 Bacteria 6484
33 Ga0070716_100147125 3300006173 Bacteria 1510
34 Ga0070712_100236773 3300006175 Bacteria 1452
35 Ga0068871_100268291 3300006358 Bacteria 1490
36 Ga0068865_100288229 3300006881 Bacteria 1309
37 Ga0105244_10012568 3300009036 Bacteria 4994
38 Ga0105244_10018083 3300009036 Bacteria 3966
39 Ga0105245_10037962 3300009098 Bacteria 4284
40 Ga0105247_10115144 3300009101 Bacteria 1735
41 Ga0105243_10001283 3300009148 Bacteria 22557
42 Ga0105243_10090508 3300009148 Bacteria 2518
43 Ga0105243_10189388 3300009148 Bacteria 1796
44 Ga0105242_10278341 3300009176 Bacteria 1519
45 Ga0105242_10714240 3300009176 Bacteria 982
46 Ga0105248_10027583 3300009177 Bacteria 6324
47 Ga0105239_10570861 3300010375 Bacteria 1289
48 Ga0105246_10234637 3300011119 Bacteria 1447
49 Ga0157373_10024703 3300013100 Bacteria 4351
50 Ga0157374_10147917 3300013296 Bacteria 2282
51 Ga0157378_10322226 3300013297 Bacteria 1502
52 Ga0157375_10043990 3300013308 Bacteria 4334
53 Ga0213875_10000479 3300021388 Bacteria 34018
54 Ga0224572_1009079 3300024225 Bacteria 1849
55 Ga0207655_1003916 3300025728 Bacteria 10807
56 Ga0207655_1009134 3300025728 Bacteria 6195
57 Ga0207692_10247456 3300025898 Bacteria 1067
58 Ga0207688_10106847 3300025901 Bacteria 1621
59 Ga0207643_10048739 3300025908 Bacteria 2400
60 Ga0207695_10292847 3300025913 Bacteria 1520
61 Ga0207663_10076201 3300025916 Bacteria 2178
62 Ga0207663_10177250 3300025916 Bacteria 1519
63 Ga0207662_10310984 3300025918 Bacteria 1050
64 Ga0207657_10027161 3300025919 Bacteria 5246
65 Ga0207652_10229830 3300025921 Bacteria 1672
66 Ga0207652_10257446 3300025921 Bacteria 1574
67 Ga0207687_10026203 3300025927 Bacteria 3902
68 Ga0207687_10230730 3300025927 Bacteria 1462
69 Ga0207700_10039195 3300025928 Bacteria 3447
70 Ga0207700_10095047 3300025928 Bacteria 2363
71 Ga0207664_10033025 3300025929 Bacteria 3972
72 Ga0207664_10040485 3300025929 Bacteria 3624
73 Ga0207664_10042252 3300025929 Bacteria 3557
74 Ga0207664_10356586 3300025929 Bacteria 1295
75 Ga0207690_10449648 3300025932 Bacteria 1035
76 Ga0207706_10253678 3300025933 Bacteria 1536
77 Ga0207709_10007034 3300025935 Bacteria 6290
78 Ga0207709_10176253 3300025935 Bacteria 1505
79 Ga0207665_10003430 3300025939 Bacteria 10604
80 Ga0207665_10008497 3300025939 Bacteria 6760
81 Ga0207689_10013408 3300025942 Bacteria 6997
82 Ga0207651_10071112 3300025960 Bacteria 2465
83 Ga0207668_10249337 3300025972 Bacteria 1441
84 Ga0207658_10290160 3300025986 Bacteria 1406
85 Ga0207674_10488587 3300026116 Bacteria 1190
86 Ga0207675_100047803 3300026118 Bacteria 3994
87 Ga0207683_10009268 3300026121 Bacteria 8387
88 Ga0268266_10087347 3300028379 Bacteria 2728
89 Ga0265337_1000507 3300028556 Bacteria 20709
90 Ga0265326_10001842 3300028558 Bacteria 7272
91 Ga0265326_10007046 3300028558 Bacteria 3463
92 Ga0265319_1007530 3300028563 Bacteria 4881
93 Ga0265334_10002024 3300028573 Bacteria 9595
94 Ga0265322_10020776 3300028654 Bacteria 1881
95 Ga0265336_10013023 3300028666 Bacteria 2782
96 Ga0307517_10014971 3300028786 Bacteria 10348
97 Ga0307517_10043638 3300028786 Bacteria 4769
98 Ga0307515_10023453 3300028794 Bacteria 10810
99 Ga0307515_10037004 3300028794 Bacteria 7867
100 Ga0307515_10230145 3300028794 Bacteria 1648
101 Ga0265338_10000683 3300028800 Bacteria 58337
102 Ga0265338_10014715 3300028800 Bacteria 8668
103 Ga0265338_10022602 3300028800 Bacteria 6502
104 Ga0265338_10038968 3300028800 Bacteria 4492
105 Ga0265324_10016624 3300029957 Bacteria 2681
106 Ga0307511_10000740 3300030521 Bacteria 34869
107 Ga0307512_10010839 3300030522 Bacteria 8667
108 Ga0265332_10002202 3300031238 Bacteria 10000
109 Ga0265332_10008339 3300031238 Bacteria 4656
110 Ga0265328_10055032 3300031239 Bacteria 1460
111 Ga0265320_10022349 3300031240 Bacteria 3384
112 Ga0265325_10004803 3300031241 Bacteria 8464
113 Ga0265325_10037590 3300031241 Bacteria 2559
114 Ga0265340_10001310 3300031247 Bacteria 14258
115 Ga0265340_10002111 3300031247 Bacteria 11390
116 Ga0265340_10014614 3300031247 Bacteria 4095
117 Ga0265340_10025343 3300031247 Bacteria 3004
118 Ga0265340_10042220 3300031247 Bacteria 2240
119 Ga0265339_10153083 3300031249 Bacteria 1164
120 Ga0265316_10022331 3300031344 Bacteria 5337
121 Ga0307513_10011124 3300031456 Bacteria 11212
122 Ga0307513_10061389 3300031456 Bacteria 3980
123 Ga0307509_10011993 3300031507 Bacteria 10410
124 Ga0307509_10023171 3300031507 Bacteria 6982
125 Ga0307509_10090955 3300031507 Bacteria 3125
126 Ga0265313_10007753 3300031595 Bacteria 7264
127 Ga0265313_10032716 3300031595 Bacteria 2651
128 Ga0307508_10009287 3300031616 Bacteria 9049
129 Ga0307508_10026489 3300031616 Bacteria 5255
130 Ga0307508_10031495 3300031616 Bacteria 4794
131 Ga0307508_10046380 3300031616 Bacteria 3880
132 Ga0307508_10194922 3300031616 Bacteria 1627
133 Ga0307514_10004019 3300031649 Bacteria 13689
134 Ga0307514_10163436 3300031649 Bacteria 1469
135 Ga0265314_10004962 3300031711 Bacteria 12137
136 Ga0265314_10088532 3300031711 Bacteria 2021
137 Ga0265342_10030686 3300031712 Bacteria 3328
138 Ga0265342_10051127 3300031712 Bacteria 2467
139 Ga0307516_10017893 3300031730 Bacteria 7380
140 Ga0307516_10058608 3300031730 Bacteria 3748
141 Ga0307516_10104783 3300031730 Bacteria 2640
142 Ga0307516_10213031 3300031730 Bacteria 1645
143 Ga0307518_10056464 3300031838 Bacteria 2852
144 Ga0307507_10021642 3300033179 Bacteria 7142
145 Ga0307507_10039217 3300033179 Bacteria 4785
