F434994

General Info

Members Datasets Scaffolds Average Seq Length
401 285 302 197

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005275841|8005276123
Length 228
Sequence DIPITLYGYTPVTLLASNKERDHSLNEVFMRYSVEHKLETRARVITAAGQVFRKDGYGGAGIDALTKAAGVTNGAFYGHFKSKAEAFRIAVLEGLEELRQGIAALKTNQPKDWLPTFVSYYLGYKRTCDLGESCALPSLSPDVMRADDETRNAYTAEIKRLVEEVAAGLPEHKIEGRSETSQEDQAILLLAMLSGGVTLARAVSDPALSERIADIIAQAALTAIKPHN

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
9 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
10 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
11 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
12 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
13 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
16 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
17 2519899620 Rhizobium sp. Pop5 Isolate Nodule
18 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
19 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
20 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
21 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
22 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
23 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
24 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
25 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
26 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
27 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
28 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
29 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
30 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
31 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
32 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
33 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
34 2718217927 Rhizobium sp. N324 Isolate Nodule
35 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
36 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
37 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
38 2718218423 Rhizobium sp. N941 Isolate Nodule
39 2721755809 Rhizobium sp. N541 Isolate Nodule
40 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
41 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
42 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
43 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
44 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
45 2791355267 Rhizobium sp. L18 Isolate Nodule
46 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
47 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
48 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
49 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
50 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
51 2838048938 Rhizobium pisi 27/80 Isolate Nodule
52 2838061910 Rhizobium phaseoli L15 Isolate Nodule
53 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
54 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
55 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
56 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
57 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
58 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
59 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
60 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
61 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
62 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
63 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
64 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
65 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
66 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
67 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
68 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
69 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
70 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
71 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
72 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
73 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
74 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
75 2909042592 Labrys sp. LIt4 Isolate Nodule
76 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
77 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
78 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
79 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
80 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
81 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
82 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
83 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
84 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
85 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
86 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
87 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
88 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
89 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
90 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
91 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
92 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
93 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
97 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
101 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
245 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
248 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
254 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
260 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
261 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
264 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
265 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
266 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