146 Ga0307507_10046542 3300033179 Bacteria 4250
147 Ga0307507_10096172 3300033179 Bacteria 2507
148 Ga0307507_10104181 3300033179 Bacteria 2356
149 Ga0307510_10140197 3300033180 Bacteria 2063
150 Ga0307510_10178348 3300033180 Bacteria 1691
151 Ga0307510_10215008 3300033180 Bacteria 1440
152 Ga0373926_0001528 3300035083 Bacteria 7094
153 Ga0373944_0001725 3300035089 Bacteria 5524
154 Ga0373951_0000022 3300035091 Bacteria 61753
155 Ga0373923_0001089 3300035111 Bacteria 7478
156 Ga0373936_0002173 3300035113 Bacteria 7309
157 Ga0373941_0024138 3300035115 Bacteria 1744
158 Ga0373945_0000254 3300035116 Bacteria 14906
159 Ga0373953_0051785 3300035117 Bacteria 1661
160 Ga0373956_0075639 3300035119 Bacteria 1540
161 Ga0373943_0003809 3300035170 Bacteria 6850
162 Ga0373946_0002455 3300035171 Bacteria 6554
163 Ga0373946_0073670 3300035171 Bacteria 1481
164 Ga0373955_0002045 3300035172 Bacteria 8678
165 Ga0373924_0002046 3300035410 Bacteria 6723
166 Ga0373931_0027564 3300035691 Bacteria 2901
167 Ga0373931_0092462 3300035691 Bacteria 1687
168 Ga0373935_0013584 3300035692 Bacteria 4915
169 Ga0373927_0007050 3300035695 Bacteria 7624
170 Ga0373933_0005892 3300035724 Bacteria 6666
171 Ga0373947_0002168 3300035725 Bacteria 11920
172 Ga0373937_0004466 3300036401 Bacteria 11884
173 Ga0373925_0000043 3300037068 Bacteria 134268
174 Ga0373925_0009478 3300037068 Bacteria 7088
175 Ga0373925_0015679 3300037068 Bacteria 5483
176 Ga0436364_1299779 3300037853 Bacteria 159755
177 Ga0436365_0604418 3300039437 Bacteria 996
178 Ga0451791_1699598 3300041451 Bacteria 1118
179 Ga0451793_1363277 3300041452 Bacteria 3164
180 Ga0495592_0017989 3300046454 Bacteria 5369
181 Ga0495592_0076327 3300046454 Bacteria 2432
182 Ga0495592_0080665 3300046454 Bacteria 2353
183 Ga0495603_0014589 3300046455 Bacteria 4751
184 Ga0495590_0026215 3300046457 Bacteria 2047
185 Ga0495629_0009125 3300046459 Bacteria 7265
186 Ga0495629_0105549 3300046459 Bacteria 1965
187 Ga0495629_0106111 3300046459 Bacteria 1959
188 Ga0495629_0180397 3300046459 Bacteria 1463
189 Ga0495641_0005718 3300046461 Bacteria 8270
190 Ga0495651_0010855 3300046462 Bacteria 7004
191 Ga0495651_0027381 3300046462 Bacteria 4439
192 Ga0495651_0111740 3300046462 Bacteria 2019
193 Ga0495653_0011192 3300046463 Bacteria 7332
194 Ga0495653_0191342 3300046463 Bacteria 1395
195 Ga0495580_0004793 3300046472 Bacteria 11328
196 Ga0495582_0005215 3300046473 Bacteria 7271
197 Ga0495639_0000402 3300046475 Bacteria 20524
198 Ga0495639_0067060 3300046475 Bacteria 1653
199 Ga0495662_0004508 3300046476 Bacteria 6984
200 Ga0495662_0007824 3300046476 Bacteria 5261
201 Ga0495664_0000936 3300046477 Bacteria 15066
202 Ga0495664_0002285 3300046477 Bacteria 10270
203 Ga0495664_0176633 3300046477 Bacteria 1295
204 Ga0495594_0001951 3300046499 Bacteria 10762
205 Ga0495594_0107954 3300046499 Bacteria 1568
206 Ga0495608_0008380 3300046511 Bacteria 7245
207 Ga0495618_0001484 3300046514 Bacteria 15746
208 Ga0495618_0073487 3300046514 Bacteria 2177
209 Ga0495628_0012190 3300046516 Bacteria 7245
210 Ga0495628_0048161 3300046516 Bacteria 3379
211 Ga0495628_0070856 3300046516 Bacteria 2717
212 Ga0495630_0009397 3300046517 Bacteria 7025
213 Ga0495630_0012279 3300046517 Bacteria 6215
214 Ga0495630_0112399 3300046517 Bacteria 2063
215 Ga0495637_0038451 3300046520 Bacteria 2072
216 Ga0495643_0002762 3300046522 Bacteria 13430
217 Ga0495652_0001328 3300046529 Bacteria 27560
218 Ga0495652_0013849 3300046529 Bacteria 7254
219 Ga0495652_0202555 3300046529 Bacteria 1505
220 Ga0495652_0247277 3300046529 Bacteria 1323
221 Ga0495640_0009493 3300046533 Bacteria 7577
222 Ga0495640_0032690 3300046533 Bacteria 3703
223 Ga0495587_0003578 3300046536 Bacteria 10345
224 Ga0495587_0004256 3300046536 Bacteria 9461
225 Ga0495645_0010419 3300046543 Bacteria 6515
226 Ga0495645_0013920 3300046543 Bacteria 5702
227 Ga0495622_0052467 3300046557 Bacteria 1892
228 Ga0495667_0004154 3300046559 Bacteria 9740
229 Ga0495668_0090763 3300046616 Bacteria 1674
230 Ga0495634_0007468 3300046642 Bacteria 8207
231 Ga0495634_0140804 3300046642 Bacteria 1531
232 Ga0495611_0047663 3300046648 Bacteria 1924
233 Ga0495625_0054554 3300046660 Bacteria 2853
234 Ga0495635_0000283 3300046663 Bacteria 32627
235 Ga0495635_0009141 3300046663 Bacteria 6917
236 Ga0495635_0010440 3300046663 Bacteria 6496
237 Ga0495635_0110647 3300046663 Bacteria 1876
238 Ga0495588_0019721 3300046674 Bacteria 3307
239 Ga0495588_0035780 3300046674 Bacteria 2517
240 Ga0495657_0000049 3300046675 Bacteria 103042
241 Ga0495657_0002719 3300046675 Bacteria 14760
242 Ga0495599_0006184 3300046678 Bacteria 7216
243 Ga0495623_0030102 3300046679 Bacteria 3492
244 Ga0495623_0116297 3300046679 Bacteria 1616
245 Ga0495646_0005769 3300046680 Bacteria 7851
246 Ga0495646_0008601 3300046680 Bacteria 6484
247 Ga0495646_0036378 3300046680 Bacteria 3050
248 Ga0495646_0052101 3300046680 Bacteria 2474
249 Ga0495646_0068886 3300046680 Bacteria 2088
250 Ga0495646_0165050 3300046680 Bacteria 1224
251 Ga0495658_0002687 3300046683 Bacteria 8951
252 Ga0495658_0044405 3300046683 Bacteria 2490
253 Ga0495658_0112649 3300046683 Bacteria 1637
254 Ga0495613_0001023 3300046689 Bacteria 21297
255 Ga0495613_0019182 3300046689 Bacteria 5097
256 Ga0495613_0061291 3300046689 Bacteria 2755
257 Ga0495624_0039367 3300046690 Bacteria 3031
258 Ga0495670_0002060 3300046691 Bacteria 9911
259 Ga0495671_0012888 3300046692 Bacteria 4551