269 8005258706 Rhizobium sp. R693 Isolate Nodule
270 8005275841 Rhizobium sp. N4311 Isolate Nodule
271 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
272 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
273 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
274 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
275 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
276 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
277 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
278 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
279 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
280 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
281 8018176218 Rhizobium sp. N122 Isolate Nodule
282 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
283 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
284 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
285 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.31
Metatranscriptomes 0
Isolates 24.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.19
Nodule 16.96
Rhizoplane 3.74
Rhizosphere 32.17
Stem 0
Stem Tuber 0
Unclassified 21.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000010 3300001979 Bacteria 72485
2 JGI25155J39150_1000044 3300002704 Bacteria 86149
3 JGI25156J39149_1000058 3300002705 Bacteria 86233
4 JGI25162J39368_1000143 3300002737 Bacteria 77302
5 JGI25162J39368_1000510 3300002737 Bacteria 29069
6 JGI25154J39366_1000174 3300002738 Bacteria 49957
7 JGI25157J39369_1000078 3300002741 Bacteria 86233
8 JGI25152J39213_1003685 3300002773 Bacteria 5146
9 JGI25152J39213_1008816 3300002773 Bacteria 2464
10 JGI25150J39212_1003026 3300002774 Bacteria 4035
11 JGI25151J46595_10011835 3300003187 Bacteria 3996
12 JGI25165J46597_1000356 3300003214 Bacteria 51368
13 JGI25165J46597_1001997 3300003214 Bacteria 7842
14 JGI25153J46596_10007092 3300003215 Bacteria 5565
15 JGI25153J46596_10007938 3300003215 Bacteria 5146
16 JGI25153J46596_10011363 3300003215 Bacteria 3939
17 JGI25153J46596_10020840 3300003215 Bacteria 2464
18 rootH1_10088509 3300003316 Bacteria 2268
19 rootH1_10135521 3300003316 Bacteria 3159
20 rootL2_10062776 3300003322 Bacteria 5430
21 rootL2_10190432 3300003322 Bacteria 1271
22 rootH1_10054196 3300003323 Bacteria 2252
23 rootH1_10055586 3300003323 Bacteria 2759
24 rootH1_10264619 3300003323 Unclassified 1911
25 rootH1_10279867 3300003323 Bacteria 1411
26 Ga0055526_1001399 3300003771 Bacteria 17148
27 Ga0055524_1009508 3300003775 Bacteria 3947
28 Ga0055536_1001688 3300003781 Bacteria 13068
29 Ga0055528_1000034 3300003790 Bacteria 118577
30 Ga0055528_1009765 3300003790 Bacteria 3979
31 Ga0055528_1016454 3300003790 Bacteria 2615
32 Ga0055528_1028004 3300003790 Bacteria 1565
33 Ga0055530_10029334 3300003791 Bacteria 1472
34 Ga0055530_10030674 3300003791 Unclassified 1420
35 Ga0055540_1000066 3300003792 Bacteria 122947
36 Ga0055540_1004019 3300003792 Bacteria 6847
37 Ga0055531_10004663 3300003794 Bacteria 8223
38 Ga0070711_100137967 3300005439 Bacteria 1825
39 Ga0068853_100313267 3300005539 Bacteria 1453
40 Ga0070665_100293554 3300005548 Bacteria 1628
41 Ga0068855_100005827 3300005563 Bacteria 15039
42 Ga0068855_100731791 3300005563 Bacteria 1056
43 Ga0068854_100550593 3300005578 Bacteria 978
44 Ga0068856_100198311 3300005614 Bacteria 2022
45 Ga0068856_100431283 3300005614 Bacteria 1338
46 Ga0068852_101166770 3300005616 Unclassified 791
47 Ga0075363_100211603 3300006048 Bacteria 1110
48 Ga0075363_100225724 3300006048 Bacteria 1074
49 Ga0075363_100253234 3300006048 Bacteria 1014
50 Ga0070712_100085519 3300006175 Bacteria 2296
51 Ga0075367_10097344 3300006178 Bacteria 1795
52 Ga0075367_10168483 3300006178 Bacteria 1364
53 Ga0075367_10628918 3300006178 Bacteria 682
54 Ga0075369_10054126 3300006186 Bacteria 1742
55 Ga0075366_10007549 3300006195 Bacteria 6014
56 Ga0075366_10153294 3300006195 Bacteria 1396
57 Ga0075370_10049294 3300006353 Bacteria 2387
58 Ga0075370_10086343 3300006353 Bacteria 1807
59 Ga0105240_10001458 3300009093 Bacteria 40449
60 Ga0105240_10003101 3300009093 Bacteria 26140
61 Ga0105243_10194456 3300009148 Bacteria 1774
62 Ga0105237_10000080 3300009545 Bacteria 127788
63 Ga0105237_10002043 3300009545 Bacteria 25676
64 Ga0105237_10232204 3300009545 Bacteria 1846
65 Ga0105238_10000711 3300009551 Bacteria 34783
66 Ga0105239_10000116 3300010375 Bacteria 112811
67 Ga0105239_10000972 3300010375 Bacteria 40206
68 Ga0105239_10111136 3300010375 Bacteria 3037
69 Ga0105239_10153482 3300010375 Bacteria 2571
70 Ga0157373_10349633 3300013100 Bacteria 1054
71 Ga0157370_10000960 3300013104 Bacteria 36558
72 Ga0157369_10229240 3300013105 Bacteria 1942
73 Ga0163163_10662590 3300014325 Bacteria 1107
74 Ga0182008_10097007 3300014497 Bacteria 1455
75 Ga0182005_1014324 3300015265 Bacteria 2219
76 Ga0213872_10006285 3300021361 Bacteria 5988
77 Ga0213872_10010351 3300021361 Bacteria 4442
78 Ga0213872_10034527 3300021361 Bacteria 2314
79 Ga0213876_10101821 3300021384 Unclassified 1523
80 Ga0213876_10418958 3300021384 Unclassified 712
81 Ga0213875_10004630 3300021388 Bacteria 7502
82 Ga0213875_10172778 3300021388 Unclassified 1015
83 Ga0209435_100054 3300025206 Bacteria 86285
84 Ga0209437_100051 3300025233 Bacteria 392523
85 Ga0209437_100098 3300025233 Bacteria 229766
86 Ga0209437_104542 3300025233 Bacteria 2435
87 Ga0207425_1002118 3300025245 Bacteria 7305
88 Ga0207425_1009071 3300025245 Bacteria 2500
89 Ga0209646_1000170 3300025246 Bacteria 86285
90 Ga0209646_1006431 3300025246 Bacteria 1976
91 Ga0209646_1006451 3300025246 Bacteria 1970
92 Ga0209026_1000193 3300025250 Bacteria 86285
93 Ga0209677_100744 3300025253 Bacteria 16516
94 Ga0209677_101654 3300025253 Bacteria 9374
95 Ga0209759_1000222 3300025256 Bacteria 86285
96 Ga0209129_1002027 3300025258 Bacteria 10493
97 Ga0209129_1009622 3300025258 Bacteria 2516
98 Ga0209233_1000095 3300025261 Bacteria 303783
99 Ga0209233_1000113 3300025261 Bacteria 253455
100 Ga0209233_1000148 3300025261 Bacteria 185135
101 Ga0209673_1000020 3300025273 Bacteria 430653
102 Ga0209673_1000462 3300025273 Bacteria 68568
103 Ga0209673_1001959 3300025273 Bacteria 16130
104 Ga0209676_1032733 3300025292 Bacteria 1560
105 Ga0209025_1015160 3300025294 Bacteria 4673
106 Ga0209025_1022170 3300025294 Bacteria 3382
107 Ga0209025_1023883 3300025294 Bacteria 3178
108 Ga0209564_1000205 3300025295 Bacteria 135901
109 Ga0209564_1057063 3300025295 Bacteria 903
110 Ga0209758_1000265 3300025297 Bacteria 104078
111 Ga0209758_1001226 3300025297 Bacteria 32089
112 Ga0209758_1003911 3300025297 Bacteria 12998
113 Ga0209758_1026380 3300025297 Bacteria 2516
114 Ga0209758_1053381 3300025297 Bacteria 1389
115 Ga0209050_1003157 3300025298 Bacteria 12556
116 Ga0209256_1000500 3300025299 Bacteria 57552
117 Ga0209256_1020309 3300025299 Bacteria 2077
118 Ga0209051_1000038 3300025303 Bacteria 320926
119 Ga0209051_1002360 3300025303 Bacteria 13662
120 Ga0209051_1090041 3300025303 Bacteria 856
121 Ga0209257_1005293 3300025304 Bacteria 9179
122 Ga0209257_1014049 3300025304 Bacteria 3485
123 Ga0209257_1015575 3300025304 Bacteria 3152
124 Ga0207695_10001420 3300025913 Bacteria 40295
125 Ga0207671_10000934 3300025914 Bacteria 36501
126 Ga0207671_10002386 3300025914 Bacteria 20172
127 Ga0207694_10013039 3300025924 Bacteria 6256
128 Ga0207706_10005400 3300025933 Bacteria 11913
129 Ga0207667_10020288 3300025949 Bacteria 7396
130 Ga0207667_10662090 3300025949 Bacteria 1049
131 Ga0207640_10066981 3300025981 Bacteria 2401
132 Ga0207639_10333901 3300026041 Bacteria 1350
133 Ga0207702_10164930 3300026078 Bacteria 2026
134 Ga0207702_10246247 3300026078 Bacteria 1677
135 Ga0265331_10007897 3300031250 Bacteria 6100
136 Ga0307508_10069269 3300031616 Bacteria 3099
137 Ga0307516_10066291 3300031730 Bacteria 3483
138 Ga0307510_10179679 3300033180 Bacteria 1681
139 Ga0373946_0287554 3300035171 Bacteria 810
140 Ga0373927_0001739 3300035695 Bacteria 16274
141 Ga0373947_0134666 3300035725 Bacteria 1580
142 Ga0395900_0091716 3300037418 Bacteria 3122
143 Ga0395905_0001877 3300037471 Bacteria 24203
144 Ga0395905_0046703 3300037471 Bacteria 4060
145 Ga0395905_0132795 3300037471 Bacteria 2341
146 Ga0395905_0409950 3300037471 Bacteria 1250
147 Ga0436364_0621060 3300037853 Bacteria 18950
148 Ga0436364_0947489 3300037853 Bacteria 4359
149 Ga0436365_0986713 3300039437 Bacteria 3162
150 Ga0436365_1543068 3300039437 Bacteria 1718
151 Ga0436361_0337717 3300039447 Bacteria 8067
152 Ga0436361_0784500 3300039447 Bacteria 6210
153 Ga0436361_0837534 3300039447 Bacteria 4931
154 Ga0436361_0849505 3300039447 Bacteria 2027
155 Ga0436361_1022221 3300039447 Bacteria 1267
156 Ga0436363_0252068 3300039450 Bacteria 2445
157 Ga0451789_1178455 3300041443 Bacteria 1120
158 Ga0451791_1825131 3300041451 Bacteria 1635
159 Ga0451837_0503030 3300041494 Bacteria 809
160 Ga0451837_0543028 3300041494 Bacteria 4195
161 Ga0451841_0542958 3300041498 Bacteria 4080
162 Ga0451847_0850539 3300041503 Bacteria 1342
163 Ga0451849_0452136 3300041505 Bacteria 6318
164 Ga0451851_0492284 3300041507 Bacteria 3501
165 Ga0451843_0253168 3300041509 Bacteria 5122
166 Ga0451843_0290257 3300041509 Bacteria 914
167 Ga0451855_0092305 3300041511 Bacteria 3017
168 Ga0451855_0401504 3300041511 Bacteria 1388
169 Ga0451853_0049987 3300041512 Bacteria 6326
170 Ga0451853_2665250 3300041512 Bacteria 907
171 Ga0466969_0003661 3300044656 Bacteria 8181
172 Ga0466969_0014680 3300044656 Bacteria 4118
173 Ga0466965_0022015 3300044683 Bacteria 3071
174 Ga0466966_0000549 3300044684 Bacteria 23916
175 Ga0466966_0009878 3300044684 Bacteria 6325
176 Ga0466966_0025507 3300044684 Bacteria 3860
177 Ga0466966_0031463 3300044684 Bacteria 3440
178 Ga0466961_0447776 3300044693 Bacteria 781
179 Ga0466963_0049474 3300044694 Bacteria 2780
180 Ga0466963_0222472 3300044694 Bacteria 1322
181 Ga0466971_0063656 3300044719 Bacteria 1669
182 Ga0466970_0075194 3300044765 Unclassified 1819
183 Ga0466970_0117797 3300044765 Bacteria 1453
184 Ga0466970_0189214 3300044765 Bacteria 1143
185 Ga0466957_0028834 3300044842 Bacteria 3307
186 Ga0466957_0217320 3300044842 Bacteria 1261
187 Ga0466959_0000337 3300045049 Bacteria 27666
188 Ga0466959_0000837 3300045049 Bacteria 18178
189 Ga0466959_0018721 3300045049 Bacteria 5086
190 Ga0466959_0192785 3300045049 Bacteria 1421
191 Ga0466958_0066894 3300045836 Bacteria 2194
192 Ga0466958_0295479 3300045836 Bacteria 1039
193 Ga0466967_0053278 3300045976 Bacteria 3555
194 Ga0495627_078797 3300046453 Bacteria 956
195 Ga0495605_0021489 3300046474 Bacteria 3418
196 Ga0495596_0090921 3300046500 Bacteria 1185
197 Ga0495607_0046206 3300046501 Bacteria 2558
198 Ga0495583_0007467 3300046506 Bacteria 6856
199 Ga0495583_0039224 3300046506 Bacteria 2232
200 Ga0495606_0105372 3300046507 Bacteria 1709
201 Ga0495610_0015508 3300046512 Bacteria 4424
202 Ga0495610_0045216 3300046512 Bacteria 2179
203 Ga0495616_0198601 3300046513 Bacteria 882
204 Ga0495620_0181358 3300046515 Bacteria 814
205 Ga0495632_0069093 3300046519 Bacteria 1701
206 Ga0495637_0048233 3300046520 Bacteria 1794
207 Ga0495643_0019630 3300046522 Bacteria 3907
208 Ga0495643_0061787 3300046522 Bacteria 1985
209 Ga0495663_0022854 3300046525 Bacteria 1809
210 Ga0495654_0169324 3300046530 Bacteria 953
211 Ga0495609_0038914 3300046538 Bacteria 2142
212 Ga0495622_0052184 3300046557 Bacteria 1897
213 Ga0495633_0024625 3300046558 Bacteria 2972
214 Ga0495633_0072267 3300046558 Bacteria 1609
215 Ga0495656_0162156 3300046615 Bacteria 1087