260 Ga0495600_0007779 3300046809 Bacteria 6561
261 Ga0495600_0074924 3300046809 Bacteria 2210
262 Ga0495600_0086706 3300046809 Bacteria 2042
263 Ga0495660_0005929 3300046810 Bacteria 7277
264 Ga0495581_0001210 3300047315 Bacteria 14209
265 Ga0495581_0009453 3300047315 Bacteria 5641
266 Ga0495604_0008042 3300047317 Bacteria 8355
267 Ga0495604_0011554 3300047317 Bacteria 7017
268 Ga0495674_0003698 3300047319 Bacteria 14878
269 Ga0495674_0035452 3300047319 Bacteria 4501
270 Ga0495676_0001517 3300047321 Bacteria 20088
271 Ga0495676_0004674 3300047321 Bacteria 12535
272 Ga0495680_0003765 3300047322 Bacteria 14752
273 Ga0495680_0004527 3300047322 Bacteria 13280
274 Ga0495683_0084677 3300047323 Bacteria 1542
275 Ga0495687_004564 3300047443 Bacteria 9278
276 Ga0495687_020175 3300047443 Bacteria 3254
277 Ga0495687_043467 3300047443 Bacteria 1957
278 Ga0495675_0007037 3300047444 Bacteria 6918
279 Ga0495679_038419 3300047446 Bacteria 1499
280 Ga0495685_000149 3300047447 Bacteria 23647
281 Ga0495681_0022192 3300047470 Bacteria 3403
282 Ga0495681_0033467 3300047470 Bacteria 2573
283 Ga0495684_0003423 3300047471 Bacteria 12435
284 Ga0495686_0012020 3300047472 Bacteria 6084
285 Ga0495686_0017806 3300047472 Bacteria 4781
286 Ga0495686_0133629 3300047472 Bacteria 1469
287 Ga0495593_0002037 3300047673 Bacteria 12051
288 Ga0495602_0045519 3300048088 Bacteria 3970
289 Ga0495602_0048205 3300048088 Bacteria 3832
290 Ga0495614_0007168 3300048089 Bacteria 4971
291 Ga0495614_0014413 3300048089 Bacteria 3459
292 Ga0496101_0433318 3300048904 Bacteria 1037
293 Ga0496102_0074933 3300048905 Bacteria 3111
294 Ga0496102_0149132 3300048905 Bacteria 2196
295 Ga0496102_0150244 3300048905 Bacteria 2188
296 Ga0496104_0009180 3300048907 Bacteria 8794
297 Ga0496105_0002510 3300048908 Bacteria 13311
298 Ga0496105_0107834 3300048908 Bacteria 2299
299 Ga0496108_0000034 3300048911 Bacteria 157614
300 Ga0496108_0000088 3300048911 Bacteria 97568
301 Ga0496108_0033233 3300048911 Bacteria 4285
302 Ga0496108_0057082 3300048911 Bacteria 3280
303 Ga0496108_0178653 3300048911 Bacteria 1838
304 Ga0496108_0235620 3300048911 Bacteria 1592
305 Ga0496109_0000929 3300048912 Bacteria 24273
306 Ga0496109_0008337 3300048912 Bacteria 8802
307 Ga0496109_0022492 3300048912 Bacteria 5585
308 Ga0496110_0081234 3300048913 Bacteria 2889
309 Ga0496110_0245761 3300048913 Bacteria 1629
310 Ga0496111_0000275 3300048914 Bacteria 24943
311 Ga0496111_0056772 3300048914 Bacteria 2833
312 Ga0496112_0186984 3300048915 Bacteria 2034
313 Ga0496112_0204833 3300048915 Bacteria 1931
314 Ga0496113_0050908 3300048916 Bacteria 3089
315 Ga0496113_0105623 3300048916 Bacteria 2187
316 Ga0496114_0010187 3300048917 Bacteria 7480
317 Ga0496114_0032105 3300048917 Bacteria 4320
318 Ga0496114_0034502 3300048917 Bacteria 4175
319 Ga0496114_0083494 3300048917 Bacteria 2703
320 Ga0496114_0084056 3300048917 Bacteria 2694
321 Ga0496114_0154576 3300048917 Bacteria 1991
322 Ga0496115_0260761 3300048918 Bacteria 1425
323 Ga0496117_0000014 3300048920 Bacteria 584427
324 Ga0496117_0036792 3300048920 Bacteria 3657
325 Ga0496117_0041678 3300048920 Bacteria 3360
326 Ga0496119_0000989 3300048922 Bacteria 36539
327 Ga0496119_0023275 3300048922 Bacteria 4402
328 Ga0496119_0046893 3300048922 Bacteria 2693
329 Ga0496120_0000284 3300048923 Bacteria 85391
330 Ga0496120_0016998 3300048923 Bacteria 4732
331 Ga0496121_0003323 3300048924 Bacteria 23087
332 Ga0496121_0091061 3300048924 Bacteria 2382
333 Ga0496122_0001399 3300048925 Bacteria 39179
334 Ga0496122_0034556 3300048925 Bacteria 4135
335 Ga0496123_0002140 3300048926 Bacteria 25245
336 Ga0496124_0015340 3300048927 Bacteria 7352
337 Ga0496125_0004920 3300048928 Bacteria 15121
338 Ga0496125_0034319 3300048928 Bacteria 4474
339 Ga0496126_0000072 3300048929 Bacteria 238130
340 Ga0496126_0013607 3300048929 Bacteria 8261
341 Ga0496126_0034464 3300048929 Bacteria 4755
342 Ga0496126_0219920 3300048929 Bacteria 1596
343 Ga0501031_0072516 3300049568 Bacteria 2242
344 Ga0501032_0024558 3300049569 Bacteria 4159
345 Ga0501032_0035779 3300049569 Bacteria 3393
346 Ga0501034_0046537 3300049571 Bacteria 4383
347 Ga0501034_0149224 3300049571 Bacteria 2314
348 Ga0501034_0159488 3300049571 Bacteria 2228
349 Ga0501036_0009183 3300049572 Bacteria 8130
350 Ga0501036_0431254 3300049572 Bacteria 1099
351 Ga0501038_0008113 3300049574 Bacteria 9665
352 Ga0501043_0103678 3300049579 Bacteria 2235
353 Ga0501046_0155017 3300049580 Bacteria 1726
354 Ga0501047_0003022 3300049581 Bacteria 15953
355 Ga0501047_0010409 3300049581 Bacteria 8800
356 Ga0501067_0047371 3300049583 Bacteria 2384
357 Ga0501073_0060132 3300049589 Bacteria 2652
358 Ga0501083_0044132 3300049744 Bacteria 3018
359 Ga0501035_0041048 3300049822 Bacteria 4178
360 Ga0501035_0049434 3300049822 Bacteria 3768
361 Ga0501044_0020572 3300049823 Bacteria 7044
362 Ga0501044_0225664 3300049823 Bacteria 1823
363 nmdc:mga0rr50_369380_c1 3300050513 Bacteria 1208
364 Ga0495601_0001038 3300053077 Bacteria 15167
365 Ga0495601_0004822 3300053077 Bacteria 7820
366 Ga0495601_0010611 3300053077 Bacteria 5489
367 Ga0495601_0066949 3300053077 Bacteria 2287
368 Ga0495612_0000259 3300053078 Bacteria 21895
369 Ga0495612_0004182 3300053078 Bacteria 5985
370 Ga0495595_0006181 3300053084 Bacteria 4871
371 Ga0495619_0003369 3300053085 Bacteria 10333
372 Ga0495619_0197129 3300053085 Bacteria 1394