216 Ga0495668_0236923 3300046616 Bacteria 999
217 Ga0495625_0022274 3300046660 Bacteria 4861
218 Ga0495625_0141102 3300046660 Bacteria 1625
219 Ga0495588_0044967 3300046674 Bacteria 2262
220 Ga0495670_0300983 3300046691 Bacteria 859
221 Ga0495649_0052033 3300046694 Bacteria 2220
222 Ga0495660_0018874 3300046810 Bacteria 3958
223 Ga0495683_0137539 3300047323 Bacteria 1147
224 Ga0495687_031032 3300047443 Bacteria 2456
225 Ga0495681_0031977 3300047470 Bacteria 2654
226 Ga0495681_0081322 3300047470 Bacteria 1445
227 Ga0495681_0092469 3300047470 Bacteria 1333
228 Ga0495626_0102539 3300048091 Bacteria 1246
229 Ga0496100_0033280 3300048903 Bacteria 3224
230 Ga0496101_0015691 3300048904 Bacteria 5112
231 Ga0496102_0015390 3300048905 Bacteria 6662
232 Ga0496102_0100143 3300048905 Bacteria 2691
233 Ga0496103_0080479 3300048906 Bacteria 2049
234 Ga0496104_0772961 3300048907 Bacteria 867
235 Ga0496104_0977142 3300048907 Bacteria 751
236 Ga0496105_0183822 3300048908 Bacteria 1711
237 Ga0496105_0324563 3300048908 Bacteria 1233
238 Ga0496106_0375546 3300048909 Bacteria 1142
239 Ga0496110_0150999 3300048913 Bacteria 2104
240 Ga0496113_0113044 3300048916 Bacteria 2116
241 Ga0496116_0006856 3300048919 Bacteria 10228
242 Ga0496117_0002281 3300048920 Bacteria 24769
243 Ga0496117_0144868 3300048920 Bacteria 1416
244 Ga0496117_0267053 3300048920 Bacteria 924
245 Ga0496117_0348720 3300048920 Bacteria 765
246 Ga0496118_0000477 3300048921 Bacteria 66433
247 Ga0496118_0002480 3300048921 Bacteria 24769
248 Ga0496118_0204587 3300048921 Bacteria 1165
249 Ga0496119_0005480 3300048922 Bacteria 12135
250 Ga0496119_0018234 3300048922 Bacteria 5240
251 Ga0496119_0179023 3300048922 Bacteria 1113
252 Ga0496120_0007918 3300048923 Bacteria 7829
253 Ga0496120_0085668 3300048923 Bacteria 1695
254 Ga0496121_0002956 3300048924 Bacteria 24769
255 Ga0496121_0019531 3300048924 Bacteria 6767
256 Ga0496121_0022774 3300048924 Bacteria 6060
257 Ga0496121_0069488 3300048924 Bacteria 2841
258 Ga0496122_0012900 3300048925 Bacteria 8252
259 Ga0496122_0031975 3300048925 Bacteria 4362
260 Ga0496122_0056314 3300048925 Bacteria 2932
261 Ga0496123_0009202 3300048926 Bacteria 8927
262 Ga0496124_0018846 3300048927 Bacteria 6445
263 Ga0496124_0042262 3300048927 Bacteria 3926
264 Ga0496124_0105688 3300048927 Bacteria 2274
265 Ga0496125_0000207 3300048928 Bacteria 122897
266 Ga0496125_0001507 3300048928 Bacteria 33343
267 Ga0496125_0006233 3300048928 Bacteria 12971
268 Ga0496125_0077795 3300048928 Bacteria 2554
269 Ga0496126_0325455 3300048929 Bacteria 1262
270 Ga0495682_0075883 3300049460 Bacteria 1209
271 nmdc:mga03n38_211833_c1 3300050490 Bacteria 1007
272 nmdc:mga03n38_68967_c1 3300050490 Bacteria 1631
273 nmdc:mga0k408_83148_c1 3300050493 Bacteria 820
274 nmdc:mga06z11_358715_c1 3300050494 Bacteria 873
275 nmdc:mga06z11_377003_c1 3300050494 Bacteria 852
276 nmdc:mga07m45_42927_c1 3300050496 Bacteria 2535
277 Ga0500578_0269701 3300053086 Bacteria 1018
278 Ga0500566_0000394 3300053094 Bacteria 24254
279 Ga0500640_002770 3300053095 Bacteria 5900
280 Ga0500556_0011736 3300053104 Bacteria 2601
281 Ga0500560_089446 3300053107 Bacteria 1028
282 Ga0500572_000156 3300053111 Bacteria 23706
283 Ga0500608_039947 3300053122 Bacteria 2247
284 Ga0500618_008806 3300053125 Bacteria 2789
285 Ga0500658_0000075 3300053134 Bacteria 45932
286 Ga0500559_0001182 3300053136 Bacteria 15606
287 Ga0500561_0010369 3300053137 Bacteria 1924
288 Ga0500573_0079331 3300053140 Bacteria 1867
289 Ga0500577_0292748 3300053142 Bacteria 710
290 Ga0500603_000224 3300053150 Bacteria 14919
291 Ga0500616_0008185 3300053153 Bacteria 6527
292 Ga0500622_0101462 3300053156 Bacteria 1416
293 Ga0500630_000834 3300053159 Bacteria 14264
294 Ga0500638_005764 3300053162 Bacteria 4984
295 Ga0500639_002819 3300053163 Bacteria 8743
296 Ga0500636_0054103 3300053177 Bacteria 2353
297 Ga0500636_0231406 3300053177 Bacteria 956
298 Ga0500637_0016835 3300053178 Bacteria 3904
299 Ga0500657_176615 3300053728 Bacteria 748
300 Ga0500596_017445 3300053735 Bacteria 1076
301 Ga0500601_001718 3300053737 Bacteria 2353
302 Ga0466962_0004426 3300061719 Bacteria 6728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100313267 Ga0068853_1003132673 160
2 3300005548 Ga0070665_100293554 Ga0070665_1002935543 160
3 3300005616 Ga0068852_101166770 Ga0068852_1011667702 160
4 3300009093 Ga0105240_10003101 Ga0105240_1000310114 160
5 3300009545 Ga0105237_10000080 Ga0105237_1000008033 160
6 3300009551 Ga0105238_10000711 Ga0105238_1000071118 160
7 3300010375 Ga0105239_10000116 Ga0105239_1000011674 160
8 3300014325 Ga0163163_10662590 Ga0163163_106625902 160
9 3300025914 Ga0207671_10002386 Ga0207671_1000238610 161
10 3300025924 Ga0207694_10013039 Ga0207694_100130392 161
11 3300026041 Ga0207639_10333901 Ga0207639_103339013 161
12 3300025297 Ga0209758_1003911 Ga0209758_10039115 175
13 3300053104 Ga0500556_0011736 Ga0500556_0011736_83_685 179
14 3300010375 Ga0105239_10111136 Ga0105239_101111365 184
15 3300046525 Ga0495663_0022854 Ga0495663_0022854_613_1212 184
16 3300046615 Ga0495656_0162156 Ga0495656_0162156_282_881 184
17 3300041509 Ga0451843_0290257 Ga0451843_0290257_243_842 186
18 3300046500 Ga0495596_0090921 Ga0495596_0090921_525_1124 186
19 3300047470 Ga0495681_0031977 Ga0495681_0031977_1037_1636 186
20 iso_pu_bacteria 2738543031 2739351413 186
21 3300031730 Ga0307516_10066291 Ga0307516_100662913 187
22 3300041511 Ga0451855_0401504 Ga0451855_0401504_500_1099 187
23 3300046558 Ga0495633_0024625 Ga0495633_0024625_71_670 187
24 iso_pu_bacteria 2523231067 2523470842 189
25 3300031250 Ga0265331_10007897 Ga0265331_100078977 190
26 3300044656 Ga0466969_0014680 Ga0466969_0014680_1612_2184 190
27 3300044684 Ga0466966_0000549 Ga0466966_0000549_221_793 190
28 3300044693 Ga0466961_0447776 Ga0466961_0447776_78_650 190
29 3300044694 Ga0466963_0222472 Ga0466963_0222472_493_1065 190
30 3300044765 Ga0466970_0117797 Ga0466970_0117797_725_1297 190
31 3300044842 Ga0466957_0217320 Ga0466957_0217320_659_1231 190
32 3300045049 Ga0466959_0000337 Ga0466959_0000337_198_770 190
33 3300045836 Ga0466958_0295479 Ga0466958_0295479_162_734 190
34 iso_pu_bacteria 2582581307 2585276655 190
35 iso_pu_bacteria 2919171160 2919175989 190
36 3300021361 Ga0213872_10010351 Ga0213872_100103515 191
37 3300021361 Ga0213872_10034527 Ga0213872_100345275 191
38 3300039447 Ga0436361_0784500 Ga0436361_0784500_2617_3192 191
39 3300039447 Ga0436361_0837534 Ga0436361_0837534_2686_3261 191
40 3300048905 Ga0496102_0100143 Ga0496102_0100143_327_902 191
41 3300048908 Ga0496105_0183822 Ga0496105_0183822_357_932 191
42 3300048913 Ga0496110_0150999 Ga0496110_0150999_1071_1646 191
43 iso_pu_bacteria 2529292951 2530648542 191
44 iso_pu_bacteria 2724679232 2725946436 191
45 iso_pu_bacteria 2980125574 2980127594 191
46 iso_pu_bacteria 2791355259 2793312653 192
47 iso_pu_bacteria 2841846520 2841847417 192
48 iso_pu_bacteria 2842124991 2842126553 192
49 iso_pu_bacteria 2852387548 2852388519 192
50 iso_pu_bacteria 8005695170 8005695283 192
51 iso_pu_bacteria 8046767195 8046769907 192
52 iso_pu_bacteria 8057575449 8057579905 192
53 3300005563 Ga0068855_100005827 Ga0068855_1000058277 193
54 3300006195 Ga0075366_10007549 Ga0075366_100075497 193
55 3300025933 Ga0207706_10005400 Ga0207706_100054003 193
56 3300025949 Ga0207667_10020288 Ga0207667_100202887 193
57 3300039447 Ga0436361_0849505 Ga0436361_0849505_1200_1781 193
58 3300044656 Ga0466969_0003661 Ga0466969_0003661_3074_3667 193
59 3300044683 Ga0466965_0022015 Ga0466965_0022015_1938_2531 193
60 3300044684 Ga0466966_0025507 Ga0466966_0025507_1969_2550 193
61 3300044684 Ga0466966_0031463 Ga0466966_0031463_2088_2681 193
62 3300044694 Ga0466963_0049474 Ga0466963_0049474_240_833 193
63 3300044719 Ga0466971_0063656 Ga0466971_0063656_1031_1624 193
64 3300044765 Ga0466970_0189214 Ga0466970_0189214_511_1104 193
65 3300044842 Ga0466957_0028834 Ga0466957_0028834_799_1392 193
66 3300045049 Ga0466959_0018721 Ga0466959_0018721_2304_2885 193
67 3300045049 Ga0466959_0192785 Ga0466959_0192785_362_955 193
68 3300045836 Ga0466958_0066894 Ga0466958_0066894_567_1160 193
69 3300045976 Ga0466967_0053278 Ga0466967_0053278_2723_3316 193
70 3300048924 Ga0496121_0022774 Ga0496121_0022774_3087_3686 193
71 3300050493 nmdc:mga0k408_83148_c1 nmdc:mga0k408_83148_c1_15_602 193
72 3300061719 Ga0466962_0004426 Ga0466962_0004426_2082_2675 193
73 iso_pu_bacteria 2509276021 2509391027 193
74 iso_pu_bacteria 2510065045 2510252888 193
75 iso_pu_bacteria 2510461076 2510893286 193
76 iso_pu_bacteria 2510917030 2511197777 193
77 iso_pu_bacteria 2513237084 2513572046 193
78 iso_pu_bacteria 2513237085 2513576024 193
79 iso_pu_bacteria 2513237103 2513714242 193
80 iso_pu_bacteria 2513237162 2514019254 193
81 iso_pu_bacteria 2515075009 2515109487 193
82 iso_pu_bacteria 2515154113 2515634258 193
83 iso_pu_bacteria 2515154114 2515641864 193
84 iso_pu_bacteria 2515154116 2515658855 193
85 iso_pu_bacteria 2515154134 2515742553 193
86 iso_pu_bacteria 2515154189 2516023244 193
87 iso_pu_bacteria 2517093000 2517100117 193
88 iso_pu_bacteria 2517287029 2517411343 193
89 iso_pu_bacteria 2519899620 2520380230 193
90 iso_pu_bacteria 2585427526 2585526576 193
91 iso_pu_bacteria 2718217927 2719389997 193
92 iso_pu_bacteria 2718217991 2719638688 193
93 iso_pu_bacteria 2718217997 2719668228 193
94 iso_pu_bacteria 2718218199 2720494991 193
95 iso_pu_bacteria 2718218423 2721403636 193
96 iso_pu_bacteria 2721755809 2724035212 193
97 iso_pu_bacteria 2721755823 2724107919 193
98 iso_pu_bacteria 2791355267 2793367236 193
99 iso_pu_bacteria 2838016132 2838019254 193
100 iso_pu_bacteria 2838022645 2838027125 193
101 iso_pu_bacteria 2838048938 2838054455 193
102 iso_pu_bacteria 2838061910 2838063022 193
103 iso_pu_bacteria 2841864319 2841865635 193
104 iso_pu_bacteria 2842163707 2842166102 193
105 iso_pu_bacteria 2842198810 2842200599 193
106 iso_pu_bacteria 2842217011 2842222561 193
107 iso_pu_bacteria 2842264693 2842269391 193
108 iso_pu_bacteria 2842304105 2842310883 193
109 iso_pu_bacteria 2842311132 2842312009 193
110 iso_pu_bacteria 2842341865 2842345566 193
111 iso_pu_bacteria 2842363717 2842363862 193
112 iso_pu_bacteria 2842428310 2842432652 193
113 iso_pu_bacteria 2842434925 2842438900 193
114 iso_pu_bacteria 2842441272 2842445530 193
115 iso_pu_bacteria 2842447887 2842449983 193
116 iso_pu_bacteria 2842462802 2842467775 193
117 iso_pu_bacteria 2842469257 2842473515 193
118 iso_pu_bacteria 2883087390 2883093574 193
119 iso_pu_bacteria 2933570622 2933577378 193
120 iso_pu_bacteria 2935901341 2935906541 193
121 iso_pu_bacteria 639633055 639651047 193
122 iso_pu_bacteria 8005258706 8005258767 193
123 iso_pu_bacteria 8005282627 8005288119 193
124 iso_pu_bacteria 8005307578 8005311557 193
125 iso_pu_bacteria 8005430974 8005431250 193
126 iso_pu_bacteria 8005460587 8005466251 193
127 iso_pu_bacteria 8005619151 8005625390 193
128 iso_pu_bacteria 8018176218 8018180708 193
129 iso_pu_bacteria 8023680758 8023686080 193
130 iso_pu_bacteria 8056375014 8056381936 193
131 3300002773 JGI25152J39213_1008816 JGI25152J39213_10088162 194
132 3300003187 JGI25151J46595_10011835 JGI25151J46595_100118354 194
133 3300003215 JGI25153J46596_10011363 JGI25153J46596_100113634 194
134 3300003215 JGI25153J46596_10020840 JGI25153J46596_100208402 194
135 3300003322 rootL2_10190432 rootL2_101904321 194
136 3300003323 rootH1_10264619 rootH1_102646193 194
137 3300003781 Ga0055536_1001688 Ga0055536_10016883 194