373 Ga0500640_007579 3300053095 Bacteria 4236
374 Ga0500556_0001754 3300053104 Bacteria 8136
375 Ga0500560_067924 3300053107 Bacteria 1171
376 Ga0500569_006090 3300053109 Bacteria 2629
377 Ga0500594_0015601 3300053118 Bacteria 1834
378 Ga0500621_038036 3300053126 Bacteria 1935
379 Ga0500628_001716 3300053129 Bacteria 3695
380 Ga0500652_003780 3300053131 Bacteria 4617
381 Ga0500658_0007885 3300053134 Bacteria 3934
382 Ga0500600_0038919 3300053149 Bacteria 2751
383 Ga0500616_0000088 3300053153 Bacteria 191662
384 Ga0500616_0123565 3300053153 Bacteria 1232
385 Ga0500624_001245 3300053157 Bacteria 4497
386 Ga0500633_0003061 3300053160 Bacteria 3577
387 Ga0500634_0001952 3300053161 Bacteria 8410
388 Ga0500656_000115 3300053732 Bacteria 4624
389 Ga0500587_002216 3300053739 Bacteria 2767
390 Ga0501082_0007790 3300060353 Bacteria 9241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0004920 Ga0496125_0004920_9537_10349 261
2 3300010375 Ga0105239_10570861 Ga0105239_105708612 262
3 3300009176 Ga0105242_10714240 Ga0105242_107142402 263
4 3300025901 Ga0207688_10106847 Ga0207688_101068471 263
5 3300025927 Ga0207687_10230730 Ga0207687_102307302 263
6 3300035171 Ga0373946_0073670 Ga0373946_0073670_27_938 269
7 3300048917 Ga0496114_0154576 Ga0496114_0154576_106_996 270
8 3300028794 Ga0307515_10230145 Ga0307515_102301452 271
9 3300031456 Ga0307513_10061389 Ga0307513_100613892 271
10 3300009148 Ga0105243_10189388 Ga0105243_101893882 275
11 3300035091 Ga0373951_0000022 Ga0373951_0000022_27327_28292 280
12 3300039437 Ga0436365_0604418 Ga0436365_0604418_115_969 281
13 3300049568 Ga0501031_0072516 Ga0501031_0072516_983_1915 286
14 3300049569 Ga0501032_0035779 Ga0501032_0035779_1243_2175 286
15 3300049571 Ga0501034_0046537 Ga0501034_0046537_3343_4275 286
16 3300049572 Ga0501036_0431254 Ga0501036_0431254_83_1015 286
17 3300049574 Ga0501038_0008113 Ga0501038_0008113_5358_6290 286
18 3300049580 Ga0501046_0155017 Ga0501046_0155017_720_1652 286
19 3300049581 Ga0501047_0010409 Ga0501047_0010409_6529_7461 286
20 3300049583 Ga0501067_0047371 Ga0501067_0047371_1373_2305 286
21 3300049589 Ga0501073_0060132 Ga0501073_0060132_675_1607 286
22 3300049744 Ga0501083_0044132 Ga0501083_0044132_1737_2669 286
23 3300049822 Ga0501035_0049434 Ga0501035_0049434_505_1437 286
24 3300049823 Ga0501044_0020572 Ga0501044_0020572_3059_3991 286
25 3300060353 Ga0501082_0007790 Ga0501082_0007790_7068_8000 286
26 3300048911 Ga0496108_0000088 Ga0496108_0000088_61637_62563 287
27 iso_pu_bacteria 2751185782 2753271729 287
28 3300048904 Ga0496101_0433318 Ga0496101_0433318_122_1027 288
29 3300031247 Ga0265340_10001310 Ga0265340_100013102 290
30 3300037068 Ga0373925_0000043 Ga0373925_0000043_123400_124359 290
31 3300033179 Ga0307507_10104181 Ga0307507_101041811 291
32 3300053153 Ga0500616_0000088 Ga0500616_0000088_179981_180931 291
33 3300031239 Ga0265328_10055032 Ga0265328_100550321 292
34 3300021388 Ga0213875_10000479 Ga0213875_100004792 294
35 3300025918 Ga0207662_10310984 Ga0207662_103109841 294
36 3300033179 Ga0307507_10096172 Ga0307507_100961723 294
37 3300037853 Ga0436364_1299779 Ga0436364_1299779_142943_143878 294
38 3300005367 Ga0070667_100211191 Ga0070667_1002111912 295
39 3300009148 Ga0105243_10090508 Ga0105243_100905082 295
40 3300031247 Ga0265340_10025343 Ga0265340_100253433 295
41 3300025929 Ga0207664_10040485 Ga0207664_100404851 296
42 3300031838 Ga0307518_10056464 Ga0307518_100564641 296
43 3300048929 Ga0496126_0000072 Ga0496126_0000072_220603_221562 296
44 3300005445 Ga0070708_100400935 Ga0070708_1004009351 297
45 3300035119 Ga0373956_0075639 Ga0373956_0075639_303_1295 297
46 3300046477 Ga0495664_0176633 Ga0495664_0176633_186_1181 297
47 3300046517 Ga0495630_0112399 Ga0495630_0112399_675_1670 297
48 3300046529 Ga0495652_0247277 Ga0495652_0247277_249_1244 297
49 3300046533 Ga0495640_0032690 Ga0495640_0032690_1327_2322 297
50 3300046663 Ga0495635_0110647 Ga0495635_0110647_290_1285 297
51 3300047319 Ga0495674_0003698 Ga0495674_0003698_10817_11812 297
52 3300053077 Ga0495601_0066949 Ga0495601_0066949_142_1137 297
53 3300006028 Ga0070717_10072154 Ga0070717_100721543 298
54 3300009098 Ga0105245_10037962 Ga0105245_100379624 298
55 3300025927 Ga0207687_10026203 Ga0207687_100262035 298
56 3300005340 Ga0070689_100359053 Ga0070689_1003590531 299
57 3300005366 Ga0070659_100344837 Ga0070659_1003448371 299
58 3300005547 Ga0070693_100253027 Ga0070693_1002530271 299
59 3300005578 Ga0068854_100033931 Ga0068854_1000339314 299
60 3300005983 Ga0081540_1018353 Ga0081540_10183532 299
61 3300006881 Ga0068865_100288229 Ga0068865_1002882292 299
62 3300009176 Ga0105242_10278341 Ga0105242_102783411 299
63 3300013297 Ga0157378_10322226 Ga0157378_103222261 299
64 3300025728 Ga0207655_1003916 Ga0207655_100391611 299
65 3300025921 Ga0207652_10257446 Ga0207652_102574461 299
66 3300025929 Ga0207664_10356586 Ga0207664_103565862 299
67 3300025932 Ga0207690_10449648 Ga0207690_104496481 299
68 3300025935 Ga0207709_10007034 Ga0207709_100070345 299
69 3300025935 Ga0207709_10176253 Ga0207709_101762531 299
70 3300025942 Ga0207689_10013408 Ga0207689_100134087 299
71 3300026121 Ga0207683_10009268 Ga0207683_100092683 299
72 3300028556 Ga0265337_1000507 Ga0265337_100050716 299
73 3300028558 Ga0265326_10007046 Ga0265326_100070463 299
74 3300028563 Ga0265319_1007530 Ga0265319_10075306 299
75 3300028573 Ga0265334_10002024 Ga0265334_100020242 299
76 3300028654 Ga0265322_10020776 Ga0265322_100207761 299