138 3300003791 Ga0055530_10030674 Ga0055530_100306741 194
139 3300003792 Ga0055540_1004019 Ga0055540_10040192 194
140 3300003794 Ga0055531_10004663 Ga0055531_100046634 194
141 3300006048 Ga0075363_100225724 Ga0075363_1002257242 194
142 3300006178 Ga0075367_10628918 Ga0075367_106289181 194
143 3300021361 Ga0213872_10006285 Ga0213872_100062855 194
144 3300021388 Ga0213875_10004630 Ga0213875_100046306 194
145 3300025245 Ga0207425_1009071 Ga0207425_10090712 194
146 3300025258 Ga0209129_1009622 Ga0209129_10096222 194
147 3300025294 Ga0209025_1015160 Ga0209025_10151605 194
148 3300025297 Ga0209758_1000265 Ga0209758_100026592 194
149 3300025297 Ga0209758_1026380 Ga0209758_10263802 194
150 3300025303 Ga0209051_1002360 Ga0209051_100236017 194
151 3300025304 Ga0209257_1014049 Ga0209257_10140494 194
152 3300025304 Ga0209257_1015575 Ga0209257_10155754 194
153 3300033180 Ga0307510_10179679 Ga0307510_101796792 194
154 3300037471 Ga0395905_0046703 Ga0395905_0046703_2575_3159 194
155 3300037853 Ga0436364_0621060 Ga0436364_0621060_2740_3324 194
156 3300039447 Ga0436361_0337717 Ga0436361_0337717_1407_2012 194
157 3300039447 Ga0436361_1022221 Ga0436361_1022221_144_728 194
158 3300050490 nmdc:mga03n38_211833_c1 nmdc:mga03n38_211833_c1_299_883 194
159 iso_pu_bacteria 2582581308 2585283386 194
160 iso_pu_bacteria 2582581315 2585323288 194
161 iso_pu_bacteria 2585427527 2585531439 194
162 iso_pu_bacteria 2585427530 2585552661 194
163 iso_pu_bacteria 2818991453 2819644153 194
164 3300005439 Ga0070711_100137967 Ga0070711_1001379672 195
165 3300006175 Ga0070712_100085519 Ga0070712_1000855193 195
166 3300021384 Ga0213876_10101821 Ga0213876_101018212 195
167 3300021388 Ga0213875_10172778 Ga0213875_101727782 195
168 3300037853 Ga0436364_0947489 Ga0436364_0947489_776_1363 195
169 3300039437 Ga0436365_1543068 Ga0436365_1543068_378_965 195
170 3300039450 Ga0436363_0252068 Ga0436363_0252068_1336_2049 195
171 3300041512 Ga0451853_2665250 Ga0451853_2665250_121_714 195
172 3300048907 Ga0496104_0772961 Ga0496104_0772961_217_804 195
173 3300003316 rootH1_10135521 rootH1_101355215 196
174 3300021384 Ga0213876_10418958 Ga0213876_104189581 196
175 3300025253 Ga0209677_100744 Ga0209677_10074413 196
176 3300031616 Ga0307508_10069269 Ga0307508_100692692 196
177 3300035171 Ga0373946_0287554 Ga0373946_0287554_30_626 196
178 3300035695 Ga0373927_0001739 Ga0373927_0001739_5623_6219 196
179 3300035725 Ga0373947_0134666 Ga0373947_0134666_258_854 196
180 3300037471 Ga0395905_0001877 Ga0395905_0001877_23079_23675 196
181 3300039437 Ga0436365_0986713 Ga0436365_0986713_29_625 196
182 3300044684 Ga0466966_0009878 Ga0466966_0009878_3705_4295 196
183 3300044765 Ga0466970_0075194 Ga0466970_0075194_20_610 196
184 3300045049 Ga0466959_0000837 Ga0466959_0000837_16215_16805 196
185 3300046522 Ga0495643_0061787 Ga0495643_0061787_132_722 196
186 3300046557 Ga0495622_0052184 Ga0495622_0052184_45_635 196
187 3300047470 Ga0495681_0092469 Ga0495681_0092469_605_1195 196
188 3300048920 Ga0496117_0267053 Ga0496117_0267053_261_863 196
189 3300048920 Ga0496117_0348720 Ga0496117_0348720_47_643 196
190 3300048922 Ga0496119_0179023 Ga0496119_0179023_335_931 196
191 3300048924 Ga0496121_0069488 Ga0496121_0069488_1544_2140 196
192 3300053140 Ga0500573_0079331 Ga0500573_0079331_197_787 196
193 iso_pu_bacteria 2909042592 2909045042 196
194 3300003215 JGI25153J46596_10007092 JGI25153J46596_100070924 197
195 3300003771 Ga0055526_1001399 Ga0055526_100139913 197
196 3300003775 Ga0055524_1009508 Ga0055524_10095085 197
197 3300003790 Ga0055528_1000034 Ga0055528_100003423 197
198 3300003790 Ga0055528_1009765 Ga0055528_10097655 197
199 3300003790 Ga0055528_1016454 Ga0055528_10164544 197
200 3300003790 Ga0055528_1028004 Ga0055528_10280042 197
201 3300003791 Ga0055530_10029334 Ga0055530_100293343 197
202 3300003792 Ga0055540_1000066 Ga0055540_100006626 197
203 3300006048 Ga0075363_100211603 Ga0075363_1002116032 197
204 3300006048 Ga0075363_100253234 Ga0075363_1002532341 197
205 3300006178 Ga0075367_10097344 Ga0075367_100973444 197
206 3300006178 Ga0075367_10168483 Ga0075367_101684831 197
207 3300006186 Ga0075369_10054126 Ga0075369_100541262 197
208 3300006195 Ga0075366_10153294 Ga0075366_101532942 197
209 3300006353 Ga0075370_10049294 Ga0075370_100492944 197
210 3300006353 Ga0075370_10086343 Ga0075370_100863433 197
211 3300025273 Ga0209673_1000020 Ga0209673_1000020174 197
212 3300025273 Ga0209673_1000462 Ga0209673_100046266 197
213 3300025273 Ga0209673_1001959 Ga0209673_100195914 197
214 3300025292 Ga0209676_1032733 Ga0209676_10327333 197
215 3300025294 Ga0209025_1023883 Ga0209025_10238832 197
216 3300025295 Ga0209564_1000205 Ga0209564_100020522 197
217 3300025295 Ga0209564_1057063 Ga0209564_10570632 197
218 3300025297 Ga0209758_1053381 Ga0209758_10533813 197
219 3300025298 Ga0209050_1003157 Ga0209050_10031577 197
220 3300025299 Ga0209256_1000500 Ga0209256_100050043 197
221 3300025299 Ga0209256_1020309 Ga0209256_10203092 197
222 3300025303 Ga0209051_1000038 Ga0209051_1000038128 197
223 3300025303 Ga0209051_1090041 Ga0209051_10900411 197
224 3300025304 Ga0209257_1005293 Ga0209257_10052935 197
225 3300041443 Ga0451789_1178455 Ga0451789_1178455_352_951 197
226 3300041451 Ga0451791_1825131 Ga0451791_1825131_603_1202 197
227 3300041494 Ga0451837_0503030 Ga0451837_0503030_87_686 197
228 3300041494 Ga0451837_0543028 Ga0451837_0543028_2624_3223 197
229 3300041498 Ga0451841_0542958 Ga0451841_0542958_2785_3384 197
230 3300041503 Ga0451847_0850539 Ga0451847_0850539_138_737 197
231 3300041505 Ga0451849_0452136 Ga0451849_0452136_2101_2700 197
232 3300041507 Ga0451851_0492284 Ga0451851_0492284_573_1172 197
233 3300041509 Ga0451843_0253168 Ga0451843_0253168_3545_4144 197
234 3300041511 Ga0451855_0092305 Ga0451855_0092305_660_1259 197
235 3300041512 Ga0451853_0049987 Ga0451853_0049987_1486_2085 197
236 3300046474 Ga0495605_0021489 Ga0495605_0021489_1513_2112 197
237 3300046507 Ga0495606_0105372 Ga0495606_0105372_379_978 197
238 3300046512 Ga0495610_0015508 Ga0495610_0015508_1462_2061 197
239 3300046513 Ga0495616_0198601 Ga0495616_0198601_216_815 197
240 3300046519 Ga0495632_0069093 Ga0495632_0069093_516_1115 197
241 3300046522 Ga0495643_0019630 Ga0495643_0019630_2210_2809 197
242 3300046616 Ga0495668_0236923 Ga0495668_0236923_323_922 197
243 3300046660 Ga0495625_0022274 Ga0495625_0022274_2974_3573 197
244 3300046691 Ga0495670_0300983 Ga0495670_0300983_70_669 197
245 3300046694 Ga0495649_0052033 Ga0495649_0052033_522_1121 197
246 3300046810 Ga0495660_0018874 Ga0495660_0018874_2687_3286 197
247 3300047323 Ga0495683_0137539 Ga0495683_0137539_130_729 197
248 3300048091 Ga0495626_0102539 Ga0495626_0102539_145_744 197
249 3300048921 Ga0496118_0000477 Ga0496118_0000477_16147_16746 197
250 3300050490 nmdc:mga03n38_68967_c1 nmdc:mga03n38_68967_c1_738_1337 197
251 3300050494 nmdc:mga06z11_358715_c1 nmdc:mga06z11_358715_c1_210_809 197
252 3300050494 nmdc:mga06z11_377003_c1 nmdc:mga06z11_377003_c1_214_813 197
253 3300050496 nmdc:mga07m45_42927_c1 nmdc:mga07m45_42927_c1_797_1396 197
254 3300053086 Ga0500578_0269701 Ga0500578_0269701_41_640 197
255 3300053094 Ga0500566_0000394 Ga0500566_0000394_2287_2907 197
256 3300053095 Ga0500640_002770 Ga0500640_002770_4859_5479 197
257 3300053111 Ga0500572_000156 Ga0500572_000156_2075_2695 197
258 3300053122 Ga0500608_039947 Ga0500608_039947_1590_2210 197
259 3300053134 Ga0500658_0000075 Ga0500658_0000075_29076_29675 197
260 3300053136 Ga0500559_0001182 Ga0500559_0001182_12265_12885 197
261 3300053142 Ga0500577_0292748 Ga0500577_0292748_50_649 197
262 3300053150 Ga0500603_000224 Ga0500603_000224_13422_14042 197
263 3300053153 Ga0500616_0008185 Ga0500616_0008185_299_898 197
264 3300053156 Ga0500622_0101462 Ga0500622_0101462_478_1077 197
265 3300053159 Ga0500630_000834 Ga0500630_000834_8174_8794 197
266 3300053162 Ga0500638_005764 Ga0500638_005764_120_740 197
267 3300053163 Ga0500639_002819 Ga0500639_002819_389_1009 197
268 3300053178 Ga0500637_0016835 Ga0500637_0016835_3223_3843 197
269 3300053728 Ga0500657_176615 Ga0500657_176615_62_682 197
270 3300053735 Ga0500596_017445 Ga0500596_017445_422_1042 197
271 3300053737 Ga0500601_001718 Ga0500601_001718_1112_1732 197
272 iso_pu_bacteria 2582581299 2585231569 197
273 iso_pu_bacteria 2582581316 2585331430 197
274 iso_pu_bacteria 2585427608 2585898288 197
275 iso_pu_bacteria 2585427634 2586000451 197
276 iso_pu_bacteria 2615840698 2616554274 197
277 iso_pu_bacteria 2617270742 2617383614 197
278 iso_pu_bacteria 2667528174 2671111385 197
279 iso_pu_bacteria 2775507266 2778175459 197
280 iso_pu_bacteria 2818991448 2819609193 197
281 iso_pu_bacteria 2838029111 2838029759 197
282 iso_pu_bacteria 2842475841 2842476956 197
283 iso_pu_bacteria 2842482326 2842484514 197
284 iso_pu_bacteria 2842502639 2842503287 197
285 iso_pu_bacteria 2919408235 2919410026 197
286 iso_pu_bacteria 3005416602 3005417422 197
287 iso_pu_bacteria 8005275841 8005276123 197
288 iso_pu_bacteria 8005314921 8005315789 197
289 iso_pu_bacteria 8005484373 8005489141 197
290 iso_pu_bacteria 8005645114 8005648186 197
291 iso_pu_bacteria 8005682033 8005682843 197
292 3300005563 Ga0068855_100731791 Ga0068855_1007317912 198
293 3300005578 Ga0068854_100550593 Ga0068854_1005505932 198
294 3300005614 Ga0068856_100431283 Ga0068856_1004312832 198
295 3300009093 Ga0105240_10001458 Ga0105240_1000145831 198
296 3300009148 Ga0105243_10194456 Ga0105243_101944562 198
297 3300009545 Ga0105237_10002043 Ga0105237_1000204319 198
298 3300009545 Ga0105237_10232204 Ga0105237_102322042 198
299 3300010375 Ga0105239_10000972 Ga0105239_100009728 198
300 3300013104 Ga0157370_10000960 Ga0157370_1000096028 198
301 3300013105 Ga0157369_10229240 Ga0157369_102292403 198
302 3300014497 Ga0182008_10097007 Ga0182008_100970072 198
303 3300015265 Ga0182005_1014324 Ga0182005_10143243 198
304 3300025233 Ga0209437_104542 Ga0209437_1045422 198
305 3300025253 Ga0209677_101654 Ga0209677_1016546 198
306 3300025261 Ga0209233_1000148 Ga0209233_1000148150 198
307 3300025913 Ga0207695_10001420 Ga0207695_100014208 198
308 3300025914 Ga0207671_10000934 Ga0207671_1000093435 198
309 3300025949 Ga0207667_10662090 Ga0207667_106620902 198
310 3300025981 Ga0207640_10066981 Ga0207640_100669814 198
311 3300026078 Ga0207702_10246247 Ga0207702_102462472 198
312 3300037418 Ga0395900_0091716 Ga0395900_0091716_564_1160 198
313 3300037471 Ga0395905_0132795 Ga0395905_0132795_63_659 198
314 3300037471 Ga0395905_0409950 Ga0395905_0409950_240_836 198
315 3300048903 Ga0496100_0033280 Ga0496100_0033280_1598_2200 198
316 3300048904 Ga0496101_0015691 Ga0496101_0015691_3684_4286 198
317 3300048905 Ga0496102_0015390 Ga0496102_0015390_4492_5094 198
318 3300048906 Ga0496103_0080479 Ga0496103_0080479_456_1058 198
319 3300048907 Ga0496104_0977142 Ga0496104_0977142_68_670 198
320 3300048908 Ga0496105_0324563 Ga0496105_0324563_405_1007 198
321 3300048909 Ga0496106_0375546 Ga0496106_0375546_229_831 198
322 3300048916 Ga0496113_0113044 Ga0496113_0113044_1044_1646 198
323 3300048919 Ga0496116_0006856 Ga0496116_0006856_4756_5358 198
324 3300048920 Ga0496117_0002281 Ga0496117_0002281_4104_4706 198
325 3300048921 Ga0496118_0002480 Ga0496118_0002480_4104_4706 198
326 3300048922 Ga0496119_0005480 Ga0496119_0005480_4104_4706 198
327 3300048923 Ga0496120_0007918 Ga0496120_0007918_4104_4706 198
328 3300048924 Ga0496121_0002956 Ga0496121_0002956_4104_4706 198
329 3300048925 Ga0496122_0012900 Ga0496122_0012900_4562_5164 198
330 3300048926 Ga0496123_0009202 Ga0496123_0009202_3081_3683 198