77 3300028666 Ga0265336_10013023 Ga0265336_100130232 299
78 3300028800 Ga0265338_10000683 Ga0265338_1000068320 299
79 3300029957 Ga0265324_10016624 Ga0265324_100166243 299
80 3300031238 Ga0265332_10002202 Ga0265332_100022023 299
81 3300031240 Ga0265320_10022349 Ga0265320_100223493 299
82 3300031247 Ga0265340_10002111 Ga0265340_100021112 299
83 3300031249 Ga0265339_10153083 Ga0265339_101530831 299
84 3300031344 Ga0265316_10022331 Ga0265316_100223313 299
85 3300031595 Ga0265313_10007753 Ga0265313_100077533 299
86 3300031711 Ga0265314_10088532 Ga0265314_100885322 299
87 3300031712 Ga0265342_10030686 Ga0265342_100306863 299
88 iso_pu_bacteria 2751185734 2753075450 299
89 3300005436 Ga0070713_100269913 Ga0070713_1002699132 300
90 3300025728 Ga0207655_1009134 Ga0207655_10091344 300
91 3300025916 Ga0207663_10076201 Ga0207663_100762013 300
92 3300046454 Ga0495592_0076327 Ga0495592_0076327_742_1707 300
93 3300046529 Ga0495652_0001328 Ga0495652_0001328_12584_13549 300
94 3300046543 Ga0495645_0013920 Ga0495645_0013920_631_1596 300
95 3300046680 Ga0495646_0052101 Ga0495646_0052101_1163_2128 300
96 3300009036 Ga0105244_10012568 Ga0105244_100125683 301
97 3300009148 Ga0105243_10001283 Ga0105243_1000128320 301
98 3300048905 Ga0496102_0074933 Ga0496102_0074933_101_1069 301
99 3300048929 Ga0496126_0013607 Ga0496126_0013607_4915_5883 301
100 3300009036 Ga0105244_10018083 Ga0105244_100180834 302
101 3300046516 Ga0495628_0070856 Ga0495628_0070856_631_1596 302
102 3300046680 Ga0495646_0036378 Ga0495646_0036378_1954_2919 302
103 3300048925 Ga0496122_0034556 Ga0496122_0034556_493_1428 302
104 3300053077 Ga0495601_0001038 Ga0495601_0001038_5494_6459 302
105 3300005549 Ga0070704_100153849 Ga0070704_1001538492 303
106 3300013296 Ga0157374_10147917 Ga0157374_101479171 303
107 3300035691 Ga0373931_0092462 Ga0373931_0092462_84_1043 303
108 3300046516 Ga0495628_0048161 Ga0495628_0048161_453_1421 303
109 3300046529 Ga0495652_0202555 Ga0495652_0202555_247_1215 303
110 3300046680 Ga0495646_0068886 Ga0495646_0068886_822_1790 303
111 3300048908 Ga0496105_0107834 Ga0496105_0107834_1000_1959 303
112 3300048914 Ga0496111_0056772 Ga0496111_0056772_297_1256 303
113 3300049571 Ga0501034_0159488 Ga0501034_0159488_40_966 303
114 3300005338 Ga0068868_100071934 Ga0068868_1000719343 304
115 3300025960 Ga0207651_10071112 Ga0207651_100711124 304
116 3300031616 Ga0307508_10031495 Ga0307508_100314953 304
117 3300035089 Ga0373944_0001725 Ga0373944_0001725_436_1395 304
118 3300035410 Ga0373924_0002046 Ga0373924_0002046_153_1112 304
119 3300035724 Ga0373933_0005892 Ga0373933_0005892_5678_6637 304
120 3300046543 Ga0495645_0010419 Ga0495645_0010419_18_977 304
121 3300048088 Ga0495602_0048205 Ga0495602_0048205_270_1229 304
122 3300048922 Ga0496119_0046893 Ga0496119_0046893_1571_2506 304
123 3300049569 Ga0501032_0024558 Ga0501032_0024558_1532_2461 304
124 3300049571 Ga0501034_0149224 Ga0501034_0149224_229_1158 304
125 3300049572 Ga0501036_0009183 Ga0501036_0009183_1296_2225 304
126 3300049579 Ga0501043_0103678 Ga0501043_0103678_968_1897 304
127 3300049581 Ga0501047_0003022 Ga0501047_0003022_13573_14502 304
128 3300049822 Ga0501035_0041048 Ga0501035_0041048_1149_2078 304
129 3300005335 Ga0070666_10234801 Ga0070666_102348011 305
130 3300005341 Ga0070691_10162086 Ga0070691_101620861 305
131 3300005434 Ga0070709_10015264 Ga0070709_100152642 305
132 3300005434 Ga0070709_10076222 Ga0070709_100762224 305
133 3300005435 Ga0070714_100045862 Ga0070714_1000458625 305
134 3300005436 Ga0070713_100075972 Ga0070713_1000759723 305
135 3300005439 Ga0070711_100201157 Ga0070711_1002011572 305
136 3300005539 Ga0068853_100066398 Ga0068853_1000663981 305
137 3300005843 Ga0068860_100450442 Ga0068860_1004504422 305
138 3300006163 Ga0070715_10022616 Ga0070715_100226161 305
139 3300006173 Ga0070716_100004817 Ga0070716_1000048173 305
140 3300006173 Ga0070716_100147125 Ga0070716_1001471252 305
141 3300006175 Ga0070712_100236773 Ga0070712_1002367731 305
142 3300013100 Ga0157373_10024703 Ga0157373_100247033 305
143 3300024225 Ga0224572_1009079 Ga0224572_10090792 305
144 3300025913 Ga0207695_10292847 Ga0207695_102928471 305
145 3300025916 Ga0207663_10177250 Ga0207663_101772502 305
146 3300025928 Ga0207700_10039195 Ga0207700_100391954 305
147 3300025928 Ga0207700_10095047 Ga0207700_100950473 305
148 3300025929 Ga0207664_10033025 Ga0207664_100330252 305
149 3300025939 Ga0207665_10003430 Ga0207665_100034307 305
150 3300025939 Ga0207665_10008497 Ga0207665_100084971 305
151 3300026116 Ga0207674_10488587 Ga0207674_104885871 305
152 3300035115 Ga0373941_0024138 Ga0373941_0024138_27_995 305
153 3300046457 Ga0495590_0026215 Ga0495590_0026215_318_1277 305
154 3300048905 Ga0496102_0149132 Ga0496102_0149132_1068_2036 305
155 3300048911 Ga0496108_0033233 Ga0496108_0033233_417_1385 305
156 3300050513 nmdc:mga0rr50_369380_c1 nmdc:mga0rr50_369380_c1_107_1075 305
157 iso_pu_bacteria 2558860112 2558914653 305
158 3300005339 Ga0070660_100226452 Ga0070660_1002264522 306
159 3300005440 Ga0070705_100090190 Ga0070705_1000901901 306
160 3300005458 Ga0070681_10050387 Ga0070681_100503874 306
161 3300005564 Ga0070664_100291379 Ga0070664_1002913793 306
162 3300006358 Ga0068871_100268291 Ga0068871_1002682913 306
163 3300025908 Ga0207643_10048739 Ga0207643_100487391 306
164 3300025986 Ga0207658_10290160 Ga0207658_102901601 306
165 3300026118 Ga0207675_100047803 Ga0207675_1000478034 306
166 3300031238 Ga0265332_10008339 Ga0265332_100083394 306
167 3300031730 Ga0307516_10058608 Ga0307516_100586083 306
168 3300035083 Ga0373926_0001528 Ga0373926_0001528_5511_6503 306
169 3300035111 Ga0373923_0001089 Ga0373923_0001089_5965_6957 306
170 3300035113 Ga0373936_0002173 Ga0373936_0002173_833_1825 306
171 3300035116 Ga0373945_0000254 Ga0373945_0000254_5790_6782 306
172 3300035170 Ga0373943_0003809 Ga0373943_0003809_5511_6503 306
173 3300035171 Ga0373946_0002455 Ga0373946_0002455_43_1035 306
174 3300035172 Ga0373955_0002045 Ga0373955_0002045_2133_3125 306
175 3300035692 Ga0373935_0013584 Ga0373935_0013584_749_1741 306
176 3300035695 Ga0373927_0007050 Ga0373927_0007050_93_1085 306
177 3300035725 Ga0373947_0002168 Ga0373947_0002168_834_1826 306
178 3300036401 Ga0373937_0004466 Ga0373937_0004466_4949_5941 306
179 3300037068 Ga0373925_0009478 Ga0373925_0009478_5537_6529 306
180 3300046454 Ga0495592_0080665 Ga0495592_0080665_1027_2019 306
181 3300046455 Ga0495603_0014589 Ga0495603_0014589_3302_4294 306
182 3300046459 Ga0495629_0009125 Ga0495629_0009125_749_1741 306
183 3300046461 Ga0495641_0005718 Ga0495641_0005718_6554_7546 306
184 3300046462 Ga0495651_0010855 Ga0495651_0010855_502_1494 306
185 3300046463 Ga0495653_0011192 Ga0495653_0011192_5508_6500 306
186 3300046472 Ga0495580_0004793 Ga0495580_0004793_5516_6508 306
187 3300046473 Ga0495582_0005215 Ga0495582_0005215_749_1741 306
188 3300046475 Ga0495639_0000402 Ga0495639_0000402_13994_14986 306
189 3300046476 Ga0495662_0004508 Ga0495662_0004508_462_1454 306
190 3300046477 Ga0495664_0002285 Ga0495664_0002285_5503_6495 306
191 3300046499 Ga0495594_0001951 Ga0495594_0001951_5894_6886 306
192 3300046511 Ga0495608_0008380 Ga0495608_0008380_740_1732 306
193 3300046514 Ga0495618_0001484 Ga0495618_0001484_9216_10208 306
194 3300046516 Ga0495628_0012190 Ga0495628_0012190_5518_6510 306
195 3300046517 Ga0495630_0009397 Ga0495630_0009397_495_1487 306
196 3300046529 Ga0495652_0013849 Ga0495652_0013849_5523_6515 306
197 3300046533 Ga0495640_0009493 Ga0495640_0009493_749_1741 306
198 3300046536 Ga0495587_0004256 Ga0495587_0004256_5487_6479 306
199 3300046559 Ga0495667_0004154 Ga0495667_0004154_5531_6523 306
200 3300046642 Ga0495634_0007468 Ga0495634_0007468_721_1713 306
201 3300046663 Ga0495635_0010440 Ga0495635_0010440_3175_4167 306
202 3300046674 Ga0495588_0019721 Ga0495588_0019721_1728_2720 306
203 3300046675 Ga0495657_0002719 Ga0495657_0002719_7335_8327 306
204 3300046678 Ga0495599_0006184 Ga0495599_0006184_694_1686 306
205 3300046679 Ga0495623_0030102 Ga0495623_0030102_2123_3115 306
206 3300046680 Ga0495646_0005769 Ga0495646_0005769_335_1327 306
207 3300046683 Ga0495658_0002687 Ga0495658_0002687_2429_3421 306
208 3300046689 Ga0495613_0001023 Ga0495613_0001023_14341_15333 306
209 3300046809 Ga0495600_0007779 Ga0495600_0007779_31_1023 306
210 3300047315 Ga0495581_0001210 Ga0495581_0001210_187_1179 306
211 3300047317 Ga0495604_0011554 Ga0495604_0011554_5531_6523 306
212 3300047319 Ga0495674_0035452 Ga0495674_0035452_335_1327 306
213 3300047321 Ga0495676_0001517 Ga0495676_0001517_9159_10151 306
214 3300047322 Ga0495680_0003765 Ga0495680_0003765_5554_6546 306
215 3300047444 Ga0495675_0007037 Ga0495675_0007037_5474_6466 306
216 3300047471 Ga0495684_0003423 Ga0495684_0003423_6495_7487 306
217 3300047673 Ga0495593_0002037 Ga0495593_0002037_5511_6503 306
218 3300048912 Ga0496109_0022492 Ga0496109_0022492_1796_2770 306
219 3300048924 Ga0496121_0091061 Ga0496121_0091061_66_995 306
220 3300053077 Ga0495601_0004822 Ga0495601_0004822_462_1454 306
221 3300053078 Ga0495612_0004182 Ga0495612_0004182_3995_4987 306
222 3300053084 Ga0495595_0006181 Ga0495595_0006181_1806_2798 306
223 3300053085 Ga0495619_0003369 Ga0495619_0003369_3820_4812 306
224 iso_pu_bacteria 2600255286 2601640186 306
225 3300031616 Ga0307508_10194922 Ga0307508_101949222 307
226 3300041452 Ga0451793_1363277 Ga0451793_1363277_1763_2716 307
227 3300048924 Ga0496121_0003323 Ga0496121_0003323_3982_4935 307
228 3300048925 Ga0496122_0001399 Ga0496122_0001399_34674_35624 307
229 3300048926 Ga0496123_0002140 Ga0496123_0002140_15619_16569 307
230 3300005530 Ga0070679_100361512 Ga0070679_1003615121 308
231 3300005548 Ga0070665_100012808 Ga0070665_1000128089 308
232 3300025921 Ga0207652_10229830 Ga0207652_102298302 308
233 3300028379 Ga0268266_10087347 Ga0268266_100873474 308
234 3300031241 Ga0265325_10004803 Ga0265325_1000480310 308
235 3300031711 Ga0265314_10004962 Ga0265314_1000496212 308
236 3300031712 Ga0265342_10051127 Ga0265342_100511272 308
237 3300033180 Ga0307510_10215008 Ga0307510_102150082 308
238 3300048911 Ga0496108_0000034 Ga0496108_0000034_144153_145094 308
239 3300048920 Ga0496117_0041678 Ga0496117_0041678_1616_2581 308
240 3300048929 Ga0496126_0034464 Ga0496126_0034464_3200_4147 308
241 iso_pu_bacteria 2582581314 2585322203 308
242 iso_pu_bacteria 2643221615 2644091215 308
243 iso_pu_bacteria 2643221657 2644321018 308
244 iso_pu_bacteria 2728368933 2728533925 308
245 iso_pu_bacteria 2968558590 2968560575 308
246 3300005436 Ga0070713_100027357 Ga0070713_1000273571 309
247 3300013308 Ga0157375_10043990 Ga0157375_100439902 309
248 3300025929 Ga0207664_10042252 Ga0207664_100422525 309
249 3300028558 Ga0265326_10001842 Ga0265326_100018426 309
250 3300035117 Ga0373953_0051785 Ga0373953_0051785_256_1227 309
251 3300046463 Ga0495653_0191342 Ga0495653_0191342_364_1335 309