331 3300048927 Ga0496124_0018846 Ga0496124_0018846_3167_3769 198
332 3300048928 Ga0496125_0006233 Ga0496125_0006233_3037_3639 198
333 3300048929 Ga0496126_0325455 Ga0496126_0325455_339_941 198
334 iso_pu_bacteria 2615840626 2616312766 198
335 3300010375 Ga0105239_10153482 Ga0105239_101534822 200
336 3300048928 Ga0496125_0001507 Ga0496125_0001507_6389_7009 200
337 3300001979 JGI24740J21852_10000010 JGI24740J21852_1000001015 201
338 3300002704 JGI25155J39150_1000044 JGI25155J39150_10000446 201
339 3300002705 JGI25156J39149_1000058 JGI25156J39149_100005887 201
340 3300002737 JGI25162J39368_1000143 JGI25162J39368_100014377 201
341 3300002737 JGI25162J39368_1000510 JGI25162J39368_100051025 201
342 3300002738 JGI25154J39366_1000174 JGI25154J39366_10001746 201
343 3300002741 JGI25157J39369_1000078 JGI25157J39369_100007886 201
344 3300002773 JGI25152J39213_1003685 JGI25152J39213_10036855 201
345 3300002774 JGI25150J39212_1003026 JGI25150J39212_10030264 201
346 3300003214 JGI25165J46597_1000356 JGI25165J46597_100035656 201
347 3300003214 JGI25165J46597_1001997 JGI25165J46597_10019973 201
348 3300003215 JGI25153J46596_10007938 JGI25153J46596_100079385 201
349 3300003316 rootH1_10088509 rootH1_100885092 201
350 3300003322 rootL2_10062776 rootL2_100627762 201
351 3300003323 rootH1_10054196 rootH1_100541964 201
352 3300003323 rootH1_10055586 rootH1_100555864 201
353 3300003323 rootH1_10279867 rootH1_102798672 201
354 3300005614 Ga0068856_100198311 Ga0068856_1001983113 201
355 3300013100 Ga0157373_10349633 Ga0157373_103496332 201
356 3300025206 Ga0209435_100054 Ga0209435_1000547 201
357 3300025233 Ga0209437_100051 Ga0209437_100051280 201
358 3300025233 Ga0209437_100098 Ga0209437_100098123 201
359 3300025245 Ga0207425_1002118 Ga0207425_10021185 201
360 3300025246 Ga0209646_1000170 Ga0209646_10001707 201
361 3300025246 Ga0209646_1006431 Ga0209646_10064312 201
362 3300025246 Ga0209646_1006451 Ga0209646_10064512 201
363 3300025250 Ga0209026_1000193 Ga0209026_10001937 201
364 3300025256 Ga0209759_1000222 Ga0209759_10002227 201
365 3300025258 Ga0209129_1002027 Ga0209129_10020276 201
366 3300025261 Ga0209233_1000095 Ga0209233_1000095240 201
367 3300025261 Ga0209233_1000113 Ga0209233_100011363 201
368 3300025294 Ga0209025_1022170 Ga0209025_10221702 201
369 3300025297 Ga0209758_1001226 Ga0209758_100122622 201
370 3300026078 Ga0207702_10164930 Ga0207702_101649303 201
371 3300046453 Ga0495627_078797 Ga0495627_078797_258_863 201
372 3300046501 Ga0495607_0046206 Ga0495607_0046206_1413_2018 201
373 3300046506 Ga0495583_0007467 Ga0495583_0007467_3409_4053 201
374 3300046506 Ga0495583_0039224 Ga0495583_0039224_1407_2012 201
375 3300046512 Ga0495610_0045216 Ga0495610_0045216_1449_2054 201
376 3300046515 Ga0495620_0181358 Ga0495620_0181358_93_698 201
377 3300046520 Ga0495637_0048233 Ga0495637_0048233_108_713 201
378 3300046530 Ga0495654_0169324 Ga0495654_0169324_63_668 201
379 3300046538 Ga0495609_0038914 Ga0495609_0038914_291_896 201
380 3300046558 Ga0495633_0072267 Ga0495633_0072267_747_1364 201
381 3300046660 Ga0495625_0141102 Ga0495625_0141102_998_1603 201
382 3300046674 Ga0495588_0044967 Ga0495588_0044967_1389_1994 201
383 3300047443 Ga0495687_031032 Ga0495687_031032_419_1024 201
384 3300047470 Ga0495681_0081322 Ga0495681_0081322_291_896 201
385 3300048920 Ga0496117_0144868 Ga0496117_0144868_713_1330 201
386 3300048921 Ga0496118_0204587 Ga0496118_0204587_144_761 201
387 3300048922 Ga0496119_0018234 Ga0496119_0018234_988_1605 201
388 3300048923 Ga0496120_0085668 Ga0496120_0085668_971_1588 201
389 3300048924 Ga0496121_0019531 Ga0496121_0019531_686_1324 201
390 3300048925 Ga0496122_0031975 Ga0496122_0031975_1668_2285 201
391 3300048925 Ga0496122_0056314 Ga0496122_0056314_337_969 201
392 3300048927 Ga0496124_0042262 Ga0496124_0042262_2666_3298 201
393 3300048927 Ga0496124_0105688 Ga0496124_0105688_801_1418 201
394 3300048928 Ga0496125_0000207 Ga0496125_0000207_63982_64614 201
395 3300048928 Ga0496125_0077795 Ga0496125_0077795_829_1446 201
396 3300049460 Ga0495682_0075883 Ga0495682_0075883_389_994 201
397 3300053107 Ga0500560_089446 Ga0500560_089446_51_656 201
398 3300053125 Ga0500618_008806 Ga0500618_008806_846_1451 201
399 3300053137 Ga0500561_0010369 Ga0500561_0010369_1047_1652 201
400 3300053177 Ga0500636_0054103 Ga0500636_0054103_444_1049 201
401 3300053177 Ga0500636_0231406 Ga0500636_0231406_260_922 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

44

88

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8484 11 92
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8434 8 191
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.829 8 189
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8255 8 187
4yze-assembly1.cif.gz_C crystal structure of e.coli nemr reduced form 0.8206 11 188
ID Description Score Start End Superfamily
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9867 11 53 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9789 10 53 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9737 9 53 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9666 11 58 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9651 11 58 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7C3C6A3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9445 1 193 GO:0003677
GO:0006355
AF-J0L238-F1-model_v4 Transcriptional regulator 0.9441 1 197 GO:0003677
GO:0006355
AF-A0A7Z1R779-F1-model_v4 deleted 0.9414 1 194
AF-A0A522E697-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9404 34 197 GO:0003677
AF-A0A1B4Q3A0-F1-model_v4 TetR family transcriptional regulator 0.9398 1 201 GO:0003677

Feature Viewer

pLDDT pTM Quality
86.2 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map