252 3300046557 Ga0495622_0052467 Ga0495622_0052467_634_1590 309
253 3300046680 Ga0495646_0165050 Ga0495646_0165050_131_1102 309
254 3300047322 Ga0495680_0004527 Ga0495680_0004527_11014_11985 309
255 3300048911 Ga0496108_0235620 Ga0496108_0235620_58_1014 309
256 3300048912 Ga0496109_0008337 Ga0496109_0008337_6911_7867 309
257 3300048916 Ga0496113_0105623 Ga0496113_0105623_346_1302 309
258 3300048917 Ga0496114_0032105 Ga0496114_0032105_684_1640 309
259 3300048917 Ga0496114_0034502 Ga0496114_0034502_1399_2355 309
260 3300048917 Ga0496114_0084056 Ga0496114_0084056_441_1397 309
261 3300048920 Ga0496117_0036792 Ga0496117_0036792_2529_3485 309
262 3300049823 Ga0501044_0225664 Ga0501044_0225664_312_1247 309
263 3300053104 Ga0500556_0001754 Ga0500556_0001754_2243_3187 309
264 iso_pu_bacteria 2971403814 2971406523 309
265 3300025972 Ga0207668_10249337 Ga0207668_102493372 310
266 3300028800 Ga0265338_10038968 Ga0265338_100389685 310
267 3300031241 Ga0265325_10037590 Ga0265325_100375903 310
268 3300031247 Ga0265340_10014614 Ga0265340_100146144 310
269 3300031247 Ga0265340_10042220 Ga0265340_100422202 310
270 3300031595 Ga0265313_10032716 Ga0265313_100327162 310
271 3300048911 Ga0496108_0178653 Ga0496108_0178653_491_1450 310
272 3300025898 Ga0207692_10247456 Ga0207692_102474561 311
273 3300028786 Ga0307517_10043638 Ga0307517_100436386 311
274 3300028794 Ga0307515_10023453 Ga0307515_100234534 311
275 3300028800 Ga0265338_10014715 Ga0265338_100147152 311
276 3300028800 Ga0265338_10022602 Ga0265338_100226026 311
277 3300031616 Ga0307508_10009287 Ga0307508_100092872 311
278 3300031649 Ga0307514_10004019 Ga0307514_100040198 311
279 3300031649 Ga0307514_10163436 Ga0307514_101634362 311
280 3300033179 Ga0307507_10039217 Ga0307507_100392174 311
281 3300033179 Ga0307507_10046542 Ga0307507_100465423 311
282 3300033180 Ga0307510_10140197 Ga0307510_101401972 311
283 3300037068 Ga0373925_0015679 Ga0373925_0015679_3116_4078 311
284 3300046459 Ga0495629_0180397 Ga0495629_0180397_199_1164 311
285 3300046660 Ga0495625_0054554 Ga0495625_0054554_164_1129 311
286 3300046674 Ga0495588_0035780 Ga0495588_0035780_1389_2354 311
287 3300046692 Ga0495671_0012888 Ga0495671_0012888_2020_2985 311
288 3300047470 Ga0495681_0022192 Ga0495681_0022192_1503_2468 311
289 3300047472 Ga0495686_0133629 Ga0495686_0133629_459_1424 311
290 3300048089 Ga0495614_0014413 Ga0495614_0014413_400_1365 311
291 3300048920 Ga0496117_0000014 Ga0496117_0000014_313232_314185 311
292 3300048922 Ga0496119_0000989 Ga0496119_0000989_4446_5399 311
293 3300048922 Ga0496119_0023275 Ga0496119_0023275_3400_4353 311
294 3300048923 Ga0496120_0000284 Ga0496120_0000284_31602_32555 311
295 3300048923 Ga0496120_0016998 Ga0496120_0016998_2389_3342 311
296 3300048927 Ga0496124_0015340 Ga0496124_0015340_1847_2800 311
297 3300048928 Ga0496125_0034319 Ga0496125_0034319_3105_4058 311
298 3300048929 Ga0496126_0219920 Ga0496126_0219920_531_1499 311
299 3300053107 Ga0500560_067924 Ga0500560_067924_178_1143 311
300 3300005334 Ga0068869_100190704 Ga0068869_1001907043 312
301 3300005615 Ga0070702_100158707 Ga0070702_1001587071 312
302 3300009101 Ga0105247_10115144 Ga0105247_101151442 312
303 3300011119 Ga0105246_10234637 Ga0105246_102346371 312
304 3300025919 Ga0207657_10027161 Ga0207657_100271611 312
305 3300025933 Ga0207706_10253678 Ga0207706_102536782 312
306 3300028786 Ga0307517_10014971 Ga0307517_100149713 312
307 3300028794 Ga0307515_10037004 Ga0307515_100370043 312
308 3300030521 Ga0307511_10000740 Ga0307511_1000074012 312
309 3300030522 Ga0307512_10010839 Ga0307512_100108394 312
310 3300031456 Ga0307513_10011124 Ga0307513_100111244 312
311 3300031507 Ga0307509_10011993 Ga0307509_100119936 312
312 3300031507 Ga0307509_10023171 Ga0307509_100231715 312
313 3300031507 Ga0307509_10090955 Ga0307509_100909552 312
314 3300031616 Ga0307508_10026489 Ga0307508_100264896 312
315 3300031616 Ga0307508_10046380 Ga0307508_100463802 312
316 3300031730 Ga0307516_10017893 Ga0307516_100178933 312
317 3300031730 Ga0307516_10104783 Ga0307516_101047832 312
318 3300031730 Ga0307516_10213031 Ga0307516_102130312 312
319 3300033179 Ga0307507_10021642 Ga0307507_100216423 312
320 3300033180 Ga0307510_10178348 Ga0307510_101783482 312
321 3300035691 Ga0373931_0027564 Ga0373931_0027564_1714_2682 312
322 3300041451 Ga0451791_1699598 Ga0451791_1699598_55_1035 312
323 3300046454 Ga0495592_0017989 Ga0495592_0017989_911_1876 312
324 3300046459 Ga0495629_0105549 Ga0495629_0105549_462_1427 312
325 3300046459 Ga0495629_0106111 Ga0495629_0106111_400_1365 312
326 3300046462 Ga0495651_0027381 Ga0495651_0027381_1569_2534 312
327 3300046462 Ga0495651_0111740 Ga0495651_0111740_131_1096 312
328 3300046475 Ga0495639_0067060 Ga0495639_0067060_133_1098 312
329 3300046476 Ga0495662_0007824 Ga0495662_0007824_1156_2121 312
330 3300046477 Ga0495664_0000936 Ga0495664_0000936_12196_13161 312
331 3300046499 Ga0495594_0107954 Ga0495594_0107954_341_1306 312
332 3300046514 Ga0495618_0073487 Ga0495618_0073487_300_1268 312
333 3300046517 Ga0495630_0012279 Ga0495630_0012279_1951_2916 312
334 3300046520 Ga0495637_0038451 Ga0495637_0038451_760_1725 312
335 3300046522 Ga0495643_0002762 Ga0495643_0002762_10793_11758 312
336 3300046536 Ga0495587_0003578 Ga0495587_0003578_483_1448 312
337 3300046616 Ga0495668_0090763 Ga0495668_0090763_648_1613 312
338 3300046642 Ga0495634_0140804 Ga0495634_0140804_59_1024 312
339 3300046648 Ga0495611_0047663 Ga0495611_0047663_684_1649 312
340 3300046663 Ga0495635_0000283 Ga0495635_0000283_1140_2105 312
341 3300046663 Ga0495635_0009141 Ga0495635_0009141_3656_4621 312
342 3300046675 Ga0495657_0000049 Ga0495657_0000049_74527_75492 312
343 3300046679 Ga0495623_0116297 Ga0495623_0116297_482_1447 312
344 3300046680 Ga0495646_0008601 Ga0495646_0008601_1767_2732 312
345 3300046683 Ga0495658_0044405 Ga0495658_0044405_907_1872 312
346 3300046683 Ga0495658_0112649 Ga0495658_0112649_515_1480 312
347 3300046689 Ga0495613_0019182 Ga0495613_0019182_1977_2942 312
348 3300046689 Ga0495613_0061291 Ga0495613_0061291_1617_2582 312
349 3300046690 Ga0495624_0039367 Ga0495624_0039367_200_1165 312
350 3300046691 Ga0495670_0002060 Ga0495670_0002060_7092_8057 312
351 3300046809 Ga0495600_0074924 Ga0495600_0074924_1002_1967 312
352 3300046809 Ga0495600_0086706 Ga0495600_0086706_483_1448 312
353 3300046810 Ga0495660_0005929 Ga0495660_0005929_1073_2038 312
354 3300047315 Ga0495581_0009453 Ga0495581_0009453_3708_4673 312
355 3300047317 Ga0495604_0008042 Ga0495604_0008042_2610_3575 312
356 3300047321 Ga0495676_0004674 Ga0495676_0004674_6026_6991 312
357 3300047323 Ga0495683_0084677 Ga0495683_0084677_498_1463 312
358 3300047443 Ga0495687_004564 Ga0495687_004564_6047_7012 312
359 3300047443 Ga0495687_020175 Ga0495687_020175_1611_2576 312
360 3300047443 Ga0495687_043467 Ga0495687_043467_922_1887 312
361 3300047446 Ga0495679_038419 Ga0495679_038419_393_1358 312
362 3300047447 Ga0495685_000149 Ga0495685_000149_12655_13620 312
363 3300047470 Ga0495681_0033467 Ga0495681_0033467_1167_2132 312
364 3300047472 Ga0495686_0012020 Ga0495686_0012020_1513_2478 312
365 3300047472 Ga0495686_0017806 Ga0495686_0017806_2291_3256 312
366 3300048088 Ga0495602_0045519 Ga0495602_0045519_836_1801 312
367 3300048089 Ga0495614_0007168 Ga0495614_0007168_3678_4643 312
368 3300048905 Ga0496102_0150244 Ga0496102_0150244_661_1629 312
369 3300048915 Ga0496112_0186984 Ga0496112_0186984_521_1489 312
370 3300048916 Ga0496113_0050908 Ga0496113_0050908_1914_2882 312
371 3300053077 Ga0495601_0010611 Ga0495601_0010611_3472_4437 312
372 3300053078 Ga0495612_0000259 Ga0495612_0000259_20438_21403 312
373 3300053085 Ga0495619_0197129 Ga0495619_0197129_169_1134 312
374 3300053095 Ga0500640_007579 Ga0500640_007579_2378_3343 312
375 3300053109 Ga0500569_006090 Ga0500569_006090_1374_2339 312
376 3300053118 Ga0500594_0015601 Ga0500594_0015601_319_1284 312
377 3300053126 Ga0500621_038036 Ga0500621_038036_888_1853 312
378 3300053129 Ga0500628_001716 Ga0500628_001716_1318_2283 312
379 3300053131 Ga0500652_003780 Ga0500652_003780_2930_3895 312
380 3300053134 Ga0500658_0007885 Ga0500658_0007885_1320_2285 312
381 3300053149 Ga0500600_0038919 Ga0500600_0038919_1167_2132 312
382 3300053153 Ga0500616_0123565 Ga0500616_0123565_221_1186 312
383 3300053157 Ga0500624_001245 Ga0500624_001245_866_1831 312
384 3300053160 Ga0500633_0003061 Ga0500633_0003061_1994_2959 312
385 3300053161 Ga0500634_0001952 Ga0500634_0001952_3282_4247 312
386 3300053732 Ga0500656_000115 Ga0500656_000115_2765_3730 312
387 3300053739 Ga0500587_002216 Ga0500587_002216_740_1705 312
388 3300048907 Ga0496104_0009180 Ga0496104_0009180_452_1441 316
389 3300048908 Ga0496105_0002510 Ga0496105_0002510_4672_5661 316
390 3300048911 Ga0496108_0057082 Ga0496108_0057082_1585_2574 316
391 3300048912 Ga0496109_0000929 Ga0496109_0000929_13016_14005 316
392 3300048913 Ga0496110_0081234 Ga0496110_0081234_607_1596 316
393 3300048913 Ga0496110_0245761 Ga0496110_0245761_130_1119 316
394 3300048914 Ga0496111_0000275 Ga0496111_0000275_13687_14676 316
395 3300048915 Ga0496112_0204833 Ga0496112_0204833_786_1775 316
396 3300048917 Ga0496114_0010187 Ga0496114_0010187_5825_6814 316
397 3300048917 Ga0496114_0083494 Ga0496114_0083494_52_1041 316
398 3300048918 Ga0496115_0260761 Ga0496115_0260761_377_1366 316
399 3300009177 Ga0105248_10027583 Ga0105248_100275833 317
400 iso_pu_bacteria 8055066027 8055070223 317
401 3300003320 rootH2_10052341 rootH2_100523412 320

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rjw-assembly1.cif.gz_C crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r 0.8216 4 311
4rvs-assembly1.cif.gz_B the native structure of mycobacterial quinone oxidoreductase rv154c. 0.8207 3 311
1f8f-assembly1.cif.gz_A crystal structure of benzyl alcohol dehydrogenase from acinetobacter calcoaceticus 0.8202 1 312
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.8197 2 311
4y1b-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp 0.8195 2 311
ID Description Score Start End Superfamily
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8945 117 176 3.90.180.10
af_Q75JW6_1_121_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.886 1 129 3.90.180.10
af_K7MH10_157_229_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8731 123 172 3.90.180.10
af_Q8IPZ3_51_184_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8714 3 110 3.90.180.10
af_Q9LK96_31_155_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8686 4 111 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6B1LG99-F1-model_v4 deleted 0.9532 4 311
AF-A0A810M5Q4-F1-model_v4 deleted 0.953 4 311
AF-A0A6B1LG99-F1-model_v4 deleted 0.9442 4 311
AF-A0A1C4NF56-F1-model_v4 Zinc-binding dehydrogenase 0.9382 153 311
AF-A0A0L8QS47-F1-model_v4 deleted 0.9363 4 311

Feature Viewer

pLDDT pTM Quality
90.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map